WorldWideScience

Sample records for w. b. mc guire-1 reactor

  1. Safety-evaluation report related to operation of McGuire Nuclear Station, Units 1 and 2. Docket Nos. 50-369 and 50-370

    International Nuclear Information System (INIS)

    1983-05-01

    This report supplements the Safety Evaluation Report Related to the Operation of McGuire Nuclear Station, Units 1 and 2 (SER (NUREG-0422)) issued in March 1978 by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission with respect to the application filed by Duke Power Company, as applicant and owner, for licenses to operate the McGuire Nuclear Station, Units 1 and 2 (Docket Nos. 50-369 and 50-370). The facility is located in Mecklenburg County, North Carolina, about 17 mi north-northwest of Charlotte, North Carolina. This supplement provides information related to issuance of a full-power authorization for Unit 2. The staff concludes that the McGuire Nuclear Station can be operated by the licensee without endangering the health and safety of the public

  2. McGuire snubber elimination program

    International Nuclear Information System (INIS)

    Cloud, R.L.; Leung, J.S.M.; Taylor, W.H.; Morgan, R.L. Jr.

    1993-01-01

    An engineering program has been initiated at McGuire Nuclear Stations 1 and 2 to eliminate all existing snubbers. The elimination is achieved by replacing existing snubbers with limit stop pipe supports. The program establishes plant-wide modification procedures for one-to-one substitution under the 10 CFR 50.59 requirement. Nuclear Regulatory Commission (NRC) acceptance is based on the results of both comparison analyses and the hardware implementation of sample piping systems at McGuire nuclear stations. Experimental results obtained on shake table testing and from the NRC sponsored HDR research program are also used to formulate the technical basis and design procedures for plant-wide implementation of the snubber replacement effort. The overall program plan is for nearly 3,000 snubbers to be replaced in phases consistent with the plant scheduled outages. Duke Power estimates the program, when completed, will maintain ALARA, improve reliability, and reduce plant operating costs

  3. 75 FR 43572 - Duke Energy Carolinas, LLC, McGuire Nuclear Station, Units 1 and 2; Environmental Assessment and...

    Science.gov (United States)

    2010-07-26

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-369 and 50-370; NRC-2010-0259] Duke Energy Carolinas, LLC, McGuire Nuclear Station, Units 1 and 2; Environmental Assessment and Finding of No Significant... Energy Carolinas, LLC (the licensee), for operation of the McGuire Nuclear Station, Units 1 and 2...

  4. Robotic filter handling at McGuire nuclear station

    International Nuclear Information System (INIS)

    Hilley, J.R. Jr.; Twiggs, J.G.

    1988-01-01

    The application of a robotics system for the packaging of radioactive spent filters was justified on the basis of radiation dose savings, i.e., ALARA considerations, and the benefits associated with defining additional applications of this technology once experienced is gained. This particular gantry-mounted manipulator system was chosen for its ease of relocation and potential use in other hazardous areas at the McGuire nuclear station. The initial investment is estimated to be recovered in 6 to 7 yr. The robotic system is on site at McGuire, with installation and bunker modifications currently scheduled for completion in 1988. Personnel training on the system will start shortly thereafter

  5. Auxiliary feedwater system risk-based inspection guide for the McGuire nuclear power plant

    International Nuclear Information System (INIS)

    Bumgardner, J.D.; Lloyd, R.C.; Moffitt, N.E.; Gore, B.F.; Vo, T.V.

    1994-05-01

    In a study sponsored by the US Nuclear Regulatory Commission (NRC), Pacific Northwest Laboratory has developed and applied a methodology for deriving plant-specific risk-based inspection guidance for the auxiliary feedwater (AFW) system at pressurized water reactors that have not undergone probabilistic risk assessment (PRA). This methodology uses existing PRA results and plant operating experience information. Existing PRA-based inspection guidance information recently developed for the NRC for various plants was used to identify generic component failure modes. This information was then combined with plant-specific and industry-wide component information and failure data to identify failure modes and failure mechanisms for the AFW system at the selected plants. McGuire was selected as one of a series of plants for study. The product of this effort is a prioritized listing of AFW failures which have occurred at the plant and at other PWRs. This listing is intended for use by NRC inspectors in the preparation of inspection plans addressing AFW risk-important components at the McGuire plant

  6. 76 FR 24538 - Duke Energy Carolinas, LLC; Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station...

    Science.gov (United States)

    2011-05-02

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-413 and 50-414; NRC-2011-0100; Docket Nos. 50-369 and 50-370; Docket Nos. 50-269, 50-270, and 50-287] Duke Energy Carolinas, LLC; Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station, Units 1 and 2; Oconee Nuclear Station, Units 1, 2, and 3...

  7. Westinghouse power distribution monitoring experience at Duke Power's McGuire Unit 1

    International Nuclear Information System (INIS)

    Grobmyer, L.R.; Cash, M.T.; Kitlan, M.S.; Impink, A.J. Jr.

    1987-01-01

    In the evolution of the Westinghouse methodology of assuring safe core power distributions, emphasis was placed on analysis and not on continuous detailed core monitoring. Power distribution monitoring is currently achieved by periodic surveillances using the movable in-core detector system (MIDS) and by continuous observations of the two-section excore power range detectors. Control of the power distribution is regulated by limits on the indications from these systems, by limits on control rod insertion, and by operational constraints on the position indication systems. As more plants come on line and as more utilities take over the fuel design function for themselves, the desire for better core monitoring becomes evident. Also, the need and desire by the utilities to have more control over their operating margin has motivated the industry to offer and/or upgrade core monitoring systems. Westinghouse and Duke Power are participants in a joint development program to finalize the development of the core on-line surveillance monitoring and operations system (COSMOS). This final stage of development consists of prototype field trials at the McGuire Nuclear Plant. The purpose of the prototype program is to determine how well the design objectives are met and how to improve the system based on the operating experience at McGuire. Another purpose of this prototype program is to generate the necessary experience and information to develop a topical report for the US Nuclear Regulatory Commission to obtain a licensing basis for technical specification relaxation

  8. 76 FR 40754 - Duke Energy Carolinas, LLC Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station, Units...

    Science.gov (United States)

    2011-07-11

    ... NUCLEAR REGULATORY COMMISSION [NRC-2011-0100; Docket Nos. 50-413 and 50-414; Docket Nos. 50-369 and 50-370; Docket Nos. 50-269, 50-270, And 50-287] Duke Energy Carolinas, LLC Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station, Units 1 and 2; Oconee Nuclear Station, Units 1, 2, and 3; Notice...

  9. System Definition Document: Reactor Data Necessary for Modeling Plutonium Disposition in Catawba Nuclear Station Units 1 and 2

    International Nuclear Information System (INIS)

    Ellis, R.J.

    2000-01-01

    The US Department of Energy (USDOE) has contracted with Duke Engineering and Services, Cogema, Inc., and Stone and Webster (DCS) to provide mixed-oxide (MOX) fuel fabrication and reactor irradiation services in support of USDOE's mission to dispose of surplus weapons-grade plutonium. The nuclear station units currently identified as mission reactors for this project are Catawba Units 1 and 2 and McGuire Units 1 and 2. This report is specific to Catawba Nuclear Station Units 1 and 2, but the details and materials for the McGuire reactors are very similar. The purpose of this document is to present a complete set of data about the reactor materials and components to be used in modeling the Catawba reactors to predict reactor physics parameters for the Catawba site. Except where noted, Duke Power Company or DCS documents are the sources of these data. These data are being used with the ORNL computer code models of the DCS Catawba (and McGuire) pressurized-water reactors

  10. Duke Power Company - McGuire Nuclear Station: steam-generator hideout return and cleanup

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    McGuire Nuclear Station steam generator hideout return and cleanup are discussed. Hideout return data are presented for Unit 1 shutdowns that occurred on November 23, 1984, and April 19, 1985, and a Unit 2 shutdown on January 25, 1985. The data are presented as the concentrations of various species as a function of time after power reduction and primary water temperature. The steam generator blowdown as a function of time after power reduction is also presented. The concentrations of sodium, potassium, calcium, magnesium, aluminum, iron, and copper cations, and chloride, fluoride, sulfate, phosphate and nitrite anions were monitored during the each shutdown. Silica was also measured in the two 1985 shutdowns. The return of sulfate, phosphate, calcium and magnesium showed retrograde solubility. Silica concentrations showed an increase as the temperature decreased to about 450 to 500 0 F and then they decreased as the temperature decreased. McGuire has a holf point at 300 at 350 0 F to clean up the steam generator secondary water. The return of sulfates should occur within 4 to 6 hours. The blowdown is maximized to reduce the secondary water impurity concentrations. Cleanup continues until the sulfate concentration is reduced to below 100 ppb. At that point cooldown is continued

  11. Common-cause failure analysis of McGuire Unit 2 auxiliary feedwater system

    International Nuclear Information System (INIS)

    Rasmuson, D.M.; Shepherd, J.C.; Fowler, R.D.; Summitt, R.L.; Logan, B.W.

    1982-01-01

    A powerful method for qualitative common cause failure analysis (CCFA) of nuclear power plant systems was developed by EG and G Idaho at the Idaho National Engineering Laboratory. As a cooperative project to demonstrate and evaluate the usefulness of the method, the Duke Power Company agreed to allow a CCFA of the auxiliary feedwater system (AFWS) in their McGuire Nuclear Station Unit 2. The results of the CCFA are the subject of this discussion

  12. Waste minimization successes at McGuire Nuclear Station

    International Nuclear Information System (INIS)

    Correll, J.C.; Johnson, G.T.

    1995-01-01

    McGuire Nuclear Station is a two unit, 1125 MWe PWR located 25 miles north of Charlotte, North Carolina. It is a Westinghouse Ice Condenser plant that is owned and operated by Duke Power Company. At Duke Power, open-quotes Culture Changeclose quotes is a common term that we have used to describe the incredible transformation that we are making to become a cost conscious, customer driven, highly competitive business. Nowhere has this change been more evident then in the way we process and disposed of our solid radioactive waste. With top-down management support, we have used team-based, formalized, problem solving methods and have implemented many successful waste minimization programs. Through these programs, we have dramatically increased employees close-quote awareness of the importance of waste minimization. As a result, we have been able to reduce both our burial volumes and our waste processing and disposal costs

  13. Aerial radiological survey of the William B. McGuire Nuclear Station and surrounding area, Cowans Ford Dam, North Carolina, April 13-24, 1981

    International Nuclear Information System (INIS)

    Hobaugh, J.L.

    1981-08-01

    An aerial radiological survey was performed from 13 to 24 April 1981 over a 235 square kilometer area centered on the William B. McGuire Nuclear Station at Cowans Ford Dam, North Carolina. All gamma-photon data were collected by flying North-South lines spaced 228 meters apart at an altitude of 122 meters above ground level. Processed data showed that all gamma-photons detected within the survey area were those expected from naturally occurring terrestrial background emitters. Count rates obtained from the aerial platform were converted to exposure rates at 1 meter above the ground and are presented in the form of an isoradiation contour map. The observed exposure rates were between 5 and 22 microroentgens per hour (μR/h), with most of the area ranging from 5 to 9 μR/h. These values include an estimated cosmic ray contribution of 4.0 μR/h. The exposure rate obtained from soil samples taken from within the survey site displayed positive agreement with the aerial data

  14. Final environmental statement for William B. McGuire Nuclear Station, Units 1 and 2: (Docket Nos. 50-369 and 50-370)

    International Nuclear Information System (INIS)

    1976-04-01

    The proposed action is the issuance of operating licenses to the Duke Power Company for the startup and operation of the William B. McGuire Nuclear Station, Units 1 and 2 (the plant) located on the Lake Norman in Mecklenburg County, 17 miles north-northwest of Charlotte, North Carolina. The units will be cooled by once-through flow of water from Lake Norman. Two units, each with a net electrical capacity of 1180 MWe will be added to the resources of the Duke Power Company. This will have a favorable effect on reserve margins and provide a cost savings of $77 to $122 million in production costs in 1979 if the units come on line as scheduled, and cost savings in subsequent years. Approximately 200 acres of rural, partially wooded land owned by the applicant will be unavailable for other uses during the 40-year life of the plant. Approximately 61.6 acres of additional land will be utilized for transmission line corridors and/or switchyard and maintained under controlled conditions. Land-use patterns will necessarily conform to the needs of the application but will not be changed significantly from present usage. At full power, condenser cooling water could be heated to as high as 96/degree/F (35.6/degree/C) as a monthly average and will be discharged at a rate of up to 4492 cfs. The temperature rise of the water will be 16/degree/F (8.8/degree/C) to 32/degree/F (17.8/degree/C) above ambient. The heated water will mix with the cooler water of Lake Norman, where the heat will be dissipated to the atmosphere. The increase in temperature will cause a loss of approximately 31 cfs of water as a result of increased evaporation. 26 figs., 46 tabs

  15. Waste minimization: A team approach at McGuire nuclear

    International Nuclear Information System (INIS)

    Poteat, E.L.

    1995-01-01

    The production of radioactive waste and its subsequent disposal is a costly proposition. Burial of low-level waste (LLW), if available at all, is expensive and getting more so. The availability of disposal options is often subject to the whims and vagaries of political forces that cannot be predicted, let alone controlled in any way by the members of the nuclear community. On-site storage is a limited and, quite often, an extremely difficult process to put into place. After LLW has been generated, various volume reduction techniques are available, but these can vary widely in cost and effectiveness. If and when new disposal sites are available, the waste acceptance criteria may be such that some or all of the volume reduction processes will not produce an acceptable final waste form. Consequently, the best thing to do is probably deceptively simple: Do not generate the waste in the first place. This is the philosophy that McGuire nuclear station operates under, and this paper discusses the team approach that has been developed to support this idea

  16. Duke Power Company's control rod wear program

    International Nuclear Information System (INIS)

    Culp, D.C.; Kitlan, M.S. Jr.

    1990-01-01

    Recent examinations performed at several foreign and domestic pressurized water reactors have identified significant control rod cladding wear, leading to the conclusion that previously believed control rod lifetimes are not attainable. To monitor control rod performance and reduce safety concerns associated with wear, Duke Power Company has developed a comprehensive control rod wear program for Ag-In-Cd and boron carbide (B 4 C) rods at the McGuire and Catawba nuclear stations. Duke Power currently uses the Westinghouse 17 x 17 Ag-In-Cd control rod design at McGuire Unit 1 and the Westinghouse 17 x 17 hybrid B 4 C control rod design with a Ag-In-Cd tip at McGuire Unit 2 and Catawba Units 1 and 2. The designs are similar, with the exception of the absorber material and clad thickness. There are 53 control rods per unit

  17. Power reactor events, May-June 1986

    International Nuclear Information System (INIS)

    Massaro, S.A.

    1986-12-01

    Power Reactor Events is a bi-monthly newsletter that compiles operating experience information about commercial nuclear power plants. This includes summaries of noteworthy events and listings and/or abstracts of USNRC and other documents that discuss safety-related or possible generic issues. It is intended to feed back some of the lessons learned from operational experience to the various plant personnel, i.e., managers, licensed reactor operators, training coordinators, and support personnel. Events at the following plants are reported: McGuire Unit 1; Susquehanna Units 1 and 2; Browns Ferry Units 1, 2, and 3; and River Bend Unit 1

  18. Oblicza wojny w kontekście teorii mediów Marshalla McLuhana

    Directory of Open Access Journals (Sweden)

    Kalina Kukiełko-Rogozińska

    2017-12-01

    Full Text Available Faces of war in the context of Marshall McLuhan's media theory The article shows how Marshall McLuhan’s media theory is used to analyze photographs taken with an iPhone. The reflections were inspired by the blog of the Canadian photographer Rita Leistner, who participated in the media project aimed at familiarizing American soldiers’ families and friends with everyday life of the military contingent in Afghanistan. Leistner, for the first time in her career, used a smartphone instead of professional photographic equipment. Her decision was motivated by the need to edit photographs easily and publish them quickly on the Internet. The result of her work was a blog, titled Looking for Marshall McLuhan in Afghanistan. To describe her photographs, Leistner uses selected concepts defined by McLuhan in the second half of the 20th century: probe, extension of man or figure-background dichotomy. In consequence, the technological face of war can be better understood by the viewers of the materials she prepared.   Oblicza wojny w kontekście teorii mediów Marshalla McLuhana W artykule przedstawiono sposób wykorzystania teorii mediów Marshalla McLuhana do analizy zdjęć wykonanych iPhone’em. Inspiracją do tych rozważań jest blog kanadyjskiej fotografki Rity Leistner, uczestniczki projektu medialnego, którego celem było zapoznanie rodzin i przyjaciół amerykańskich żołnierzy z codziennym życiem wojskowego kontyngentu w Afganistanie. Leistner, po raz pierwszy w karierze, używała smartfonu zamiast profesjonalnego sprzętu fotograficznego. Wynikało to z konieczności łatwego edytowania zdjęć i ich szybkiego umieszczania w internecie. Efektem tej pracy jest blog zatytułowany Looking for Marshall McLuhan in Afghanistan. Aby opisać swoje fotografie, Leistner użyła bowiem wybranych koncepcji sformułowanych przez kanadyjskiego myśliciela w drugiej połowie XX wieku: sondy, przedłużenia człowieka czy dychotomii figura/tło. Dzi

  19. The old lady says "no": the language of denial in Brian Friel's The Loves of Cass McGuireDOI:10.5007/2175-8026.2010n58p53

    Directory of Open Access Journals (Sweden)

    Giovanna Tallone

    2010-01-01

    Full Text Available In Brian Friel's The Loves of Cass McGuire the presence of negative expressions both in stage directions and dialogue acts as a structuring principle and emphasizes the metadramatic construction of the play. Negative forms underlie Cass's growing awareness of disappointment and hopelessness, denying the "loves" ironically mentioned in the title. Only the alternative imaginary recreation of her own life - her "rhapsody" - is significantly marked by the absence of negative forms. The language of denial is thus both subject and object in the play.

  20. IRPHE/B and W-SS-LATTICE, Spectral Shift Reactor Lattice Experiments

    International Nuclear Information System (INIS)

    2003-01-01

    Description: B and W has performed and analysed a series of physics experiments basically concerned with the technology of heterogeneous reactors moderated and cooled by a variable mixture of heavy and light water. A reactor so moderated is termed Spectral Shift Control Reactor (S SCR). In the practical application of this concept, the moderator mixture is rich in heavy water at the beginning of core life, so a relatively large fraction of the neutrons are epithermal and are absorbed in the fertile material. As fuel is consumed, the moderator is diluted with light water. In this way the neutron spectrum is shifted, thereby increasing the proportion of thermal neutrons and the reactivity of the system. The general objective of the S SCR Basic Physics Program was to study the nuclear properties of rod lattices moderated by D 2 O-H 2 O mixtures. The volume ratio of moderator to non-moderator in all lattices was approximately 1.0, and the fuel was either 4%-enriched UO 2 clad in stainless steel or 93%-enriched UO 2 -ThO 2 (Nth/N 15) pellets clad in aluminum. The D 2 O concentration in the moderator ranged from zero to about 90 mole %. The experimental program includes critical experiments with both types of fuel, exponential experiments at room temperature with both types of fuel, exponential experiments at elevated temperatures with the 4%-enriched UO 2 fuel, and neutron age measurements in ThO 2 lattices. The theoretical program included the development of calculation methods applicable to these systems, and the analysis and correlation of the experimental data. A first report provides the results of critical experiments performed under the Spectral Shift Control Reactor Basic Physics Program. A second report documents experimental results and theoretical interpretation of a series of twenty uniform lattice critical experiments in which the neutron spectrum is varied over a fairly broad range. A third report addresses issues that bear on the problems associated with

  1. An extended conventional fuel cycle for the B and W mPower{sup TM} small modular nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Scarangella, M. J. [Babcock and Wilcox Company, 109 Ramsey Place, Lynchburg, VA 24502 (United States)

    2012-07-01

    The B and W mPower{sup TM} reactor is a small pressurized water reactor (PWR) with an integral once-through steam generator and a thermal output of about 500 MW; it is intended to replace aging fossil power plants of similar output. The core is composed of 69 reduced-height PWR assemblies with the familiar 17 x 17 fuel rod array. The Babcock and Wilcox Company (B and W) is offering a core loading and cycle management plan for a four-year cycle based on its presumed attractiveness to potential customers. This option is a once-through fuel cycle in which the entire core is discharged and replaced after four years. In addition, a conventional fuel utilization strategy, employing a periodic partial reload and shuffle, was developed as an alternative to the four-year once-through fuel cycle. This study, which was performed using the Studsvik core design code suite, is a typical multi-cycle projection analysis of the type performed by most fuel management organizations such as fuel vendors and utilities. In the industry, the results of such projections are used by the financial arms of these organizations to assist in making long-term decisions. In the case of the B and W mPower reactor, this analysis demonstrates flexibility for customers who consider the once-through fuel cycle unacceptable from a fuel utilization standpoint. As expected, when compared to the once-through concept, reloads of the B and W mPower reactor will achieve higher batch average discharge exposure, will have adequate shut-down margin, and will have a relatively flat hot excess reactivity trend at the expense of slightly increased peaking. (authors)

  2. 77 FR 62249 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-10-12

    ...: 793 sf. for b-574; 92 sf. for b-740; usage varies; properties located in secured area; need military... approval from Security Police 2 Buildings Joint Base McGuire-Dix-Lakehurst Ft. Dix NJ 08640 Landholding... military installation; public access denied & no alternative method to gain access w/out compromising nat'l...

  3. McClellan Nuclear Radiation Center (MNRC) TRIGA reactor: Four years of operations

    International Nuclear Information System (INIS)

    Heidel, C.C.; Richards, W.J.

    1994-01-01

    McClellan Air Force Base, at Sacramento, California, is headquarters for the Sacramento Air Force Logistics Center (SM-ALC). McClellan Air Force Base provides extensive inspection and maintenance capabilities for the F-111, F-1 5, and other military aircraft. Criticality of the MNRC TRIGA reactor was obtained on January 20, 1990 with 63 standard TRIGA fuel elements, three fuel-followed control rods and one air-followed control rod. Presently there are 93 fuel elements in the reactor core. The reactor can be operated at 1 MW steady state power, producing pulses up to three dollars worth of reactivity addition, and can be square waved up to 1 MW. The reactor core contains a circular grid plate and a graphite reflector assembly surrounding the core. Four tangential beam ports installed in the reflector assembly provide a thermal neutron flux to four radiography bays. The reactor tank is twenty-four (24) feet deep, seven and one-half (7.5) feet in diameter, and has a protrusion in the upper portion of the reactor tank. This protrusion is scheduled for use as a neutron thermal collimator in the future. Besides the neutron radiography capabilities, the reactor contains a pneumatic rabbit system, a central thimble, an in-core irradiation facility, and three additional cutouts that provide locations for additional irradiation facilities. The central thimble can be removed along with the B-ring locations of the upper portion of the grid plate to provide an additional and larger in-core irradiation facility. A new upper grid plate has been manufactured to expand one triangular cutout so that larger experiments can be inserted directly into the reactor core. Some operational problems experienced during the first four years of operations are the timeout of the CSC and DAC watchdogs, deterioration of the heat exchanger gaskets, and loss of thermocouples in the instrumented fuel elements. (author)

  4. Selecting a MAPLE research reactor core for 1-10 mW operation

    International Nuclear Information System (INIS)

    Smith, H.J.; Roy, M.-F.; Carlson, P.A.

    1986-06-01

    The MAPLE class of research reactors is designed so that a single reactor concept can satisfy a wide range of practical applications. This paper reports the results of physics studies performed on a number of potential core configurations fuelled with either 5 w/o or 8 w/o enriched UO 2 or 20 w/o U 3 Si-Al and assesses the relative merits of each. Recommended core designs are given to maximize the neutron fluxes available for scientific application and isotope production

  5. Study on development of ASCFR1.0/MC and initial calculation of moderator temperature effect for ASCFR

    International Nuclear Information System (INIS)

    Li Zhifeng; Yu Tao; Xie Jinsen

    2013-01-01

    In order to develop the temperature-dependent point-wise cross section library for the advanced supercritical water cooled fast reactor, the JEZEBEL fast neutron benchmark was used to analyze the important parameters of the NJOY code and compare the different effects of the input parameters. Then the most reasonable parameters were selected to develop the ASCFR1.0/MC which was based on the ENDF/B-VII.1. Finally, the Doppler coefficient benchmark was applied to test and verify the ASCFR.10/MC. In conclusion, the precision of the ASCFR1.0/MC were perfect. The resulted library can be used in the analysis and verification of the temperature effect in the Advanced Supercritical Fast Reactor (ASCFR), Finally, the moderator effect of ASCFR was calculated with MCNP using the ASCFR1.0/MC library, and the moderator effect of the ASCFR is positive. (authors)

  6. Human Parvovirus B19 NS1 Protein Aggravates Liver Injury in NZB/W F1 Mice

    Science.gov (United States)

    Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Hsu, Huai-Sheng; Tzang, Bor-Show; Hsu, Tsai-Ching

    2013-01-01

    Human parvovirus B19 (B19) has been associated with a variety of diseases. However, the influence of B19 viral proteins on hepatic injury in SLE is still obscure. To elucidate the effects of B19 viral proteins on livers in SLE, recombinant B19 NS1, VP1u or VP2 proteins were injected subcutaneously into NZB/W F1 mice, respectively. Significant expressions of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) were detected in NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Markedly hepatocyte disarray and lymphocyte infiltration were observed in livers from NZB/WF 1 mice receiving B19 NS1 as compared to those mice receiving PBS. Additionally, significant increases of Tumor Necrosis Factor –α (TNF-α), TNF-α receptor, IκB kinase –α (IKK-α), nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor (IκB) and nuclear factor-kappa B (NF-κB) were detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Accordingly, significant increases of matrix metalloproteinase-9 (MMP9) and U-plasminogen activator (uPA) were also detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Contrarily, no significant variation on livers from NZB/W F1 mice receiving B19 VP1u or VP2 was observed as compared to those mice receiving PBS. These findings firstly demonstrated the aggravated effects of B19 NS1 but not VP1u or VP2 protein on hepatic injury and provide a clue in understanding the role of B19 NS1 on hepatic injury in SLE. PMID:23555760

  7. Red hair is the null phenotype of MC1R.

    Science.gov (United States)

    Beaumont, Kimberley A; Shekar, Sri N; Cook, Anthony L; Duffy, David L; Sturm, Richard A

    2008-08-01

    The Melanocortin-1 Receptor (MC1R) is a G-protein coupled receptor, which is responsible for production of the darker eumelanin pigment and the tanning response. The MC1R gene has many polymorphisms, some of which have been linked to variation in pigmentation phenotypes within human populations. In particular, the p.D84E, p.R151C, p.R160W and p.D294 H alleles have been strongly associated with red hair, fair skin and increased skin cancer risk. These red hair colour (RHC) variants are relatively well described and are thought to result in altered receptor function, while still retaining varying levels of signaling ability in vitro. The mouse Mc1r null phenotype is yellow fur colour, the p.R151C, p.R160W and p.D294 H alleles were able to partially rescue this phenotype, leading to the question of what the true null phenotype of MC1R would be in humans. Due to the rarity of MC1R null alleles in human populations, they have only been found in the heterozygous state until now. We report here the first case of a homozygous MC1R null individual, phenotypic analysis indicates that red hair and fair skin is found in the absence of MC1R function.

  8. High thermal stability in W/MgO/CoFeB/W/CoFeB/W stacks via ultrathin W insertion with perpendicular magnetic anisotropy

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yi; Yu, Tao [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); Zhu, Zhengyong; Zhong, Huicai [Institute of Microelectronics, Chinese Academy of Sciences, Beijing 100029 (China); Khamis, Khamis Masoud [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); Zhu, Kaigui, E-mail: kgzhu@buaa.edu.cn [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Micro-Nano Measurement-Manipulation and Physics, Ministry of Education, Beihang University, Beijing 100191 (China)

    2016-07-15

    The perpendicular magnetic anisotropy (PMA) of a series of top MgO/CoFeB/W stacks were studied. In these stacks, the thickness of CoFeB is limited in a range of 1.1–2.2 nm. It was found that the stack can still maintain PMA in a 1.9 nm thick CoFeB free layer. Besides, we investigated the thermal stability factor ∆ of a spin transfer torque magnetic random access memory (STT-MRAM) by inserting an ultra-thin W film of 0.8 nm between two CoFeB films. The result shows a clear PMA behavior for the samples with CoFeB thickness up to 2.5 nm, and an in-plane magnetic anisotropy (IMA) when the CoFeB is thicker than 2.5 nm. Moreover, the thermal stability factor ∆ of the CoFeB stack with W insertion is about 132 for a 50 nm size STT-MRAM device, which is remarkably improved compared to 112 for a sample without W insertion. Our results represent an alternative way to realize the endurance at high annealing temperature, high-density and high ∆ in STT-MRAM device by ultra-thin W insertion. - Highlights: • The MgO/CoFeB/W multilayer can still maintain PMA in a CoFeB thickness of 1.9 nm. • The sample with 2.5 nm thickness of CoFeB by W insertion can still maintain PMA. • The sample with W insertion can still maintain PMA until the annealing temperature as high as 350 °C. • The thermal stability factor ∆ of sample with W insertion could be increase to about 132 for a 50 nm size STT-MRAM device.

  9. β1-C121W Is Down But Not Out: Epilepsy-Associated Scn1b-C121W Results in a Deleterious Gain-of-Function

    Science.gov (United States)

    Kruger, Larisa C.; O'Malley, Heather A.; Hull, Jacob M.; Kleeman, Amanda; Patino, Gustavo A.

    2016-01-01

    Voltage-gated sodium channel (VGSC) β subunits signal through multiple pathways on multiple time scales. In addition to modulating sodium and potassium currents, β subunits play nonconducting roles as cell adhesion molecules, which allow them to function in cell–cell communication, neuronal migration, neurite outgrowth, neuronal pathfinding, and axonal fasciculation. Mutations in SCN1B, encoding VGSC β1 and β1B, are associated with epilepsy. Autosomal-dominant SCN1B-C121W, the first epilepsy-associated VGSC mutation identified, results in genetic epilepsy with febrile seizures plus (GEFS+). This mutation has been shown to disrupt both the sodium-current-modulatory and cell-adhesive functions of β1 subunits expressed in heterologous systems. The goal of this study was to compare mice heterozygous for Scn1b-C121W (Scn1b+/W) with mice heterozygous for the Scn1b-null allele (Scn1b+/−) to determine whether the C121W mutation results in loss-of-function in vivo. We found that Scn1b+/W mice were more susceptible than Scn1b+/− and Scn1b+/+ mice to hyperthermia-induced convulsions, a model of pediatric febrile seizures. β1-C121W subunits are expressed at the neuronal cell surface in vivo. However, despite this, β1-C121W polypeptides are incompletely glycosylated and do not associate with VGSC α subunits in the brain. β1-C121W subcellular localization is restricted to neuronal cell bodies and is not detected at axon initial segments in the cortex or cerebellum or at optic nerve nodes of Ranvier of Scn1bW/W mice. These data, together with our previous results showing that β1-C121W cannot participate in trans-homophilic cell adhesion, lead to the hypothesis that SCN1B-C121W confers a deleterious gain-of-function in human GEFS+ patients. SIGNIFICANCE STATEMENT The mechanisms underlying genetic epilepsy syndromes are poorly understood. Closing this gap in knowledge is essential to the development of new medicines to treat epilepsy. We have used mouse models to

  10. The Army Communications Objectives Measurement System (ACOMS): Survey Analysis Plan

    Science.gov (United States)

    1988-05-01

    Analysis Plan 12. PERSONAL AUTHOR(S) Gregory H. Gaertner (Westat) and Timothy W. Elig (ARI), editors 13a. TYPE OF REPORT 13b. TIME COVERED 14. DATE OF...such as those of Lavidge and Steiner (1961), McGuire (1969), and Fishbein and Azjen (1975). Fishbein and Azjen (1975) and Aaker (1975) present...for college, challenge and personal development, or patriotic service). Corresponding to these beliefs are evaluations of the importance of these

  11. Exacerbating effects of human parvovirus B19 NS1 on liver fibrosis in NZB/W F1 mice.

    Directory of Open Access Journals (Sweden)

    Tsai-Ching Hsu

    Full Text Available Systemic lupus erythematosus (SLE is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19 is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling.

  12. Exacerbating Effects of Human Parvovirus B19 NS1 on Liver Fibrosis in NZB/W F1 Mice

    Science.gov (United States)

    Hsu, Tsai-Ching; Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Tzang, Bor-Show

    2013-01-01

    Systemic lupus erythematosus (SLE) is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19) is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling. PMID:23840852

  13. Enhancement of Tokamak Fusion Test Reactor performance by lithium conditioning

    International Nuclear Information System (INIS)

    Mansfield, D.K.; Hill, K.W.; Strachan, J.D.; Bell, M.G.; Scott, S.D.; Budny, R.; Marmar, E.S.; Snipes, J.A.; Terry, J.L.; Batha, S.; Bell, R.E.; Bitter, M.; Bush, C.E.; Chang, Z.; Darrow, D.S.; Ernst, D.; Fredrickson, E.; Grek, B.; Herrmann, H.W.; Janos, A.; Jassby, D.L.; Jobes, F.C.; Johnson, D.W.; Johnson, L.C.; Levinton, F.M.; Mikkelsen, D.R.; Mueller, D.; Owens, D.K.; Park, H.; Ramsey, A.T.; Roquemore, A.L.; Skinner, C.H.; Stevenson, T.; Stratton, B.C.; Synakowski, E.; Taylor, G.; von Halle, A.; von Goeler, S.; Wong, K.L.; Zweben, S.J.

    1996-01-01

    Wall conditioning in the Tokamak Fusion Test Reactor (TFTR) [K. M. McGuire et al., Phys. Plasmas 2, 2176 (1995)] by injection of lithium pellets into the plasma has resulted in large improvements in deuterium endash tritium fusion power production (up to 10.7 MW), the Lawson triple product (up to 10 21 m -3 s keV), and energy confinement time (up to 330 ms). The maximum plasma current for access to high-performance supershots has been increased from 1.9 to 2.7 MA, leading to stable operation at plasma stored energy values greater than 5 MJ. The amount of lithium on the limiter and the effectiveness of its action are maximized through (1) distributing the Li over the limiter surface by injection of four Li pellets into Ohmic plasmas of increasing major and minor radius, and (2) injection of four Li pellets into the Ohmic phase of supershot discharges before neutral-beam heating is begun. copyright 1996 American Institute of Physics

  14. Characteristics and uses of a 250 kW TRIGA reactor

    International Nuclear Information System (INIS)

    Dimic, V.

    1985-01-01

    The 250 kW TRIGA Mark II reactor is a light water reactor with solid fuel elements in which the zirconium hydride moderator is homogeneously distributed between enriched uranium. Therefore the reactor has the large prompt negative temperature coefficient of reactivity, the fuel also has very high retention of radioactive fission products. The reactor core is a cylindrical configuration with an annular graphite reflector. The experimental facilities include a rotary specimen rack, a central incore radiation thimble, a pneumatic transfer system, and pulsing capability. Other experimental facilities include two radial and two tangential beam tubes, a graphite thermal column, and a graphite thermalizing column. At the steady state power of 250 kW the peak flux is 1x10 13 n/cm 2 s in the central test position. In addition, pulsing to about 2000 MW is usually provided giving peak fluxes of about 2x10 16 n/cm 2 sec. All TRIGA reactors produce a core-average thermal neutron flux of about 10 7 n.v per watt. Only with very large accelerators could such a high neutron flux be achieved. In order to give an appreciation for the research conducted at research reactors, the types of research could be summarized as follows: thermal neutron scattering, neutron radiography, neutron and nuclear physics, activation analysis, radiochemistry, biology and medicine, and teaching and training. Typical applied research with a 250 kW reactor has been conducted in medicine in biology, archeology, metallurgy and materials science, engineering and criminology. It is well known that research reactors have been used routinely to produce isotopes for industry and medicine. In some instances, reactors are the preferred method of isotope production. We can conclude that the 250 kW TRIGA research reactor is a useful and wide ranging source of radiation for basic and applied research. The operation cost for this instrument is relatively low. (author)

  15. Validation of the MC{sup 2}-3/DIF3D Code System for Control Rod Worth via the BFS-75-1 Reactor Physics Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Yun, Sunghwan; Kim, Sang Ji [KAERI, Daejeon (Korea, Republic of)

    2016-05-15

    In this paper, control rod worths of the BFS-75-1 reactor physics experiments were examined using continuous energy MCNP models and deterministic MC2-3/DIF3D models based on the ENDF/B-VII.0 library. We can conclude that the ENDF/B-VII.0 library shows very good agreement in small-size metal uranium fuel loaded core which is surrounded by the depleted uranium blanket. However, the control rod heterogeneity effect reported by the reference is not significant in this problem because the tested control rod models were configured by single rod. Hence comparison with other control rod worth measurements data such as the BFS-109-2A reactor physics experiment is planned as a future study. The BFS-75-1 critical experiment was carried out in the BFS-1 facility of IPPE in Russia within the framework of validating an early phase of KALIMER- 150 design. The Monte-Carlo model of the BFS- 75-1 critical experiment had been developed. However, due to incomplete information for the BFS- 75-1 experiments, Monte-Carlo models had been generated for the reference criticality and sodium void reactivity measurements with disk-wise homogeneous model. Recently, KAERI performed another physics experiment, BFS-109-2A, by collaborating with Russian IPPE. During the review process of the experimental report of the BFS-109-2A critical experiments, valuable information for the BFS-1 facility which can also be used for the BFS-75-1 experiments was discovered.

  16. Safety Evaluation Report related to the renewal of the operating license for the research reactor at Manhattan College (Docket No. 50-199)

    International Nuclear Information System (INIS)

    1985-02-01

    This Safety Evaluation Report for the application filed by Manhattan College (MC) for a renewal of Operating License R-94 to continue to operate the MC 0.1-W open-pool training reactor has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is owned and operated by MC and is located two blocks away from the MC main campus in the Riverdale area of New York City, New York. The staff concludes that the reactor facility can continue to be operated by MC without endangering the health and safety of the public

  17. Thermal power calibration of the TRIGA Mark I IPR-R1 reactor during the upgrading tests to 250 kW

    International Nuclear Information System (INIS)

    Mesquita, Amir Zacarias; Maretti, Fausto Junior; Rezende, Hugo Cesar

    2002-01-01

    This paper presents the results and the methodology used to calibrate the thermal power of the TRIGA MARK I IPR-R1 Reactor in CDTN, Belo Horizonte, Brazil. This calibration was realized during the operation tests carried out to allow the reactor power upgrade from the current 100 kW to 250 kW. The methodology consisted in the measurement of the inlet and outlet temperature and the water flow in the primary cooling loop. The thermal balance together with the thermal losses gave the thermal power. There were made three sequences of tests. The first rising of the thermal power was made with the usual configuration of the core (59 fuel elements). After the changing of the ion chambers position and the control rod and the increase of the number of fuels (63 fuel elements), a new evaluation of the thermal power was accomplished, having been obtained a thermal power of 234 kW, for an indication of 250 kW in the lineal channel. After the return of the core to the initial configuration (59 fuel elements), it took place a new test, getting back the reactor to the power level of 100 kW. (author)

  18. Using Persuasion Models to Identify Givers.

    Science.gov (United States)

    Ferguson, Mary Ann; And Others

    1986-01-01

    Assesses the feasibility of and suggests using W. J. McGuire's information processing theory and cognitive response analysis theory in research studies to identify "givers"--those who are likely to contribute money and resources to charities or volunteer to aid philanthropic organizations. (SRT)

  19. B ampersand W PWR advanced control system algorithm development

    International Nuclear Information System (INIS)

    Winks, R.W.; Wilson, T.L.; Amick, M.

    1992-01-01

    This paper discusses algorithm development of an Advanced Control System for the B ampersand W Pressurized Water Reactor (PWR) nuclear power plant. The paper summarizes the history of the project, describes the operation of the algorithm, and presents transient results from a simulation of the plant and control system. The history discusses the steps in the development process and the roles played by the utility owners, B ampersand W Nuclear Service Company (BWNS), Oak Ridge National Laboratory (ORNL), and the Foxboro Company. The algorithm description is a brief overview of the features of the control system. The transient results show that operation of the algorithm in a normal power maneuvering mode and in a moderately large upset following a feedwater pump trip

  20. A single amino acid substitution within the transmembrane domain of the human immunodeficiency virus type 1 Vpu protein renders simian-human immunodeficiency virus (SHIVKU-1bMC33) susceptible to rimantadine

    International Nuclear Information System (INIS)

    Hout, David R.; Gomez, Lisa M.; Pacyniak, Erik; Miller, Jean-Marie; Hill, M. Sarah; Stephens, Edward B.

    2006-01-01

    Previous studies from our laboratory have shown that the transmembrane domain (TM) of the Vpu protein of human immunodeficiency virus type 1 (HIV-1) contributes to the pathogenesis of SHIV KU-1bMC33 in macaques and that the TM domain of Vpu could be replaced with the M2 protein viroporin from influenza A virus. Recently, we showed that the replacement of the TM domain of Vpu with that of the M2 protein of influenza A virus resulted in a virus (SHIV M2 ) that was sensitive to rimantadine [Hout, D.R., Gomez, M.L., Pacyniak, E., Gomez, L.M., Inbody, S.H., Mulcahy, E.R., Culley, N., Pinson, D.M., Powers, M.F., Wong, S.W., Stephens, E.B., 2006. Substitution of the transmembrane domain of Vpu in simian human immunodeficiency virus (SHIV KU-1bMC33 ) with that of M2 of influenza A results in a virus that is sensitive to inhibitors of the M2 ion channel and is pathogenic for pig-tailed macaques. Virology 344, 541-558]. Based on previous studies of the M2 protein which have shown that the His-X-X-X-Trp motif within the M2 is essential to the function of the M2 proton channel, we have constructed a novel SHIV in which the alanine at position 19 of the TM domain was replaced with a histidine residue resulting in the motif His-Ile-Leu-Val-Trp. The SHIV VpuA19H replicated with similar kinetics as the parental SHIV KU-1bMC33 and pulse-chase analysis revealed that the processing of viral proteins was similar to SHIV KU-1bMC33 . This SHIV VpuA19H virus was found to be more sensitive to the M2 ion channel blocker rimantadine than SHIV M2 . Electron microscopic examination of SHIV VpuA19H -infected cells treated with rimantadine revealed an accumulation of viral particles at the cell surface and within intracellular vesicles, which was similar to that previously observed to SHIV M2 -infected cells treated with rimantadine. These data indicate that the Vpu protein of HIV-1 can be converted into a rimantadine-sensitive ion channel with the alteration of one amino acid and provide

  1. The supernova remnant W49B as seen with H.E.S.S. and Fermi-LAT

    Science.gov (United States)

    H. E. S. S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hadasch, D.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Naurois, M. de; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; los Reyes, R. de; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; Eldik, C. van; Rensburg, C. van; Soelen, B. van; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.; Fermi-LAT Collaboration; Katsuta, J.

    2018-04-01

    The supernova remnant (SNR) W49B originated from a core-collapse supernova that occurred between one and four thousand years ago, and subsequently evolved into a mixed-morphology remnant, which is interacting with molecular clouds (MC). Gamma-ray observations of SNR-MC associations are a powerful tool to constrain the origin of Galactic cosmic rays, as they can probe the acceleration of hadrons through their interaction with the surrounding medium and subsequent emission of non-thermal photons. We report the detection of a γ-ray source coincident with W49B at very high energies (VHE; E > 100 GeV) with the H.E.S.S. Cherenkov telescopes together with a study of the source with five years of Fermi-LAT high-energy γ-ray (0.06-300 GeV) data. The smoothly connected, combined source spectrum, measured from 60 MeV to multi-TeV energies, shows two significant spectral breaks at 304 ± 20 MeV and 8.4-2.5+2.2 GeV; the latter is constrained by the joint fit from the two instruments. The detected spectral features are similar to those observed in several other SNR-MC associations and are found to be indicative of γ-ray emission produced through neutral-pion decay. The H.E.S.S. gamma-ray excess map (see Fig. 1, in FITS format) of the W49 region is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/612/A5

  2. Digital control of research reactors

    International Nuclear Information System (INIS)

    Crump, J.C. III.; Richards, W.J.; Heidel, C.C.

    1991-01-01

    Research reactors provide an important service for the nuclear industry. Developments and innovations used for research reactors can be later applied to larger power reactors. Their relatively inexpensive cost allows research reactors to be an excellent testing ground for the reactors of tomorrow. One area of current interest is digital control of research reactor systems. Digital control systems offer the benefits of implementation and superior system response over their analog counterparts. At McClellan Air Force Base in Sacramento, California, the Stationary Neutron Radiography System (SNRS) uses a 1,000-kW TRIGA reactor for neutron radiography and other nuclear research missions. The neutron radiography beams generated by the reactor are used to detect corrosion in aircraft structures. While the use of the reactor to inspect intact F-111 wings is in itself noteworthy, there is another area in which the facility has applied new technology: the instrumentation and control system (ICS). The ICS developed by General Atomics (GA) contains several new and significant items: (a) the ability to servocontrol on three rods, (b) the ability to produce a square wave, and (c) the use of a software configurator to tune parameters affected by the actual reactor core dynamics. These items will probably be present in most, if not all, future research reactors. They were developed with increased control and overall usefulness of the reactor in mind

  3. Multinode analysis of small breaks for B and W's 205-fuel-assembly nuclear plants with internals vent valves

    International Nuclear Information System (INIS)

    Jones, R.C.; Dunn, B.M.; Parks, C.E.

    1976-03-01

    Multinode analyses were conducted for several small breaks in the reactor coolant system of B and W's 205-fuel-assembly nuclear plants with internals vent valves. The multinode blowdown code CRAFT was used to evaluate the hydrodynamics and transient water inventories of the reactor coolant system. The FOAM code was used to compute a swell level history for the core, and the THETA1-B code was used to perform transient fuel pin thermal calculations. Curves showing the parameters of interest are presented. The results are well within the Final Acceptance Criteria

  4. Multinode analysis of small breaks for B and W's 145-fuel-assembly nuclear plants with internals vent valves

    International Nuclear Information System (INIS)

    Parks, C.E.; Allen, R.J.; Cartin, L.R.

    1976-03-01

    Multinode analyses were conducted for several small breaks in the reactor coolant system of B and W's 145 fuel-assembly nuclear plants with internals vent valves. The multinode blowdown code CRAFT was used to evaluate the hydrodynamics and transient water inventories of the reactor coolant system. The FOAM code was used to compute a swell level history for the core, and the THETA1-B code was used to perform transient fuel pin thermal calculations. Curves showing the parameters of interest are presented. These results are well within the Final Acceptance Criteria

  5. Hydrogen and deuterium transport and inventory parameters through W and W-alloys for fusion reactor applications

    Science.gov (United States)

    Benamati, G.; Serra, E.; Wu, C. H.

    2000-12-01

    The aim of this work is to measure the hydrogen/deuterium transport and inventory parameters in relevant structural and/or armour materials for the International Thermonuclear Experimental Reactor (ITER) divertor such as W and W-alloys. The W-alloys: W, W + 1% La 2O 3 and W + 5% Re have been investigated. The materials were supplied from the Metallwerk Plansee GmbH (Austria). Measurements were conducted using a time-dependent permeation method over the temperature range 673-873 K with hydrogen and deuterium pressures in the range 10-100 kPa (100-1000 mbar). The samples were also characterized using optical microscopy, SEM and energy dispersive spectroscopy (EDS) in order to investigate the composition, microstructure and morphology of the surfaces and cross-sections through the samples.

  6. Age McCanni büroo = Offices of Age McCann

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Rotermanni 8 asuva Age McCanni büroo sisekujundusest. Sisekujunduse autorid: sisearhitekt Kerli Valk (Kukuhaus OÜ) ja arhitekt Tomomi Hayashi (HG Arhitektuur OÜ), nende tähtsamate tööde loetelu

  7. B and W owners group scram reduction efforts

    International Nuclear Information System (INIS)

    Rose, S.T.

    1985-01-01

    Reducing the frequency of reactor scrams is an important and highly visible task. Scram frequency is one indicator of how consistently a unit is operated within desired bounds and hence is a key performance indicator. To be successful and efficient in this undertaking, diligent effort by the individual utilities should be complimented by collective action to resolve generic problems. The Babcock and Wilcox (B and W) Owners Group is committed to improving the productivity of its operating units and, in particular, to reducing the number of scrams experienced at the units. Toward this goal, the owners group has undertaken several initiatives to improve the reliability and performance of systems that historically have reactor trips. This paper describes those efforts and how they were identified

  8. Calcareous nannofossil evidence for Marine Isotope Stage 31 (1 Ma) in the AND-1B Core, ANDRILL McMurdo Ice Shelf Project (Antarctica).

    Science.gov (United States)

    Villa, G.; Persico, D.; Wise, S. W.; Gadaleta, A.

    2009-04-01

    calcareous nannofossils to the margins of Antarctica. The warm interval during the Jaramillo Subchron shows that these areas were more climatically dynamic than previously thought and calls into questions the notion that the EAIS has remained in a stable polar condition since the late Neogene. The warm surface water event reported here is especially significant given its proximal position to the Antarctic ice sheet. References Naish, T., Powell, R., Levy R., Henrys S., Krissek L., Niessen F., Pompilio M., Scherer R., Wilson G. & the ANDRIL-MIS Science Team, 2007. - Synthesis of the Initial Scientific Results of the MIS Project (AND-1B Core), Victoria Land Basin, antartica. Terra Antartica, 14(3), 317-327. Scherer, R., Bohaty, S., Dunbar, R.B., Esper, O., Flores, J.A., Gersonde, R., Harwood, D.M., Roberts, A.P., Taviani, M., 2008. Antarctic records of precession-paced insolation-driven warming during early Pleistocene Marine Isotope Stage 31. Geophys. Res. Lett., vol. 35, L03505, doi: 10.1029/2007GL032254. Villa G. and Wise S.W., 1998 - Quaternary calcareous nannofossils from the Antarctic region. Terra Antartica, 5(3), 479-484. Villa G., Lupi, C., Cobianchi, M., Florindo, F., Pekar, S.F., 2008. A Pleistocene warming event at 1 Ma in Prydz Bay, East Antarctica: evidence from ODP Site 1165. Palaeogeography, Palaoeclimatology, Palaeoecology, doi:10.1016/J.palaeo.2007.08.017. Wilson G., Levy R., Browne G., Dunbar, N., Florindo F., Henrys S., Graham I., McIntosh W., McKay R., Naish T., Ohneiser C., Powell R., Ross J., Sagnotti L., Scherer R., Sjunneskog C., Strong C.P. Taviani M., Winter D., & the ANDRILL MIS-Science Team, 2007. Preliminary Integrated Chronostratigraphy of AND-1B Drill Core, ANDRILL McMurdo Ice Shelf Project, Antarctica. Terra Antartica 14 (3), 297-316.

  9. Heat Flow and Hydrologic Characteristics at the AND-1B borehole, ANDRILL McMurdo Ice Shelf Project, Antarctica

    Science.gov (United States)

    Morin, Roger H.; Williams, Trevor; Henry, Stuart; ,; Hansaraj, Dhiresh

    2010-01-01

    The Antarctic Drilling Program (ANDRILL) successfully drilled and cored a borehole, AND-1B, beneath the McMurdo Ice Shelf and into a flexural moat basin that surrounds Ross Island. Total drilling depth reached 1285 m below seafloor (mbsf) with 98 percent core recovery for the detailed study of glacier dynamics. With the goal of obtaining complementary information regarding heat flow and permeability, which is vital to understanding the nature of marine hydrogeologic systems, a succession of three temperature logs was recorded over a five-day span to monitor the gradual thermal recovery toward equilibrium conditions. These data were extrapolated to true, undisturbed temperatures, and they define a linear geothermal gradient of 76.7 K/km from the seafloor to 647 mbsf. Bulk thermal conductivities of the sedimentary rocks were derived from empirical mixing models and density measurements performed on core, and an average value of 1.5 W/mK ± 10 percent was determined. The corresponding estimate of heat flow at this site is 115 mW/m2. This value is relatively high but is consistent with other elevated heat-flow data associated with the Erebus Volcanic Province. Information regarding the origin and frequency of pathways for subsurface fluid flow is gleaned from drillers' records, complementary geophysical logs, and core descriptions. Only two prominent permeable zones are identified and these correspond to two markedly different features within the rift basin; one is a distinct lithostratigraphic subunit consisting of a thin lava flow and the other is a heavily fractured interval within a single thick subunit.

  10. Development on hybrid evaluated nuclear data library HENDL1.0/MG/MC

    International Nuclear Information System (INIS)

    Xu Dezheng; Gao Chunjing; Zheng Shanliang; Liu Haibo; Zhu Xiaoxiang; Li Jingjing; Wu Yican

    2004-01-01

    A Hybrid Evaluated Nuclear Data Library (HENDL) named as HENDL1.0 has been developed by Fusion Design Study (FDS) team of Institute of Plasma Physics, Academia Sinica (ASIPP) to take into account the requirements in design and research relevant to fusion, fission and fusion-fission sub-critical hybrid reactor. HENDLI1.0 contains one basic evaluated sub-library naming HENDL1.0/E and to processed working sub-libraries naming HENDL1.0/MG and HENDL1.0/MC, respectively. Through carefully comparing, distinguishing and choosing, HENDL1.0/E integrated basic evaluated neutron data files of 213 nuclides from the several main data libraries for evaluated neutron reaction cross sections including ENDF/B-VI (USA), JEF-2.2 (OECD/NEA, Europe), JENDL-3.2 (Japan), CENDL-2 (China), BROND-2 (Russia) and FENDL-2 (IAEA/NDS, ITER program). Based on this, 175-group neutron and 42-group photon neutron-photon coupled multi-group working library HENDL1.0/MG used for discrete ordinate Sn method transport calculation (such as ANISN code) and a compact ENDF form (ACE), continuous energy structure (pointwise) neutron cross section library HENDL1.0/MC for Monte Carlo method transport simulation (as MCMP code) can be attainable with the current group constants processing system NJOY and transport cross section preparation code TRANSX referring to the Vitamin-J energy group structure. In addition, two special bases i.e. transmutation (burnup) library BURNUP. DAT and response function library RESPONSE.DAT, have been also made for fuel cycle calculation and reactivity analyses of nuclear reactor. The relevant sample testing, benchmark checking and primary confirmation are also carried out to assess the validity of multi-purpose data library HENDL1.0. (authors)

  11. Safety operation of training reactor VR-1

    International Nuclear Information System (INIS)

    Matejka, K.

    2001-01-01

    There are three nuclear research reactors in the Czech Republic in operation now: light water reactor LVR-15, maximum reactor power 10 MW t , owner and operator Nuclear Research Institute Rez; light water zero power reactor LR-0, maximum reactor power 5 kW t , owner and operator Nuclear Research Institute Rez and training reactor VR-1 Sparrow, maximum reactor power 5 kW t , owner and operate Faculty of Nuclear Sciences and Physical Engineering, CTU in Prague. The training reactor VR-1 Vrabec 'Sparrow', operated at the Faculty of Nuclear Sciences and Physical Engineering, Czech Technical University in Prague, was started up on December 3, 1990. Particularly it is designed for training the students of Czech universities, preparing the experts for the Czech nuclear programme, as well as for certain research work, and for information programmes in the nuclear programme, as well as for certain research work, and for information programmes in sphere of using the nuclear energy (public relations). (author)

  12. ETOA, ABBN Multigroup Constants from ENDF/B for Fast Reactors

    International Nuclear Information System (INIS)

    Nishimura, Hideo

    1977-01-01

    1 - Nature of physical problem solved: Production of ABBN type group constants up to 70 groups for fast reactor calculations, reading ENDF/B library as input. 2 - Method of solution: The multigroup method of Bondarenko et al. is used for processing basic nuclear data. Calculational algorithms for an unresolved resonance region are the same as those in the MC 2 code. For a resolved resonance region, an ultrafine energy structure dependent on a level scheme is adopted. 3 - Restrictions on the complexity of the problem: Maximum number of: energy groups: 70; sigma 0 values: 6; temperatures: 5. Self-shielding factors for an unrealistically low value of sigma 0 are not guaranteed because of the approximations used in the unresolved resonance region

  13. Reactor control system upgrade for the McClellan Nuclear Radiation Center Sacramento, CA

    International Nuclear Information System (INIS)

    Power, M. A.

    1999-01-01

    Argonne National Laboratory is currently developing a new reactor control system for the McClellan Nuclear Radiation Facility. This new control system not only provides the same functionality as the existing control system in terms of graphic displays of reactor process variables, data archival capability, and manual, automatic, pulse and square-wave modes of operation, but adds to the functionality of the previous control system by incorporating signal processing algorithms for the validation of sensors and automatic calibration and verification of control rod worth curves. With the inclusion of these automated features, the intent of this control system is not to replace the operator but to make the process of controlling the reactor easier and safer for the operator. For instance, an automatic control rod calibration method reduces the amount of time to calibrate control rods from days to minutes, increasing overall reactor utilization. The control rod calibration curve, determined using the automatic calibration system, can be validated anytime after the calibration, as long as the reactor power is between 50W and 500W. This is done by banking all of the rods simultaneously and comparing the tabulated rod worth curves with a reactivity computer estimate. As long as the deviation between the tabulated values and the reactivity estimate is within a prescribed error band, then the system is in calibration. In order to minimize the amount of information displayed, only the essential flux-related data are displayed in graphical format on the control screen. Information from the sensor validation methods is communicated to the operators via messages, which appear in a message window. The messages inform the operators that the actual process variables do not correlate within the allowed uncertainty in the reactor system. These warnings, however, cannot cause the reactor to shutdown automatically. The reactor operator has the ultimate responsibility of using this

  14. Basic research using the 250 kW research reactor of the Jozef Stefan Institute

    International Nuclear Information System (INIS)

    Dimic, V.

    1984-01-01

    The 250 kW TRIGA Mark II reactor is a light water reactor with solid fuel elements in which the zirconium hydride moderator is homogeneously distributed between enriched uranium. The reactor therefore has a large prompt negative temperature coefficient of reactivity; the fuel also has a very high retention of radioactive fission products. The experimental facilities include a rotary specimen rack, a central in-core radiation thimble, a pneumatic transfer system and pulsing capability. Other experimental facilities include two radial and two tangential beam tubes, a graphite thermal column and a graphite thermalizing column. At the steady state power of 250 kW the peak flux is 1x10 13 n/cm 2 in the central test position. In addition, pulsing to about 2000 MW is usually provided giving peak fluxes of about 2x10 16 n/cm 2 sec. All TRIGA reactors produce a core-average thermal neutron flux of about 10 7 n.v. per watt. Only with very large accelerators can such high fluxes be achieved. The types of research could be summarized as follows: thermal neutron scattering, neutron radiography, neutron and nuclear physics, activation analysis, radiochemistry, biology and medicine, and teaching and training. Typical applied research with a 250 kW reactor has been conducted in medicine, in biology, archaeology, metallurgy and materials science, engineering and criminology. It is well known that research reactors have been used routinely to produce isotopes for industry and medicine. We can conclude that the 250 kW TRIGA reactor is a useful and wide ranging source of radiation for basic and applied research. The operation cost for this instrument is relatively low. (author)

  15. The calibration of the WISE W1 and W2 Tully-Fisher relation

    International Nuclear Information System (INIS)

    Neill, J. D.; Seibert, Mark; Scowcroft, Victoria; Tully, R. Brent; Courtois, Hélène; Sorce, Jenny G.; Jarrett, T. H.; Masci, Frank J.

    2014-01-01

    In order to explore local large-scale structures and velocity fields, accurate galaxy distance measures are needed. We now extend the well-tested recipe for calibrating the correlation between galaxy rotation rates and luminosities—capable of providing such distance measures—to the all-sky, space-based imaging data from the Wide-field Infrared Survey Explorer (WISE) W1 (3.4 μm) and W2 (4.6 μm) filters. We find a correlation of line width to absolute magnitude (known as the Tully-Fisher relation, TFR) of M W1 b,i,k,a =−20.35−9.56(log W mx i −2.5) (0.54 mag rms) and M W2 b,i,k,a =−19.76−9.74(log W mx i −2.5) (0.56 mag rms) from 310 galaxies in 13 clusters. We update the I-band TFR using a sample 9% larger than in Tully and Courtois. We derive M I b,i,k =−21.34−8.95(log W mx i −2.5) (0.46 mag rms). The WISE TFRs show evidence of curvature. Quadratic fits give M W1 b,i,k,a =−20.48−8.36(log W mx i −2.5)+3.60(log W mx i −2.5) 2 (0.52 mag rms) and M W2 b,i,k,a =−19.91−8.40(log W mx i −2.5)+4.32(log W mx i −2.5) 2 (0.55 mag rms). We apply an I-band –WISE color correction to lower the scatter and derive M C W1 =−20.22−9.12(log W mx i −2.5) and M C W2 =−19.63−9.11(log W mx i −2.5) (both 0.46 mag rms). Using our three independent TFRs (W1 curved, W2 curved, and I band), we calibrate the UNION2 Type Ia supernova sample distance scale and derive H 0 = 74.4 ± 1.4(stat) ± 2.4(sys) km s –1 Mpc –1 with 4% total error.

  16. Berlinskaja stena i Rimskije kanikulõ / Jevgeni Levik

    Index Scriptorium Estoniae

    Levik, Jevgeni

    2003-01-01

    Mängufilmid "Hüvasti, Lenin!" ("Good Bye, Lenin!") : režissöör Wolfgang Becker : Saksamaa 2003 ja "Lizzie McGuire - koolitüdrukust popstaariks" ("The Lizzie McGuire Movie") : režissöör Jim Fall : Ameerika Ühendriigid 2003

  17. Measurement of forward $t\\overline{t}$, $W+b\\overline{b}$ and $W+c\\overline{c}$ production in $pp$ collisions at $\\sqrt{s}=8$ TeV

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Bordyuzhin, Igor; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kosmyntseva, Alena; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2017-04-10

    The production of $t\\overline{t}$, $W+b\\overline{b}$ and $W+c\\overline{c}$ is studied in the forward region of proton-proton collisions collected at a centre-of-mass energy of 8 TeV by the LHCb experiment, corresponding to an integrated luminosity of 1.98 $\\pm$ 0.02 $\\mbox{fb}^{-1}$. The $W$ bosons are reconstructed in the decays $W\\rightarrow\\ell\

  18. Supernova remnant W49B and its environment

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, H.; Tian, W. W.; Zuo, P., E-mail: zhuhui@bao.ac.cn, E-mail: tww@bao.ac.cn [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)

    2014-10-01

    We study gamma-ray supernova remnant (SNR) W49B and its environment using recent radio and infrared data. Spitzer Infrared Spectrograph low resolution data of W49B shows shocked excitation lines of H{sub 2} (0,0) S(0)-S(7) from the SNR-molecular cloud interaction. The H{sub 2} gas is composed of two components with temperatures of ∼260 K and ∼1060 K, respectively. Various spectral lines from atomic and ionic particles are detected toward W49B. We suggest that the ionic phase has an electron density of ∼500 cm{sup –3} and a temperature of ∼10{sup 4} K by the spectral line diagnoses. The mid- and far-infrared data from MSX, Spitzer, and Herschel reveal a 151 ± 20 K hot dust component with a mass of 7.5 ± 6.6 × 10{sup –4} M {sub ☉} and a 45 ± 4 K warm dust component with a mass of 6.4 ± 3.2 M {sub ☉}. The hot dust is likely from materials swept up by the shock of W49B. The warm dust may possibly originate from the evaporation of clouds interacting with W49B. We build the H I absorption spectra of W49B and four nearby H II regions (W49A, G42.90+0.58, G42.43-0.26, and G43.19-0.53) and study the relation between W49B and the surrounding molecular clouds by employing the 2.12 μm infrared and CO data. We therefore obtain a kinematic distance of ∼10 kpc for W49B and suggest that the remnant is likely associated with the CO cloud at about 40 km s{sup –1}.

  19. MC2-3: Multigroup Cross Section Generation Code for Fast Reactor Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C. H. [Argonne National Lab. (ANL), Argonne, IL (United States); Yang, W. S. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2013-11-08

    The MC2-3 code is a Multigroup Cross section generation Code for fast reactor analysis, developed by improving the resonance self-shielding and spectrum calculation methods of MC2-2 and integrating the one-dimensional cell calculation capabilities of SDX. The code solves the consistent P1 multigroup transport equation using basic neutron data from ENDF/B data files to determine the fundamental mode spectra for use in generating multigroup neutron cross sections. A homogeneous medium or a heterogeneous slab or cylindrical unit cell problem is solved in ultrafine (~2000) or hyperfine (~400,000) group levels. In the resolved resonance range, pointwise cross sections are reconstructed with Doppler broadening at specified isotopic temperatures. The pointwise cross sections are directly used in the hyperfine group calculation whereas for the ultrafine group calculation, self-shielded cross sections are prepared by numerical integration of the pointwise cross sections based upon the narrow resonance approximation. For both the hyperfine and ultrafine group calculations, unresolved resonances are self-shielded using the analytic resonance integral method. The ultrafine group calculation can also be performed for two-dimensional whole-core problems to generate region-dependent broad-group cross sections. Multigroup cross sections are written in the ISOTXS format for a user-specified group structure. The code is executable on UNIX, Linux, and PC Windows systems, and its library includes all isotopes of the ENDF/BVII. 0 data.

  20. Occupational analysis for the Angra-1 reactor

    International Nuclear Information System (INIS)

    Moraes, A.

    1991-01-01

    Due to several modifications which were imposed to its time schedule during construction, the Angra-1 reactor did not enter to the grid in 1982 as it was initially foreseen. These modifications occurred due to an unforeseen scenario that was verified in steam generators (serie D-3, Westinghouse) of power stations with similar configurations which had been installed in other countries such as Ringhals-3 (Sweden), Almaraz-1 (Spain) and McGuine-1 (USA). So, among the main events that occurred in the Angra-1 reactor, which were of interest from the point of view of radiation protection, it could be pointed out the personnel monitoring, and the occupational exposure measurements at different reactor power, during the reactor fueling and during modification and tests performed at the steam generators and at ducts of the primary coolant circuit. (author)

  1. Reactor protection system. Revision 1

    International Nuclear Information System (INIS)

    Fairbrother, D.B.; Vincent, D.R.; Lesniak, L.M.

    1975-04-01

    The reactor protection system-II (RPS-II) designed for use on Babcock and Wilcox 145- and 205-fuel assembly pressurized water reactors is described. In this system, relays in the trip logic have been replaced by solid state devices. A calculating module for the low DNBR, pump status, and offset trip functions has replaced the overpower trip (based on flow and imbalance), the power/RC pump trip, and the variable low pressure trip. Included is a description of the changes from the present Oconee-type reactor protection system (RPS-I), a functional and hardware description of the calculating module, and a discussion of the qualification program conducted to ensure that the degree of protection provided by RPS-II is not less than that provided by previously licensed systems supplied by B and W. (U.S.)

  2. Technical specifications: McGuire Nuclear Station, Unit Nos. 1 and 2. Docket Nos. 50-369 and 50-370

    International Nuclear Information System (INIS)

    Anderson, F.

    1983-03-01

    Information is presented concerning safety limits for operation; control systems; power distribution limits; instrumentation; primary coolant circuit; emergency core cooling systems; containment systems; steam turbines and secondary coolant circuits; electrical equipment; refueling operations; radioactive effluents; and reactor site

  3. GPM GROUND VALIDATION MCGILL W-BAND RADAR GCPEX V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation McGill W-Band Radar GCPEx dataset was collected from February 1, 2012 to February 29, 2012 at the CARE site in Ontario, Canada as a part of...

  4. A summary of the quench behavior of B ampersand W 1 m collider quadrupole model magnets

    International Nuclear Information System (INIS)

    Rey, C.M.; Xu, M.F.; Hlasnicek, P.; Kelley, J.P.; Dixon, K.; Savignano, J.; Letterman, S.; Craig, P.; Maloney, J.; Boyes, D.

    1994-01-01

    In order to evaluate the quench performance of a B ampersand W-Siemens designed quadrupole magnet at the earliest possible stage, a model magnet program was developed at B ampersand W for the support of the Superconducting Super Collider. The authors report the quench performance, training behavior, and the ramp rate dependence for the QSH-801 through QSH-804 series of short (1.2 meter) quadrupole model magnets

  5. MANHATTAN PROJECT B REACTOR HANFORD WASHINGTON [HANFORD'S HISTORIC B REACTOR (12-PAGE BOOKLET)

    Energy Technology Data Exchange (ETDEWEB)

    GERBER MS

    2009-04-28

    The Hanford Site began as part of the United States Manhattan Project to research, test and build atomic weapons during World War II. The original 670-square mile Hanford Site, then known as the Hanford Engineer Works, was the last of three top-secret sites constructed in order to produce enriched uranium and plutonium for the world's first nuclear weapons. B Reactor, located about 45 miles northwest of Richland, Washington, is the world's first full-scale nuclear reactor. Not only was B Reactor a first-of-a-kind engineering structure, it was built and fully functional in just 11 months. Eventually, the shoreline of the Columbia River in southeastern Washington State held nine nuclear reactors at the height of Hanford's nuclear defense production during the Cold War era. The B Reactor was shut down in 1968. During the 1980's, the U.S. Department of Energy began removing B Reactor's support facilities. The reactor building, the river pumphouse and the reactor stack are the only facilities that remain. Today, the U.S. Department of Energy (DOE) Richland Operations Office offers escorted public access to B Reactor along a designated tour route. The National Park Service (NPS) is studying preservation and interpretation options for sites associated with the Manhattan Project. A draft is expected in summer 2009. A final report will recommend whether the B Reactor, along with other Manhattan Project facilities, should be preserved, and if so, what roles the DOE, the NPS and community partners will play in preservation and public education. In August 2008, the DOE announced plans to open B Reactor for additional public tours. Potential hazards still exist within the building. However, the approved tour route is safe for visitors and workers. DOE may open additional areas once it can assure public safety by mitigating hazards.

  6. Signal characteristics of focal bone marrow lesions in patients with multiple myeloma using whole body T1w-TSE, T2w-STIR and diffusion-weighted imaging with background suppression

    Energy Technology Data Exchange (ETDEWEB)

    Sommer, Gregor; Bongartz, Georg; Winter, Leopold [University of Basel Hospital, Department of Radiology, Basel (Switzerland); Klarhoefer, Markus; Lenz, Claudia; Scheffler, Klaus [University of Basel Hospital, Department of Radiology, Division of Radiological Physics, Basel (Switzerland)

    2011-04-15

    This study analyses the diagnostic potential of Diffusion-Weighted Imaging with Background Suppression (DWIBS) in the detection of focal bone marrow lesions from multiple myeloma. The signal and contrast properties of DWIBS are evaluated in correlation with the serum concentration of M-component (MC) and compared with established T1- and T2-weighted sequences. Data from 103 consecutive studies in 81 patients are analysed retrospectively. Signal intensities and apparent Diffusion Coefficients (ADC) of 79 focal lesions in the lumbar spine or pelvis of 38 patients are determined and contrast-to-noise-ratio (CNR) is calculated. Data from patients with low (<20 g/L) and high (>20 g/dL) MC are evaluated separately. Signal intensities of focal myeloma lesions on T2w-STIR vary significantly depending on the MC, which leads to a loss in CNR in patients with high MC. No signal variation is observed for T1w-TSE and DWIBS. The CNR values provided by DWIBS in patients with high MC are slightly higher than those of T2w-STIR. ADC values in patients with low MC are significantly higher than in patients with high MC. Whole-body DWIBS has the potential to improve the conspicuity of focal myeloma lesions and provides additional biological information by ADC quantification. (orig.)

  7. Babcock and Wilcox model for predicting in-reactor densification

    International Nuclear Information System (INIS)

    Buescher, B.J.; Pegram, J.W.

    1975-06-01

    The B and W fuel densification model is used to describe the extent and kinetics of in-reactor densification in B and W production fuel. The model and approach are qualified against an extensive data base available through B and W's participation in the EEI Fuel Densification Program. Out-of-reactor resintering tests on representative pellets from each batch of fuel are used to provide input parameters to the B and W densification model. The B and W densification model predicts in-reactor densification very accurately for pellets operated at heat rates above 5 kW/ft and with considerable conservation for pellets operated at heat rates less than 5 kW/ft. This model represents a technically rigorous and conservative basis for predicting the extent and kinetics of in-reactor densification. 9 references. (U.S.)

  8. Application of the master curve approach to fracture mechanics characterisation of reactor pressure vessel steel

    International Nuclear Information System (INIS)

    Viehrig, Hans-Werner; Zurbuchen, Conrad; Kalkhof, Dietmar

    2010-06-01

    The paper presents results of a research project founded by the Swiss Federal Nuclear Inspectorate concerning the application of the Master Curve approach in nuclear reactor pressure vessels integrity assessment. The main focus is put on the applicability of pre-cracked 0.4T-SE(B) specimens with short cracks, the verification of transferability of MC reference temperatures T 0 from 0.4T thick specimens to larger specimens, ascertaining the influence of the specimen type and the test temperature on T 0 , investigation of the applicability of specimens with electroerosive notches for the fracture toughness testing, and the quantification of the loading rate and specimen type on T 0 . The test material is a forged ring of steel 22 NiMoCr 3-7 of the uncommissioned German pressurized water reactor Biblis C. SE(B) specimens with different overall sizes (specimen thickness B=0.4T, 0.8T, 1.6T, 3T, fatigue pre-cracked to a/W=0.5 and 20% side-grooved) have comparable T 0 . T 0 varies within the 1σ scatter band. The testing of C(T) specimens results in higher T 0 compared to SE(B) specimens. It can be stated that except for the lowest test temperature allowed by ASTM E1921-09a, the T 0 values evaluated with specimens tested at different test temperatures are consistent. The testing in the temperature range of T 0 ± 20 K is recommended because it gave the highest accuracy. Specimens with a/W=0.3 and a/W=0.5 crack length ratios yield comparable T 0 . The T 0 of EDM notched specimens lie 41 K up to 54 K below the T 0 of fatigue pre-cracked specimens. A significant influence of the loading rate on the MC T 0 was observed. The HSK AN 425 test procedure is a suitable method to evaluate dynamic MC tests. The reference temperature T 0 is eligible to define a reference temperature RT To for the ASME-KIC reference curve as recommended in the ASME Code Case N-629. An additional margin has to be defined for the specific type of transient to be considered in the RPV integrity assessment

  9. Characteristics of Criterion-Referenced Instruments: Implications for Materials Selection for the Learning Disabled.

    Science.gov (United States)

    Blasi, Joyce F.

    Discussed are characteristics of criterion referenced reading tests for use with learning disabled (LD) children, and analyzed are the Basic Educational Skills Inventory (BESI), the Prescriptive Reading Inventory (PRI), and the Cooper-McGuire Diagnostic Work-Analysis Test (CooperMcGuire). Criterion referenced tests are defined; and problems in…

  10. Loss of coolant accident (LOCA) analysis for McMaster Nuclear Reactor through probabilistic risk assessment (PRA)

    Energy Technology Data Exchange (ETDEWEB)

    Ha, T.; Garland, W.J. [McMaster Univ., Dept. of Engineering Physics, Hamilton, Ontario (Canada)]. E-mail: hats@mcmaster.ca

    2006-07-01

    A probabilistic risk assessment (PRA) was conducted for the loss of coolant accident (LOCA) sequence in the McMaster Nuclear Reactor (MNR). A level 1 PRA was completed including event sequence modeling, system modeling, and quantification. To support the quantification of the accident sequence identified, data analysis using the Bayesian method and human reliability analysis (HRA) using the ASEP approach were performed. Since human performance in research reactors is significantly different from that in power reactors, a different time-oriented HRA model was proposed and applied for the estimation of the human error probability (HEP) of core relocation. This HEP estimate was less than that by the ASEP approach by a factor of about 2. These two HEP estimates were used for sensitivity analysis, and modeling uncertainty in the PRA models was quantified. This showed the necessity of appropriate human reliability models in PRA for research reactors. This method could be implemented for the operators' actions which require extensive manual execution with little cognitive load, as might be the case for some maintenance operations in power reactors. (author)

  11. The process of the start-up of a PWR nuclear power plant in the USA

    International Nuclear Information System (INIS)

    Rana, B.S.

    1977-01-01

    The procedure is described of putting into full operation the William B. Mc Guire nuclear power plant with two PWR reactors with an output of 2x3,411 MWt (2x1,220 MWe) supplied to the Duke Power Co. lock, stock and barrel. The basic specifications are shown of units I and II and the organization of start-up activities is described. The time schedule of preoperational and start-up tests is shown and testing is reviewed preceding the first fuel charge. Also described are tests related to the first start-up of a unit comprising the period of the first fuel charge, the initial critical state, low-power tests and tests with power gradually increased. In tests of the individual systems and components of the unit, operating regulations are verified and, if required, renewed, or new regulations are introduced. (B.S.)

  12. Measurement of the pp¯→W+b+X production cross section at √(s)=1.96 TeV

    International Nuclear Information System (INIS)

    Abazov, V.M.; Abbott, B.; Acharya, B.S.; Adams, M.; Adams, T.; Alexeev, G.D.; Alkhazov, G.; Alton, A.; Askew, A.; Atkins, S.; Augsten, K.; Avila, C.; Badaud, F.; Bagby, L.; Baldin, B.; Bandurin, D.V.; Banerjee, S.; Barberis, E.; Baringer, P.; Bartlett, J.F.

    2013-01-01

    We present a measurement of the cross section for W boson production in association with at least one b-quark jet in proton–antiproton collisions. The measurement is made using data corresponding to an integrated luminosity of 6.1 fb −1 recorded with the D0 detector at the Fermilab Tevatron pp ¯ Collider at √(s)=1.96 TeV. We measure an inclusive cross section of σ(W(→μν)+b+X)=1.04±0.05(stat.)±0.12(syst.) pb and σ(W(→eν)+b+X)=1.00±0.04(stat.)±0.12(syst.) pb in the phase space defined by p T ν >25 GeV, p T b-jet >20 GeV, |η b-jet | T ℓ >20 GeV and |η μ | e | e | ℓ | −0.34 +0.41 (syst.) pb, and also with predictions from the SHERPA and MADGRAPH Monte Carlo event generators.

  13. Thermal hydraulic analysis of the IPR-R1 TRIGA reactor

    International Nuclear Information System (INIS)

    Veloso, Marcelo Antonio; Fortini, Maria Auxiliadora

    2002-01-01

    The subchannel approach, normally employed for the analysis of power reactor cores that work under forced convection, have been used for the thermal hydraulic evaluation of a TRIGA Mark I reactor, named IPR-R1, at 250 kW power level. This was accomplished by using the PANTERA-1P subchannel code, which has been conveniently adapted to the characteristics of natural convection of TRIGA reactors. The analysis of results indicates that the steady state operation of IPR-R1 at 250 kW do not imply risks to installations, workers and public. (author)

  14. B and W NPGD quality assurance program for nuclear equipment. Revision 1

    International Nuclear Information System (INIS)

    1975-03-01

    B and W's Quality Assurance Program (QAP) is described. The program is implemented through the Nuclear Power Generation Division (NPGD) and includes design, procurement, and manufacturing activities of NPGD and all its suppliers furnishing items in the B and W scope of supply including other Divisions/ Subsidiaries of B and W. These activities are controlled by including applicable quality assurance requirements, as described, in NPGD procurement documents imposed on its suppliers. Each supplier must then establish and/or maintain a documented QA Program to meet the requirements imposed by the procurement documents. Implementation of the suppliers' NPGD-approved QA Program is verified by NPGD through Audit and QC Surveillance activities. The position and relationships of the NPGD within the Company's corporate structure are described. An overview of the QAP describing its implementation, its operation, the controls imposed on all suppliers (both corporate and vendor) and site consulting activities is presented. (U.S.)

  15. Forward W + c, b-jet and Top Measurements with LHCb

    CERN Document Server

    INSPIRE-00258006

    2015-01-01

    Inclusive c and b-jet tagging algorithms have been developed to utilize the excellent secondary vertex reconstruction and resolution capabilities of the LHCb detector. The validation and performance of these tagging algorithms are reported using the full run 1 LHCb dataset at 7 and 8 TeV. Jet-tagging has been applied to muon+jet final states to measure both the W+c,b-jet charge asymmetries and the ratios of W+c,b-jet to W+jet and W+jet to Z+jet production. The forward top production cross-section is also measured using the muon+b-jet final. All results are found to be consistent with standard model predictions.

  16. Comparison of applicability of current transition temperature shift models to SA533B-1 reactor pressure vessel steel of Korean nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Ji Hyun; Lee, Bong Sang [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2017-08-15

    The precise prediction of radiation embrittlement of aged reactor pressure vessels (RPVs) is a prerequisite for the long-term operation of nuclear power plants beyond their original design life. The expiration of the operation licenses for Korean reactors the RPVs of which are made from SA533B-1 plates and welds is imminent. Korean regulatory rules have adopted the US Nuclear Regulatory Commission's transition temperature shift (TTS) models to the prediction of the embrittlement of Korean reactor pressure vessels. The applicability of the TTS model to predict the embrittlement of Korean RPVs made of SA533B-1 plates and welds was investigated in this study. It was concluded that the TTS model of 10 CFR 50.61a matched the trends of the radiation embrittlement in the SA533B-1 plates and welds better than did that of Regulatory Guide (RG) 1.99 Rev. 2. This is attributed to the fact that the prediction performance of 10 CFR 50.61a was enhanced by considering the difference in radiation embrittlement sensitivity among the different types of RPV materials.

  17. Neutron flux measurement and thermal power calibration of the IAN-R1 TRIGA reactor

    Energy Technology Data Exchange (ETDEWEB)

    Sarta Fuentes, Jose A.; Castiblanco Bohorquez, Luis A

    2008-10-29

    The IAN-R1 TRIGA reactor in Colombia was initially fueled with MTR-HEU enriched to 93% U-235, operated since 1965 at 10 kW, and was upgraded to 30 kW in 1980. General Atomics achieved in 1997 the conversion of HEU fuel to LEU fuel TRIGA type, and upgraded the reactor power to 100 kW. Since the IAN-R1 TRIGA reactor was in an extended shutdown during seven years, it was necessary to repeat some results of the commissioning test conducted in 1997. The thermal power calibration was carried out using the calorimetric method. The reactor was operated approximately at 20 kW during 3.5 hours, with manual power corrections since the automatic control system failed and with the forced refrigeration off. During the calorimetric experiment, the pool temperature was measured with a RTD which is installed near to the core. The dates were collected in intervals of 30 minutes. For establishing thermal power reactor, the water temperature versus the running were registered. For a calculated tank volume of 16 m{sup 3}, the tank constant calculated for the IAN-R1 TRIGA reactor is 0.0539 C/kW-hr. The reactor power determined was 19 kW. The core configuration is a rectangular grid plate that holds a combination of 4-rod and 3-rod clusters. The core contains 50 fuel rods with LEU fuel TRIGA (UZr H1.6) type enriched to 19.7%. The radial reflector consists of twenty graphite elements six of which are used for isotope production. The top an bottom reflectors are the cylindrical graphite end reflectors which are installed above and below of the active fuel section in each fuel rod. The spatial dependence of thermal neutron flux was measured axially in the 3-rod clusters 4C, 3D, 5E and in the 4F graphite element. The spatial distribution of the thermal neutron was determined using a self-powered detector and the absolute value of thermal neutron flux was determined by a gold activation detector. The (n, b- ) reaction is applied to determine the relative spatial distribution of thermal

  18. The Scattering Properties of Natural Terrestrial Snows versus Icy Satellite Surfaces

    Science.gov (United States)

    Domingue, Deborah; Hartman, Beth; Verbiscer, Anne

    1997-01-01

    Our comparisons of the single particle scattering behavior of terrestrial snows and icy satellite regoliths to the laboratory particle scattering measurements of McGuire and Hapke demonstrate that the differences between icy satellite regoliths and their terrestrial counterparts are due to particle structures and textures. Terrestrial snow particle structures define a region in the single particle scattering function parameter space separate from the regions defined by the McGuire and Hapke artificial laboratory particles. The particle structures and textures of the grains composing icy satellites regoliths are not simple or uniform but consist of a variety of particle structure and texture types, some of which may be a combination of the particle types investigated by McGuire and Hapke.

  19. Development of a coupled reactor with a catalytic combustor and steam reformer for a 5 kW solid oxide fuel cell system

    International Nuclear Information System (INIS)

    Kang, Sanggyu; Lee, Kanghun; Yu, Sangseok; Lee, Sang Min; Ahn, Kook-Young

    2014-01-01

    Highlights: • Proposes the scale-up strategy to develop a large-scale coupled reactor. • Investigation of performance of steam reformer coupled with catalytic combustor. • Experimental parameters are inlet temp., air excess ratio, SCR, fuel utilization. • Evaluation of the heat transfer distribution along the gas flow direction. • The mean value of methane conversion rate is approximately 93.4%. - Abstract: The methane (CH 4 ) conversion rate of a steam reformer can be increased by thermal integration with a catalytic combustor, called a coupled reactor. In the present study, a 5 kW coupled reactor has been developed based on a 1 kW coupled reactor in previous work. The geometric parameters of the space velocity, diameter and length of the coupled reactor selected from the 1 kW coupled reactor are tuned and applied to the design of the 5 kW coupled reactor. To confirm the scale-up strategy, the performance of 5 kW coupled reactor is experimentally investigated with variations of operating parameters such as the fuel utilization in the solid oxide fuel cell (SOFC) stack, the inlet temperature of the catalytic combustor, the excess air ratio of the catalytic combustor, and the steam to carbon ratio (SCR) in the steam reformer. The temperature distributions of coupled reactors are measured along the gas flow direction. The gas composition at the steam reformer outlet is measured to find the CH 4 conversion rate of the coupled reactor. The maximum value of the CH 4 conversion rate is approximately 93.4%, which means the proposed scale-up strategy can be utilized to develop a large-scale coupled reactor

  20. MC21 v.6.0 - A continuous-energy Monte Carlo particle transport code with integrated reactor feedback capabilities

    International Nuclear Information System (INIS)

    Grieshemer, D.P.; Gill, D.F.; Nease, B.R.; Carpenter, D.C.; Joo, H.; Millman, D.L.; Sutton, T.M.; Stedry, M.H.; Dobreff, P.S.; Trumbull, T.H.; Caro, E.

    2013-01-01

    MC21 is a continuous-energy Monte Carlo radiation transport code for the calculation of the steady-state spatial distributions of reaction rates in three-dimensional models. The code supports neutron and photon transport in fixed source problems, as well as iterated-fission-source (eigenvalue) neutron transport problems. MC21 has been designed and optimized to support large-scale problems in reactor physics, shielding, and criticality analysis applications. The code also supports many in-line reactor feedback effects, including depletion, thermal feedback, xenon feedback, eigenvalue search, and neutron and photon heating. MC21 uses continuous-energy neutron/nucleus interaction physics over the range from 10 -5 eV to 20 MeV. The code treats all common neutron scattering mechanisms, including fast-range elastic and non-elastic scattering, and thermal- and epithermal-range scattering from molecules and crystalline materials. For photon transport, MC21 uses continuous-energy interaction physics over the energy range from 1 keV to 100 GeV. The code treats all common photon interaction mechanisms, including Compton scattering, pair production, and photoelectric interactions. All of the nuclear data required by MC21 is provided by the NDEX system of codes, which extracts and processes data from EPDL-, ENDF-, and ACE-formatted source files. For geometry representation, MC21 employs a flexible constructive solid geometry system that allows users to create spatial cells from first- and second-order surfaces. The system also allows models to be built up as hierarchical collections of previously defined spatial cells, with interior detail provided by grids and template overlays. Results are collected by a generalized tally capability which allows users to edit integral flux and reaction rate information. Results can be collected over the entire problem or within specific regions of interest through the use of phase filters that control which particles are allowed to score each

  1. Search for W' →> t$\\bar{b}$ in p$\\bar{p}$Collisions at √(s)=1.96 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Cully, James Clark [Univ. of Michigan, Ann Arbor, MI (United States)

    2009-01-01

    We present a search for a narrow resonance in the t$\\bar{b}$ mass spectrum using 1.9 fb-1 of p$\\bar{p}$ collisions at √s = 1.96 TeV recorded with the CDF II detector at the Fermilab Tevatron. We select events with a lepton, neutrino candidate, and two or three jets from which to construct the t$\\bar{b}$ mass. We quantify the result using the model of a massive Standard Model-like charged-boson (W') decaying to t$\\bar{b}$, but we are generally sensitive to the presence of any narrow state decaying to the third generation. For a purely right-handed W' with Standard Model couplings, we set a new limit at 95% confidence of σ(p$\\bar{p}$ → W'R) x BR(W'R → t$\\bar{b}$) < 0.28 pb and MW'R > 800 GeV/c2. The limit increases to MW'R > 825 GeV/c2 if decay to right-handed neutrinos is forbidden. These results are shown in Table 7 and plotted in Figure 7.1. The best prior search found MW' Ge 768 GeV/c2 if leptonic decays are forbidden [16]. For a simple W' model with effective coupling gW', the cross-section is proportional to gW'4. Relaxing the assumption of the universal weak coupling (gW' = gW), our cross-section limits can be rewritten as upper limits on gW', as a function of MW'. This is relevant to both the right-handed W' model as well as a left-handed W' model in which the W'L-W interference is negligible. The excluded region of the gW'-MW' plane is shown in Figure 7.2, with gW' in units of gW. At MW' = 300 GeV/c2, we limit (95% C.L.) the effective coupling to be less than 0.40 of the standard weak coupling.

  2. Niedokrwistość chorób przewlekłych w przebiegu reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Justyna Fryc

    2010-12-01

    Full Text Available Niedokrwistość chorób przewlekłych stanowi jedno z najczęstszychzaburzeń hematologicznych obserwowanych u pacjentówz reumatoidalnym zapaleniem stawów. Stwierdza się ją takżew wielu innych procesach chorobowych, takich jak: nowotwory,choroby zakaźne i zapalne, niewydolność serca czy cukrzyca. Patogenezatego schorzenia nie jest jednak jeszcze w pełni poznana.W procesie rozwoju choroby rolę odgrywają mediatory stanuzapalnego, takie jak czynnik martwicy nowotworów α, interleukiny(IL-1, IL-6 i IL-10. Hepcydyna jest jednym z kluczowych białekw patogenezie niedokrwistości chorób przewlekłych, ponieważhamuje absorpcję żelaza oraz jego uwalnianie z makrofagów.W artykule przedstawiono patogenezę niedokrwistości choróbprzewlekłych u pacjentów z reumatoidalnym zapaleniem stawów.Celem pracy jest także podsumowanie wyników ostatnio prowadzonychbadań dotyczących roli hamowania IL-6 u pacjentówz niedokrwistością chorób przewlekłych w przebiegu reumatoidalnegozapalenia stawów. Wykazano, że blokowanie receptora dlaIL-6 z użyciem tocilizumabu prowadzi do zwiększenia stężeniahemoglobiny w porównaniu z grupą otrzymującą placebo.

  3. The Limitations of Behavior-Genetic Analyses: Comment on McGue, Elkins, Walden, and Iacono (2005)

    Science.gov (United States)

    Greenberg, Gary

    2005-01-01

    This article takes issue with the behavior-genetic analysis of parenting style presented by M. McGue, I. Elkins, B. Walden, and W. G. Iacono. The author argues that the attribution of their findings to inherited genetic effects was without basis because McGue et al. never indicated how those genetic effects manifested themselves. Instead, McGue et…

  4. The reactor kinetics code tank: a validation against selected SPERT-1b experiments

    International Nuclear Information System (INIS)

    Ellis, R.J.

    1990-01-01

    The two-dimensional space-time analysis code TANK is being developed for the simulation of transient behaviour in the MAPLE class of research reactors. MAPLE research reactor cores are compact, light-water-cooled and -moderated, with a high degree of forced subcooling. The SPERT-1B(24/32) reactor core had many similarities to MAPLE-X10, and the results of the SPERT transient experiments are well documented. As a validation of TANK, a series of simulations of certain SPERT reactor transients was undertaken. Special features were added to the TANK code to model reactors with plate-type fuel and to allow for the simulation of rapid void production. The results of a series of super-prompt-critical reactivity step-insertion transient simulations are presented. The selected SPERT transients were all initiated from low power, at ambient temperatures, and with negligible coolant flow. Th results of the TANK simulations are in good agreement with the trends in the experimental SPERT data

  5. NNLO QCD corrections to the $B\\to X_s \\gamma$ matrix elements using interpolation in $m_c$

    CERN Document Server

    Misiak, M; Misiak, Mikolaj; Steinhauser, Matthias

    2007-01-01

    One of the most troublesome contributions to the NNLO QCD corrections to B -> X_s gamma originates from three-loop matrix elements of four-quark operators. A part of this contribution that is proportional to the QCD beta-function coefficient beta_0 was found in 2003 as an expansion in m_c/m_b. In the present paper, we evaluate the asymptotic behaviour of the complete contribution for m_c >> m_b/2. The asymptotic form of the beta_0-part matches the small-m_c expansion very well at the threshold m_c = m_b/2. For the remaining part, we perform an interpolation down to the measured value of m_c, assuming that the beta_0-part is a good approximation at m_c=0. Combining our results with other contributions to the NNLO QCD corrections, we find BR(B -> X_s gamma) = (3.15 +_ 0.23) x 10^-4 for E_gamma > 1.6 GeV in the B-meson rest frame. The indicated error has been obtained by adding in quadrature the following uncertainties: non-perturbative (5%), parametric (3%), higher-order perturbative (3%), and the interpolation...

  6. Superconducting state in (W, Ta)5SiB2

    Science.gov (United States)

    Fukuma, M.; Kawashima, K.; Akimitsu, J.

    We characterize the superconducting state in a boro-silicide (W, Ta)5SiB2, with Tc of 6.5 K by means of magnetization, electrical resistivity, and specific heat measurements. As x increased, the transition temperature Tc abruptly enhances from 5.8 to 6.5 K. The magnetization versus magnetic field (M-H) curve indicated that (W, Ta)5SiB2 was a conventional type-II superconductor. The estimated lower critical field Hc1(0) and upper critical field Hc2(T) are about 121 Oe and 14.7 kOe, respectively. The penetration depth λ(0) and coherence length ξ(0) are calculated to be approximately 369 and 14.9 nm, respectively, using Ginzburg-Landau (GL) equations. Specific heat data shows the superconductivity in W4.5Ta0.5SiB2 belongs to a week-coupling BCS superconductor. Finally, we discuss the increasing of Tc in of (W, Ta)5SiB2 system.

  7. Stationary low power reactor No. 1 (SL-1) accident site decontamination ampersand dismantlement project

    International Nuclear Information System (INIS)

    Perry, E.F.

    1995-01-01

    The Army Reactor Area (ARA) II was constructed in the late 1950s as a test site for the Stationary Low Power Reactor No. 1 (SL-1). The SL-1 was a prototype power and heat source developed for use at remote military bases using a direct cycle, boiling water, natural circulation reactor designed to operate at a thermal power of 3,000 kW. The ARA II compound encompassed 3 acres and was comprised of (a) the SL-1 Reactor Building, (b) eight support facilities, (c) 50,000-gallon raw water storage tank, (d) electrical substation, (e) aboveground 1,400-gallon heating oil tank, (f) underground 1,000-gallon hazardous waste storage tank, and (g) belowground power, sewer, and water systems. The reactor building was a cylindrical, aboveground facility, 39 ft in diameter and 48 ft high. The lower portion of the building contained the reactor pressure vessel surrounded by gravel shielding. Above the pressure vessel, in the center portion of the building, was a turbine generator and plant support equipment. The upper section of the building contained an air cooled condenser and its circulation fan. The major support facilities included a 2,500 ft 2 two story, cinder block administrative building; two 4,000 ft 2 single story, steel frame office buildings; a 850 ft 2 steel framed, metal sided PL condenser building, and a 550 ft 2 steel framed decontamination and laydown building

  8. Evaluating the Significance of CDK2-PELP1 Axis in Tumorigenesis and Hormone Therapy Resistance

    Science.gov (United States)

    2010-02-01

    kinase substrate (HRS) (Vadlamudi and Kumar, 2007). PELP1 has highest tissue expression in brain, testes, ovary and uterus (Khan et al, 2005; Vadlamudi... Connections and regulation of the human estrogen receptor. Science 296, 1642-1644. McGuire WL and Clark GM (1992) Prognostic factors and treatment...Weinberg RA (2001) AIB1 enhances estrogen-dependent induction of cyclin D1 expression. Cancer Res 61, 3858-3862. Pohl G, Rudas M, Dietze O, Lax S

  9. Potential of eye movement desensitization and reprocessing therapy in the treatment of post-traumatic stress disorder

    OpenAIRE

    McGuire, Tracy M; Lee, Christopher W; Drummond, Peter D

    2014-01-01

    Tracy M McGuire, Christopher W Lee, Peter D Drummond School of Psychology, Murdoch University, Perth, WA, Australia Abstract: Post-traumatic stress disorder (PTSD) continues to attract both empirical and clinical interest due to its complex symptom profile and the underlying processes involved. Recently, research attention has been focused on the types of memory processes involved in PTSD and hypothesized neurobiological processes. Complicating this exploration, and the treatment of PTSD, ar...

  10. Amino acid differences in glycoproteins B (gB, C (gC, H (gH and L(gL are associated with enhanced herpes simplex virus type-1 (McKrae entry via the paired immunoglobulin-like type-2 receptor α

    Directory of Open Access Journals (Sweden)

    Chowdhury Sona

    2012-06-01

    Full Text Available Abstract Background Herpes simplex virus type-1 (HSV-1 enters into cells via membrane fusion of the viral envelope with plasma or endosomal membranes mediated by viral glycoproteins. HSV-1 virions attach to cell surfaces by binding of viral glycoproteins gC, gD and gB to specific cellular receptors. Here we show that the human ocular and highly neurovirulent HSV-1 strain McKrae enters substantially more efficiently into cells via the gB-specific human paired immunoglobulin-like type-2 receptor-α (hPILR-α. Comparison of the predicted amino acid sequences between HSV-1(F and McKrae strains indicates that amino acid changes within gB, gC, gH and gL may cause increased entry via the hPILR- α receptor. Results HSV-1 (McKrae entered substantially more efficiently than viral strain F in Chinese hamster ovary (CHO cells expressing hPIRL-α but not within CHO-human nectin-1, -(CHO-hNectin-1, CHO-human HVEM (CHO-hHVEM or Vero cells. The McKrae genes encoding viral glycoproteins gB, gC, gD, gH, gL, gK and the membrane protein UL20 were sequenced and their predicted amino acid (aa sequences were compared with virulent strains F, H129, and the attenuated laboratory strain KOS. Most aa differences between McKrae and F were located at their gB amino termini known to bind with the PILRα receptor. These aa changes included a C10R change, also seen in the neurovirulent strain ANG, as well as redistribution and increase of proline residues. Comparison of gC aa sequences revealed multiple aa changes including an L132P change within the 129-247 aa region known to bind to heparan sulfate (HS receptors. Two aa changes were located within the H1 domain of gH that binds gL. Multiple aa changes were located within the McKrae gL sequence, which were preserved in the H129 isolate, but differed for the F strain. Viral glycoproteins gD and gK and the membrane protein UL20 were conserved between McKrae and F strains. Conclusions The results indicate that the observed

  11. Enrichment of W2B5 from WO3 and B2O3 by Double SHS Method

    Directory of Open Access Journals (Sweden)

    Bora DERIN

    2018-02-01

    Full Text Available A second self-propagating high-temperature synthesis (SHS was carried out to enrich the W2B5 content in the SHS product containing a mixture of various tungsten boride compounds. In the experiment, the process called Double-SHS (D-SHS was conducted in two steps. In the first SHS reaction, an initial molar composition ratio of WO3:B2O3:Mg mixture was selected as 1:3:8. The product was then hot-leached with hydrochloric acid to eliminate MgO and Mg3B2O6 phases. The leached product, consisting of 72.6 wt.% W2B5, 16.1 wt.% WB, 8.4 wt.% W2B, and 2.9 wt.% W, was again reacted with the Mg and B2O3 mixture by second SHS. After another acid leaching step, W2B5 content in the D-SHS product was found to be 98.2 wt.%. The study showed that D-SHS is an effective method for boron enrichment in the tungsten compounds.DOI: http://dx.doi.org/10.5755/j01.ms.24.1.17834

  12. Hanford B Reactor Building Hazard Assessment Report

    International Nuclear Information System (INIS)

    Griffin, P. W.

    1999-01-01

    The 105-B Reactor (hereinafter referred to as B Reactor) is located in the 100 Area of the Hanford Site near Richland, Washington. The B Reactor is one of nine plutonium production reactors that were constructed in the 1940s during the Cold War Era. Construction of the B Reactor began June 7, 1943, and operation began on September 26, 1944. The Environmental Restoration Contractor was requested by RL to provide an assessment/characterization of the B Reactor building to determine and document the hazards that are present and could pose a threat to the environment and/or to individuals touring the building. This report documents the potential hazards, determines the feasibility of mitigating the hazards, and makes recommendations regarding areas where public tour access should not be permitted

  13. U.S. regulatory requirements for nuclear plant license renewal: The B and W Owners Group License Renewal Program

    International Nuclear Information System (INIS)

    Staudinger, Deborah K.

    2004-01-01

    This paper discusses the current U.S. Regulatory Requirements for License Renewal and describes the Babcock and Wilcox Owners Group (B and WOG) Generic License Renewal Program (GLRP). The B and W owners, recognizing the need to obtain the maximum life for their nuclear generating units, embarked on a program to renew the licenses of the seven reactors in accordance with the requirements of the Atomic Energy Act of 1954 and further defined by Title 10 of the Code of Federal Regulation Part 54 (10 CFR 54). These reactors, owned by five separate utilities, are Pressurized Water Reactors (PWR) ranging in net rated capacity from approximately 800 to 900 MW. The plants, predominately constructed in the 70s, have USNRC Operating Licenses that expire between 2013 to 2017. (author)

  14. Low-intensity pulsed ultrasound (LIPUS) stimulates mineralization of MC3T3-E1 cells through calcium and phosphate uptake.

    Science.gov (United States)

    Tassinary, João Alberto Fioravante; Lunardelli, Adroaldo; Basso, Bruno de Souza; Dias, Henrique Bregolin; Catarina, Anderson Velasque; Stülp, Simone; Haute, Gabriela Viegas; Martha, Bianca Andrade; Melo, Denizar Alberto da Silva; Nunes, Fernanda Bordignon; Donadio, Márcio Vinícius Fagundes; Oliveira, Jarbas Rodrigues de

    2018-03-01

    The present study aimed to evaluate the effect of low-intensity pulsed ultrasound (LIPUS) on pre-osteoblast mineralization using in vitro bioassays. Pre-osteoblastic MC3T3-E1 cells were exposed to LIPUS at 1 MHz frequency, 0.2 W/cm 2 intensity and 20% duty cycle for 30 min. The analyses were carried out up to 336 h (14 days) after exposure. The concentration of collagen, phosphate, alkaline phosphatase, calcium and transforming growth factor beta 1 (TGF-β1) in cell supernatant and the presence of calcium deposits in the cells were analyzed. Our results showed that LIPUS promotes mineralized nodules formation. Collagen, phosphate, and calcium levels were decreased in cell supernatant at 192 h after LIPUS exposure. However, alkaline phosphatase and TGF-β1 concentrations remained unchanged. Therapeutic pulsed ultrasound is capable of stimulating differentiation and mineralization of pre-osteoblastic MC3T3-E1 cells by calcium and phosphate uptake with consequent hydroxyapatite formation. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. [Effect of NF-κB on the expression of interleukin-6 induced by lipopolysaccharides of Porphyromonas endodontalis in MC3T3-E1 cells].

    Science.gov (United States)

    Yu, Ya-qiong; Guo, Jia-jie; Qiu, Li-hong; Lv, You; Jia, Ge; Guo, Yan

    2013-08-01

    To investigate the effect of NF-κB signaling on the expression of interleukin-6(IL-6) induced by lipopolysaccharides(LPS) extracted from Porphyromonas endodontalis(P.e) in MC3T3-El cells. MC3T3-E1 cells were pretreated with BAY-117082 for 1 h, and then were treated with 10 mg/L P.e-LPS for different times. The translocation of NF-κB was observed by immunofluorescence. The expression of IL-6 was detected by reverse transcription polymerse chain reaction (RT-PCR) and enzyme-linked immuno sorbent assay (ELISA). Statistical analysis was performed using multi-way ANOVA and Dunnett's t test with SPSS 13.0 software package. The staining of NF-κB was mostly in cytoplasm in untreated cells. Rapid translocation of NF-κB into nucleus was observed in the cells stimulated for 30 min and mostly relocalization of NF-κB from nucleus to cytoplasm was observed after 60 min. Pretreatment with 10 μmol/L BAY-117082 for 1h significantly inhibited P.e-LPS-induced translocation of NF-κB .The mRNA and proteins of IL-6 decreased significantly after pretreatment with 10 μmol/L BAY-117082 and the expression of IL-6 proteins was reduced from (774.983±6.585) ng/L to (377.384±14.620) ng/L (P<0.01). The group of treatment with BAY-117082 alone had no significant difference from the blank control group. P.e-LPS can induce translocation of NF-κB in mouse osteoblast MC3T3-El, and P.e-LPS may induce the expression of IL-6 in mouse osteoblast through the signaling of NF-κB.

  16. Preliminary assessment of an S.G.H.W. type research reactor

    International Nuclear Information System (INIS)

    Bicevskis, A.; Chapman, A.G.; Hesse, E.W.

    1970-08-01

    A preliminary design study has been made of a research reactor, based on the enriched S.G.H.W.R. concept, to be used for power reactor fuel irradiation, isotope production, basic research, and training in nuclear technology. A reactor physics assessment established a core size which would allow uninterrupted operation for the required irradiation period consistent with low capital and operating costs. A design was selected with 24 channels, a D 2 O calandria diameter of 2.7 m and an overall core height of 4.0 m. The capital cost was estimated as $750,000 for the fuel and $1,600,000 for the moderator, the refuelling cost being $340,000 per annum. A thermal design study showed that the fission heat of 65 MW could be transmitted to pressurised light water at 200 lb/in 2 abs. and rejected to sea water in two conventional U-tube heat exchangers. The basic design is flexible and can be adapted to meet many special requirements. (author)

  17. Enter B and W: two new meningococcal vaccine programmes launched.

    Science.gov (United States)

    Ladhani, Shamez N; Ramsay, Mary; Borrow, Ray; Riordan, Andrew; Watson, John M; Pollard, Andrew J

    2016-01-01

    In 2015, the UK became the first country in the world to have a comprehensive routine meningococcal vaccine programme targeting all of the main capsular groups of N. meningitidis. 1 An infant vaccine programme against meningococcal capsular group B Neisseria meningitidis (MenB) was launched from 1st September with an aim to reduce endemic MenB disease in early childhood. On 1st August 2015, an adolescent programme against groups A, C, W and Y meningococci (MenACWY) was rolled out to halt a growing outbreak of capsular group W disease (MenW) caused by a hypervirulent clone of N. meningitidis, in addition to maintaining control against MenC disease provided by the current adolescent programme. 2. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  18. Reactive synthesis of Ti-W-Cr-B mixing powder by spark plasma sintering; Hoden plasma shoketsu ni yoru Ti-W-Cr-B kongo funmatsu no hanno gosei

    Energy Technology Data Exchange (ETDEWEB)

    Kaga, H. [Hokkaido Industrial Technology Center, Sapporo (Japan); Carrillo-Heian, E.M.; Munir, Z.A. [University of California, CA, (United States)

    2000-08-15

    The reactive sintered compacts of Ti-W-Cr-B mixed powders were manufactured by a pulse electric current technique. Identification and characterization of the resulting boride phase were done using EPMA, XRD and other methods. The density of the sintered compacts rose rapidly with sintering temperature up to 1,773 K, at which temperature the relative density was 94%. Above this temperature, the density rose only slightly with increasing sintering temperature. The borides of Ti and W were synthesized from mixed metal powders by this method. The type of boride formed and its composition depended on sintering temperature. Compacts sintered at lower temperatures consisted of WB{sub 2} and TiB{sub 2} phases, but at the highest sintering temperature, 2,173K, the main phase was (Ti, W, Cr)B{sub 2} solid solution, in which W and Cr were dissolved in TiB{sub 2}. There was also a very small amount of {beta}-(W, Ti, Cr)B phase. By annealing compact sintered at high temperature, the (Ti, W, Cr)B{sub 2} solid solution phase decomposed and the amount decreased. (author)

  19. Metal ion-mediated agonism and agonist enhancement in melanocortin MC1 and MC4 receptors

    DEFF Research Database (Denmark)

    Holst, Birgitte; Elling, Christian E; Schwartz, Thue W

    2002-01-01

    -melanocortin stimulating hormone (alpha-MSH) in the MC1 and MC4 receptors, respectively. In the presence of peptide agonist, Zn(II) acted as an enhancer on both receptors, because it shifted the dose-response curves to the left: most pronounced was a 6-fold increase in alpha-MSH potency on the MC1 receptor. The effect......An endogenous metal-ion site in the melanocortin MC1 and MC4 receptors was characterized mainly in transiently transfected COS-7 cells. ZnCl(2) alone stimulated signaling through the Gs pathway with a potency of 11 and 13 microm and an efficacy of 50 and 20% of that of alpha...... affinities and profiles were similar for a number of the 2,2'-bipyridine and 1,10-phenanthroline analogs in complex with Zn(II) in the MC1 and MC4 receptors. However, the potencies and efficacies of the metal-ion complexes were very different in the two receptors, and close to full agonism was obtained...

  20. MC2-2, Calculation of Fast Neutron Spectra and Multigroup Cross-Sections from ENDF/B Data

    International Nuclear Information System (INIS)

    2001-01-01

    1 - Description of program or function: MC 2 -2 solves the neutron slowing-down equations using basic neutron data derived from ENDF/B data files to determine fundamental mode spectra for use in generating multigroup neutron cross sections. The current edition includes the ability to treat all ENDF/B-V and -VI data representations. It accommodates high-order P scattering representations and provides numerous capabilities such as isotope mixing, delayed neutron processing, free-format input, and flexibility in output data selection. This edition supersedes previous releases of the MC22 program and the earlier MC2 program. Improved physics algorithms and increased computational efficiency are incorporated. Input data files required by MC2-2 may be generated from ENDF/B data by the code ETOE-2. The hyper-fine-group integral transport theory module of MC2-2, RABANL, is an improved version of the RABBLE/RABID codes. Many of the MC2-2 modules are used in the SDX code. 2 - Methods: The extended transport P1, B1, consistent P1, and consistent B1 fundamental mode ultra-fine-group equations are solved using continuous slowing-down theory and multigroup methods. Fast and accurate resonance integral methods are used in the narrow resonance resolved and unresolved resonance treatments. A fundamental mode homogeneous unit cell calculation is performed using either a multigroup or a continuous slowing-down treatment. Multigroup neutron homogeneous cross sections are generated in an ISOTXS format for an arbitrary group structure. A hyper-fine-group integral transport slowing down calculation (RABANL) is available as an option. RABANL performs a homogeneous or heterogeneous (pin or slab) unit cell calculation over the resonance region (resolved and unresolved) and generates multigroup neutron cross sections in an ISOTXS format. Neutron cross sections are generated by RABANL for the homogeneous unit cell and for each heterogeneous region in the pin or slab unit cell calculation

  1. General tests for t→W+b couplings at hadron colliders

    International Nuclear Information System (INIS)

    Nelson, C.A.; Kress, B.T.; Lopes, M.; McCauley, T.P.

    1997-01-01

    The modularity property of the helicity formalism is used to provide amplitude expressions and stage-two spin-correlation functions which can easily be used in direct experimental searches for electroweak symmetries and dynamics in the decay processes t→W + b and bar t→W - bar b. The formalism is used to describe the decay sequences t→W + b→(l + ν)b and t→W + b→(j bar d j u )b. Helicity amplitudes for t→W + b are obtained for the most general J bar bt current. Thereby, the most general Lorentz-invariant decay density matrix for t→W + b→(l + ν)b or for t→W + b→(j bar d j u )b is expressed in terms of eight helicity parameters and, equivalently, in terms of the structures of the J bar bt current. The parameters are physically defined in terms of partial-width intensities for polarized final states in t→W + b decay. The full angular distribution for the reactions q bar q and gg→t bar t→(W + b)(W - bar b)→ hor-ellipsis can be used to measure these parameters. Since this adds on spin-correlation information from the next stage of decays in the decay sequence, such an energy-angular distribution is called a stage-two spin-correlation function. copyright 1997 The American Physical Society

  2. Modification of the IAN-R1 reactor

    International Nuclear Information System (INIS)

    Jaime, J.; Ahumada, S.; Spin, R.A.

    1990-01-01

    The IAN-R1 reactor is the only nuclear reactor operating in Colombia; it is installed at the Institute of Nuclear Affairs (AIN) in Bogota, which is an official body coming under the Ministry of Mining and Energy. This reactor started operation in January 1965 with a rated power of 10 kW and was modified a year later to operate at 20 kW, which has been its rated power up to the present. Given its importance for the application of nuclear technology in Columbia for various purposes, principally in the areas of neutron activation analysis, determination of uranium content in minerals using the delayed neutron counting method, production of certain radioisotopes such as 198 Au and 82 Br for engineering applications, and production of radioactive material for teaching and research purposes, research has been in progress for some years into ways of increasing its power. The study on experimental requirements and on the demand for locally produced radioisotopes came to the conclusion that its power should be increased to 1000 kW, which would allow the facility to remain on the same site. The modification includes conversion of the core to low-enriched fuel, operation up to 1 MW, modification of the shielding, renovation of instrumentation and installation of a radioisotope processing plant. When the reactor is modified we will be able to produce other radioisotopes for applications in nuclear medicine, industry and engineering; at the same time, the safety of the facility will be optimized and the experimental facilities improved

  3. Experimental study of the IPR-R1 TRIGA reactor power channels responses

    International Nuclear Information System (INIS)

    Mesquita, Henrique F.A.; Ferreira, Andrea V.

    2015-01-01

    The IPR-R1 nuclear reactor installed at Centro de Desenvolvimento da Tecnologia Nuclear CDTN/CNEN, Belo Horizonte, Brazil, is a Mark I TRIGA reactor (Training, Research, Isotopes, General Atomics) and became operational on November of 1960. The reactor has four irradiation devices: a rotary specimen rack with 40 irradiation channels, the central tube, and two pneumatic transfer tubes. The nuclear reactor is operated in a power range between zero and 100 kW. The instrumentation for IPR-R1 operation is mainly composed of four neutronic channels for power measurements. The aim of this work is to investigate the responses of neutronic channels of IPR-R1, Linear, Log N and Percent Power channels, and to check their linearity. Gold foils were activated at low powers (0.125-1.000 kW), and cobalt foils were activated at high powers (10-100kW). For each sample irradiated at rotary specimen rack, another one was irradiated at the same time at the pneumatic transfer tube-2. The obtained results allowed evaluating the linearity of the neutronic channels responses. (author)

  4. Thermal hydraulic analysis of the IPR-R1 TRIGA reactor; Analise termo-hidraulica do reator TRIGA IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Veloso, Marcelo Antonio [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil); Fortini, Maria Auxiliadora [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear

    2002-07-01

    The subchannel approach, normally employed for the analysis of power reactor cores that work under forced convection, have been used for the thermal hydraulic evaluation of a TRIGA Mark I reactor, named IPR-R1, at 250 kW power level. This was accomplished by using the PANTERA-1P subchannel code, which has been conveniently adapted to the characteristics of natural convection of TRIGA reactors. The analysis of results indicates that the steady state operation of IPR-R1 at 250 kW do not imply risks to installations, workers and public. (author)

  5. Preclinical evaluation of melanocortin-1 receptor (MC1-R) specific 68Ga- and 44Sc-labeled DOTA-NAPamide in melanoma imaging.

    Science.gov (United States)

    Nagy, Gábor; Dénes, Noémi; Kis, Adrienn; Szabó, Judit P; Berényi, Ervin; Garai, Ildikó; Bai, Péter; Hajdu, István; Szikra, Dezső; Trencsényi, György

    2017-08-30

    Alpha melanocyte stimulating hormone (α-MSH) enhances melanogenesis in melanoma malignum by binding to melanocortin-1 receptors (MC1-R). Earlier studies demonstrated that alpha-MSH analog NAPamide molecule specifically binds to MC1-R receptor. Radiolabeled NAPamide is a promising radiotracer for the non-invasive detection of melanin producing melanoma tumors by Positron Emission Tomography (PET). In this present study the MC1-R selectivity of the newly developed Sc-44-labeled DOTA-NAPamide was investigated in vitro and in vivo using melanoma tumors. DOTA-NAPamide was labeled with Ga-68 and Sc-44 radionuclides. The MC1-R specificity of Ga-68- and Sc-44-labeled DOTA-NAPamide was investigated in vitro and in vivo using MC1-R positive (B16-F10) and negative (A375) melanoma cell lines. For in vivo imaging studies B16-F10 and A375 tumor-bearing mice were injected with 44 Sc/ 68 Ga-DOTA-NAPamide (in blocking studies with α-MSH) and whole body PET/MRI scans were acquired. Radiotracer uptake was expressed in terms of standardized uptake values (SUVs). 44 Sc/ 68 Ga-labeled DOTA-NAPamide were produced with high specific activity (approx. 19 GBq/μmol) and with excellent radiochemical purity (99%DOTA-NAPamide (SUVmean: 0.38±0.02), and Sc-44-DOTA-NAPamide (SUVmean: 0.52±0.13) uptake was observed in subcutaneously growing B16-F10 tumors, than in receptor negative A375 tumors, where the SUVmean values of Ga-68-DOTA-NAPamide and Sc-44-DOTA-NAPamide were 0.04±0.01 and 0.07±0.01, respectively. Tumor-to-muscle (T/M SUVmean) ratios were approximately 15-fold higher in B16-F10 tumor-bearing mice, than that of A375 tumors, and this difference was also significant (p≤0.01) using both radiotracers after 60 min incubation time. Our newly synthesized 44 Sc-labeled DOTA-NAPamide probe showed excellent binding properties to melanocortin-1 receptor (MC1-R) positive melanoma cell and tumors. Due to its high specificity and sensitivity 44 Sc-DOTA-NAPamide is a promising radiotracer in

  6. History of research reactor fuel fabrication at Babcock and Wilcox

    International Nuclear Information System (INIS)

    Freim, James B.

    1983-01-01

    B and W Research Reactor Fuel Element facility at Lynchburg, Virginia now produces national laboratory and university fuel assemblies. The Company's 201000 square foot facility is devoted entirely to supplying research fuel and related products. B and W re-entered the research reactor fuel market in 1981

  7. The 4th surveillance test and evaluation of the reactor pressure vessel material (capsule W) of Younggwang nuclear power plant unit1

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Byoung Chul; Lee, Sam Lai; Choi, Kwon Jae [Korea Atomic Energy Research Institute, Taejeon (Korea)

    2001-08-01

    Surveillance testing for reactor vessel materials is performed in order to evaluate the irradiation embrittlement due to neutrons during operation and set the condition of safe operation of nuclear reactor. The 4th surveillance testing was performed completely by Korea Atomic Energy Research Institute at Taejeon after the capsule was transported from Yonggwang site including its removal from reactor. Fast neutron fluences for capsules were calculated and various testing including mechanical and chemistry analysis were performed in order to evaluate the integrity of Yonggwang unit 1 reactor vessel during the operation until life time. The evaluation results are as follows; Fast neutron fluences for capsules U, V, X and W are 5.555E+18, 1.662E+19, 3.358E+19, and 4.521E+19 n/cm{sup 2}, respectively. The bias factor, the ratio of measurement versus calculation, was 0.859 for the 1st through 4th testing and the calculational uncertainty, 11.80% satisfied the requirement of USNRC Reg.Guide 1.190, 20%. The best estimated neutron fluence for reactor vessel inside surface was 1.551E+19 n/cm{sup 2} based on the end of 12th fuel cycle and it was predicted that the fluences of vessel inside surface at 32, 40, 48 and 56EFPY would reach 3.929E+19, 4.880E+19, 5.831E+19 and 6.782E+19 n/cm{sup 2} based on the current calculation. The result through this analysis for Yonggwang unit 1 showed that there would be no problem for the pressurized thermal shock(PTS) during the operation until design life. 4 refs., 41 figs., 35 tabs. (Author)

  8. CAD-based Monte Carlo program for integrated simulation of nuclear system SuperMC

    International Nuclear Information System (INIS)

    Wu, Y.; Song, J.; Zheng, H.; Sun, G.; Hao, L.; Long, P.; Hu, L.

    2013-01-01

    SuperMC is a (Computer-Aided-Design) CAD-based Monte Carlo (MC) program for integrated simulation of nuclear systems developed by FDS Team (China), making use of hybrid MC-deterministic method and advanced computer technologies. The design aim, architecture and main methodology of SuperMC are presented in this paper. The taking into account of multi-physics processes and the use of advanced computer technologies such as automatic geometry modeling, intelligent data analysis and visualization, high performance parallel computing and cloud computing, contribute to the efficiency of the code. SuperMC2.1, the latest version of the code for neutron, photon and coupled neutron and photon transport calculation, has been developed and validated by using a series of benchmarking cases such as the fusion reactor ITER model and the fast reactor BN-600 model

  9. HSV-1 strain McKrae is more neuroinvasive than HSV-1 KOS after corneal or vaginal inoculation in mice.

    Science.gov (United States)

    Wang, Hong; Davido, David J; Morrison, Lynda A

    2013-05-01

    Strains of HSV-1 have been noted to vary in their pathogenesis. We compared the replication of strains KOS and McKrae in mice by two routes of infection, ocular and vaginal. Peripheral replication of KOS was similar (cornea) or attenuated over time (vagina) compared with McKrae; however, McKrae replicated in the nervous system to significantly higher levels than KOS after inoculation by either route. Host genetic background strongly influenced the capacity for virus entry into the nervous system from the vagina. KOS and McKrae replicated equivalently after intracranial inoculation, indicating that McKrae's pathogenic phenotype is linked to neuroinvasiveness rather than neurovirulence. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. Arthur B. McDonald, Physics Nobel Laureate 2015, at CERN colloquium

    CERN Multimedia

    Ordan, Julien Marius

    2017-01-01

    Arthur B. McDonald, Physics Nobel Laureate 2015, photographed at CERN colloquium on the "Science of the Sudbury Neutrino Observatory (SNO) and SNOLAB” given in CERN Main Auditorium on Monday 4 Sep 2017

  11. Localized corrosion problems in water reactors

    International Nuclear Information System (INIS)

    Coriou, Henri.

    1977-01-01

    Main localized etching on the structure materials of water reactors are studied: stress corrosion on stainless steel 304 (B.W.R), stress corrosion, 'wall thinning' and denting of Inconel 600 vapor generator tubes (P.W.R.). Some mechanisms are examined and practical exemples in reactors are described. Various possible cures are presented [fr

  12. Verification of the linearity of the IPR-R1 TRIGA reactor power channels

    International Nuclear Information System (INIS)

    Souza, Rose Mary Gomes do Prado; Campolina, Daniel de Almeida Magalhaes

    2013-01-01

    The aim of this paper is to verify the linearity of the three power channels of the IPR-R1 TRIGA reactor. Located at Nuclear Technology Development Center-CDTN in Belo Horizonte, the IPR-R1 reactor is a typical 100 kW Mark I light-water reactor cooled by natural convection. When the experiments were performed, the reactor core had 59 fuel elements, containing 8% by weight of uranium enriched to 20% in 235 U. The core has cylindrical configuration with an annular graphite reflector. The responses of the detectors of the Linear, Log N and Percent Power channels were compared with the responses of detectors which only depend on the overall neutron flux within the reactor. Gold and cobalt foils were activated at low and high powers, respectively, and the specific count results were compared with measurements performed, simultaneously, with a fission chamber, and with the power registered by the three channels. The results show that the Linear channel responds linearly up to 100 kW, and the Log N channel responses are linear at low powers. In the range of high power, the Log N and the Percent Power channels exhibit linearity only from 10 kW to 50 kW. (author)

  13. Multinode analysis of small breaks for B and W's 177-fuel-assembly nuclear plants with raised loop arrangement and internals vent valves

    International Nuclear Information System (INIS)

    Cartin, L.R.; Hill, J.M.; Parks, C.E.

    1976-03-01

    Multinode analyses were conducted for several small breaks in the reactor coolant system of B and W's 177-fuel-assembly nuclear plants with a raised loop arrangement and internals vent valves. The multinode blowdown code CRAFT was used to evaluate the hydrodynamics and transient water inventories of the reactor coolant system. The FOAM code was used to compute a swell level history for the core, and THETAL-B was used to perform transient fuel pin thermal calculations. Curves showing parameters of interest are presented. The results of these analyses are acceptable within the guidelines set forth in the Final Acceptance Criteria

  14. Validation study of the reactor physics lattice transport code WIMSD-5B by TRX and BAPL critical experiments of light water reactors

    International Nuclear Information System (INIS)

    Khan, M.J.H.; Alam, A.B.M.K.; Ahsan, M.H.; Mamun, K.A.A.; Islam, S.M.A.

    2015-01-01

    Highlights: • To validate the reactor physics lattice code WIMSD-5B by this analysis. • To model TRX and BAPL critical experiments using WIMSD-5B. • To compare the calculated results with experiment and MCNP results. • To rely on WIMSD-5B code for TRIGA calculations. - Abstract: The aim of this analysis is to validate the reactor physics lattice transport code WIMSD-5B by TRX (thermal reactor-one region lattice) and BAPL (Bettis Atomic Power Laboratory-one region lattice) critical experiments of light water reactors for neutronics analysis of 3 MW TRIGA Mark-II research reactor at AERE, Dhaka, Bangladesh. This analysis is achieved through the analysis of integral parameters of five light water reactor critical experiments TRX-1, TRX-2, BAPL-UO 2 -1, BAPL-UO 2 -2 and BAPL-UO 2 -3 based on evaluated nuclear data libraries JEFF-3.1 and ENDF/B-VII.1. In integral measurements, these experiments are considered as standard benchmark lattices for validating the reactor physics lattice transport code WIMSD-5B as well as evaluated nuclear data libraries. The integral parameters of the said critical experiments are calculated using the reactor physics lattice transport code WIMSD-5B. The calculated integral parameters are compared to the measured values as well as the earlier published MCNP results based on the Chinese evaluated nuclear data library CENDL-3.0 for assessment of deterministic calculation. It was found that the calculated integral parameters give mostly reasonable and globally consistent results with the experiment and the MCNP results. Besides, the group constants in WIMS format for the isotopes U-235 and U-238 between two data files have been compared using WIMS library utility code WILLIE and it was found that the group constants are well consistent with each other. Therefore, this analysis reveals the validation study of the reactor physics lattice transport code WIMSD-5B based on JEFF-3.1 and ENDF/B-VII.1 libraries and can also be essential to

  15. Depleted Reactor Analysis With MCNP-4B

    International Nuclear Information System (INIS)

    Caner, M.; Silverman, L.; Bettan, M.

    2004-01-01

    Monte Carlo neutronics calculations are mostly done for fresh reactor cores. There is today an ongoing activity in the development of Monte Carlo plus burnup code systems made possible by the fast gains in computer processor speeds. In this work we investigate the use of MCNP-4B for the calculation of a depleted core of the Soreq reactor (IRR-1). The number densities as function of burnup were taken from the WIMS-D/4 cell code calculations. This particular code coupling has been implemented before. The Monte Carlo code MCNP-4B calculates the coupled transport of neutrons and photons for complicated geometries. We have done neutronics calculations of the IRR-1 core with the WIMS and CITATION codes in the past Also, we have developed an MCNP model of the IRR-1 standard fuel for a criticality safety calculation of a spent fuel storage pool

  16. Determination of standard Ghibbs free energy of formation of NiW sub 2 B sub 2 and activity of Ni-W binary system by EMF measurement. Kidenryokuho ni yoru NiW sub 2 B sub 2 no hyojun seisei Gibbs jiyu energy to Ni-W 2 seibunkei no katsuryo no sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Kayama, Koichiro; Hashimoto, Yasuhiko; Suzuki, Kenji; Matsuo, Hideki (Himeji Inst. of Tech., Hyogo (Japan) Fukushin Electric Co., Ltd., Hyogo (Japan))

    1989-12-25

    NiW {sub 2} B {sub 2} (M phase), existing in trinary Ni-W-B system, was measured in standard Gibbs free energy (GF) of formation in the temperature range from 1273K to 1423K by an electromotive force method (EMF) with use of solid oxide electrolyte. First, oxide phase in equilibrium with three-phase M-W-Ni solid solution region was confirmed to be B {sub 2} O {sub 3}. Binary Ni-W system solid solution in equilibrium with M phase and W phase is constant in composition with Ni-16.4mo1%W in the above temperature range. WO {sub 2} and WO {sub 2.72} were actually measured in GF. As Ni-W solid solution is in equilibrium with WO {sub 2} and WO {sub 2.72}, binary Ni-W system was measured in activity by the EMF, and Ni-16.4mo1%W solid solution was calculated in GF of mixing by use of the above measured GF of WO {sub 2} and WO {sub 2.72}. Finally with use of sample in M-W-Ni solid solution region, M phase was calculated in GF by the EMF. The result of those calculations were expressed with experimental formulas. 19 refs., 10 figs., 3 tabs.

  17. W/Z + Heavy-Flavor Measurements with ATLAS

    CERN Document Server

    Law, Alexander Thomas; The ATLAS collaboration

    2015-01-01

    The production of heavy flavour in association with a W or Z boson represent important backgrounds to Higgs and BSM studies and are challenging to calculate in QCD. Several precision measurements were performed using pp data at 7 TeV of integrated as well as differential cross sections. Comparisons are made to a diverse set of state-­of­the­-art NLO QCD calculations, some of which are interfaced to MC generators for parton showering and hadronization. Z+b, Z+bb and W+b production probe the b­-quark production by high-­order QCD processes. Cross sections are measured differentially as a function of a diverse set of kinematic variables like the jet multiplicity, transverse momentum or rapidity of the leading b­jet or variables describing the kinematics of the di-­b­jet system. Measurement of W+c production cross section has a unique sensitivity to the strange-­quark density, which is poorly known at low x.

  18. Prediction of the damage-associated non-synonymous single nucleotide polymorphisms in the human MC1R gene.

    Science.gov (United States)

    Hepp, Diego; Gonçalves, Gislene Lopes; de Freitas, Thales Renato Ochotorena

    2015-01-01

    The melanocortin 1 receptor (MC1R) is involved in the control of melanogenesis. Polymorphisms in this gene have been associated with variation in skin and hair color and with elevated risk for the development of melanoma. Here we used 11 computational tools based on different approaches to predict the damage-associated non-synonymous single nucleotide polymorphisms (nsSNPs) in the coding region of the human MC1R gene. Among the 92 nsSNPs arranged according to the predictions 62% were classified as damaging in more than five tools. The classification was significantly correlated with the scores of two consensus programs. Alleles associated with the red hair color (RHC) phenotype and with the risk of melanoma were examined. The R variants D84E, R142H, R151C, I155T, R160W and D294H were classified as damaging by the majority of the tools while the r variants V60L, V92M and R163Q have been predicted as neutral in most of the programs The combination of the prediction tools results in 14 nsSNPs indicated as the most damaging mutations in MC1R (L48P, R67W, H70Y, P72L, S83P, R151H, S172I, L206P, T242I, G255R, P256S, C273Y, C289R and R306H); C273Y showed to be highly damaging in SIFT, Polyphen-2, MutPred, PANTHER and PROVEAN scores. The computational analysis proved capable of identifying the potentially damaging nsSNPs in MC1R, which are candidates for further laboratory studies of the functional and pharmacological significance of the alterations in the receptor and the phenotypic outcomes.

  19. Prediction of the damage-associated non-synonymous single nucleotide polymorphisms in the human MC1R gene.

    Directory of Open Access Journals (Sweden)

    Diego Hepp

    Full Text Available The melanocortin 1 receptor (MC1R is involved in the control of melanogenesis. Polymorphisms in this gene have been associated with variation in skin and hair color and with elevated risk for the development of melanoma. Here we used 11 computational tools based on different approaches to predict the damage-associated non-synonymous single nucleotide polymorphisms (nsSNPs in the coding region of the human MC1R gene. Among the 92 nsSNPs arranged according to the predictions 62% were classified as damaging in more than five tools. The classification was significantly correlated with the scores of two consensus programs. Alleles associated with the red hair color (RHC phenotype and with the risk of melanoma were examined. The R variants D84E, R142H, R151C, I155T, R160W and D294H were classified as damaging by the majority of the tools while the r variants V60L, V92M and R163Q have been predicted as neutral in most of the programs The combination of the prediction tools results in 14 nsSNPs indicated as the most damaging mutations in MC1R (L48P, R67W, H70Y, P72L, S83P, R151H, S172I, L206P, T242I, G255R, P256S, C273Y, C289R and R306H; C273Y showed to be highly damaging in SIFT, Polyphen-2, MutPred, PANTHER and PROVEAN scores. The computational analysis proved capable of identifying the potentially damaging nsSNPs in MC1R, which are candidates for further laboratory studies of the functional and pharmacological significance of the alterations in the receptor and the phenotypic outcomes.

  20. Theoretical study for ICRF sustained LHD type p-11B reactor

    International Nuclear Information System (INIS)

    Watanabe, Tsuguhiro

    2003-04-01

    This is a summary of the workshop on 'Theoretical Study for ICRF Sustained LHD Type p- 11 B Reactor' held in National Institute for Fusion Science (NIFS) on July 25, 2002. In the workshop, study of LHD type D- 3 He reactor is also reported. A review concerning the advanced nuclear fusion fuels is also attached. This review was reported at the workshop of last year. The development of the p- 11 B reactor research which uses the LHD magnetic field configuration has been briefly summarized in section 1. In section 2, an integrated report on advanced nuclear fusion fuels is given. Ignition conditions in a D- 3 He helical reactor are summarized in section 3. 0-dimensional particle and power balance equations are solved numerically assuming the ISS95 confinement law including a confinement factor (γ HH ). It is shown that high average beta plasma confinement, a large confinement factor (γ HH > 3) and the hot ion mode (T i /T e > 1.4) are necessary to achieve the ignition of the D- 3 He helical reactor. Characteristics of ICRF sustained p- 11 B reactor are analyzed in section 4. The nuclear fusion reaction rate is derived assuming a quasilinear plateau distribution function (QPDF) for protons, and an ignition condition of p- 11 B reactor is shown to be possible. The 3 of the presented papers are indexed individually. (J.P.N.)

  1. Stan wiedzy na temat czynników ryzyka i profilaktyki chorób cywilizacyjnych a zachowania zdrowotne pracowników medycznych i niemedycznych

    Directory of Open Access Journals (Sweden)

    Grzegorz Józef Nowicki

    2017-03-01

    Full Text Available Cel pracy. Określenie stanu wiedzy na temat czynników ryzyka i profilaktyki wybranych chorób cywilizacyjnych i określenie związku z poziomem deklarowanych zachowań zdrowotnych wśród pracowników medycznych i niemedycznych. Materiał i metody. Badania przeprowadzono wśród 598 dorosłych osób pracujących, wykonujących zawody medyczne (grupa M i pozamedyczne (grupa P. Metodą badawczą był sondaż diagnostyczny przy użyciu Testu wiedzy na temat czynników ryzyka i profilaktyki chorób cywilizacyjnych (własnego autorstwa oraz Inwentarza Zachowań Zdrowotnych (IZZ. Wyniki. Analizując materiał badawczy na temat stanu wiedzy o czynnikach ryzyka i profilaktyce chorób cywilizacyjnych uzyskany od osób z grupy M, stwierdzono że: niski poziom wiedzy charakteryzował 1,97% (n=6 badanych, przeciętny 29,18% (n=89 a wysoki aż 68,85% (n=210. Natomiast w grupa P niski poziomem wiedzy charakteryzował 16,04% (n=47 respondentów, 55,29% (n=162 przeciętny, a 28,67% (n=84 – wysoki. Stwierdzono, że wśród badanych z grupy P wraz ze wzrostem poziomu wiedzy na temat czynników ryzyka i profilaktyki chorób cywilizacyjnych rośnie ocena ogólnego wskaźnika zachowań zdrowotnych oraz jego czterech kategorii (p<0,05. Wnioski. Stan wiedzy na temat czynników ryzyka i profilaktyki chorób cywilizacyjnych stanowi ważny czynnik determinujący poziom zachowań zdrowotnych głównie wśród osób wykonujących zawody pozamedyczne.

  2. Assessment of torsatrons as reactors

    International Nuclear Information System (INIS)

    Lyon, J.F.; Painter, S.L.

    1992-12-01

    Stellarators have significant operational advantages over tokamaks as ignited steady-state reactors because stellarators have no dangerous disruptions and no need for continuous current drive or power recirculated to the plasma, both easing the first wall, blanket, and shield design; less severe constraints on the plasma parameters and profiles; and better access for maintenance. This study shows that a reactor based on the torsatron configuration (a stellarator variant) could also have up to double the mass utilization efficiency (MUE) and a significantly lower cost of electricity (COE) than a conventional tokamak reactor (ARIES-I) for a range of assumptions. Torsatron reactors can have much smaller coil systems than tokamak reactors because the coils are closer to the plasma and they have a smaller cross section (higher average current density because of the lower magnetic field). The reactor optimization approach and the costing and component models are those used in the current stage of the ARIES-I tokamak reactor study. Typical reactor parameters for a 1-GW(e) Compact Torsatron reactor example are major radius R 0 = 6.6-8.8 m, on-axis magnetic field B 0 = 4.8-7.5 T, B max (on coils) = 16 T, MUE 140-210 kW(e)/tonne, and COE (in constant 1990 dollars) = 67-79 mill/kW(e)h. The results are relatively sensitive to assumptions on the level of confinement improvement and the blanket thickness under the inboard half of the helical windings but relatively insensitive to other assumptions

  3. Extensive utilisation of VR-1 reactor for nuclear education and training

    International Nuclear Information System (INIS)

    Rataj, J.

    2010-01-01

    The paper presents utilisation of the VR-1 reactor for nuclear education and training at national and international level. VR-1 reactor has been operating by the Czech Technical University since December 1990. The reactor is a pool-type light water reactor based on enriched uranium (19.7% 235 U) with maximum thermal power 1kW and for short time period up to 5kW. The moderator of neutrons is light water, which is also used as a reflector, a biological shielding and a coolant. Heat is removed from the core by natural convection. The pool disposition of the reactor facilitates access to the core, setting and removing of various experimental samples and detectors, easy and safe handling of fuel assemblies. The reactor core can contain from 17 to 21 fuel assemblies IRT-4M, depending on the geometric arrangement and kind of experiments to be performed in the reactor. The reactor is equipped with several experimental devices; e.g. horizontal, radial and tangential channels used to take out a neutron beam, reactivity oscillator for dynamics study and bubble boiling simulator. The reactor has been used very efficiently especially for education and training of university students and NPP's specialists for more than 18 years. The VR-1 reactor is utilised within various national and international activities such as Czech Nuclear Education Network (CENEN), European Nuclear Education Network and also Eastern European Research Reactor Initiative (EERRI). The reactor is well equipped for education and training not only by the experimental facility itself but also by incessant development of training methods and improvement of education experiments. The education experiments can be combined into training courses attended by students according to their study specialization and knowledge level. The training programme is aimed to the reactor and neutron physics, dosimetry, nuclear safety, and control of nuclear installations. Every year, approximately 250 university students undergo

  4. W-1 Sodium Loop Safety Facility experiment centerline fuel thermocouple performance

    International Nuclear Information System (INIS)

    Meyers, S.C.; Henderson, J.M.

    1980-05-01

    The W-1 Sodium Loop Safety Facility (SLSF) experiment is the fifth in a series of experiments sponsored by the Department of Energy (DOE) as part of the National Fast Breeder Reactor (FBR) Safety Assurance Program. The experiments are being conducted under the direction of Argonne National Laboratory (ANL) and Hanford Engineering Development Laboratory (HEDL). The irradiation phase of the W-1 SLSF experiment was conducted between May 27 and July 20, 1979, and terminated with incipient fuel pin cladding failure during the final boiling transient. Experimental hardware and facility performed as designed, allowing completion of all planned tests and test objectives. This paper focuses on high temperature in-fuel thermocouples and discusses their development, fabrication, and performance in the W-1 experiment

  5. Implatation of MC2 computer code

    International Nuclear Information System (INIS)

    Seehusen, J.; Nair, R.P.K.; Becceneri, J.C.

    1981-01-01

    The implantation of MC2 computer code in the CDC system is presented. The MC2 computer code calculates multigroup cross sections for tipical compositions of fast reactors. The multigroup constants are calculated using solutions of PI or BI approximations for determined buckling value as weighting function. (M.C.K.) [pt

  6. Impact of bundle deformation on CHF: ASSERT-PV assessment of extended burnup Bruce B bundle G85159W

    International Nuclear Information System (INIS)

    Rao, Y.F.; Manzer, A.M.

    2005-01-01

    This paper presents a subchannel thermalhydraulic analysis of the effect on critical heat flux (CHF) of bundle deformation such as element bow and diametral creep. The bundle geometry is based on the post-irradiation examination (PIE) data of a single bundle from the Bruce B Nuclear Generating Station, Bruce B bundle G85159W, which was irradiated for more than two years in the core during reactor commissioning. The subchannel code ASSERT-PV IST is used to assess changes in CHF and dryout power due to bundle deformation, compared to the reference, undeformed bundle. (author)

  7. iB1350 no.1. A generation III.7 reactor after the Fukushima Daiichi accident

    International Nuclear Information System (INIS)

    Sato, Takashi; Matsumoto, Keiji; Hosomi, Kenji; Kojima, Yoshihiro; Taguchi, Keisuke

    2017-01-01

    iB1350 stands for an innovative, intelligent and inexpensive BWR 1350. It is the first generation III.7 reactor after the Fukushima Daiichi accident. It has incorporated lessons learned from the Fukushima Daiichi accident and WENRA safety objectives. It has innovative safety to cope with devastating natural disasters including a giant earthquake, a large tsunami and a monster hurricane. The iB1350 can survive passively such devastation and a very prolonged SBO without any support from the outside of a site up to 7 days even preventing core melt. It, however, is based on the well-established proven ABWR design. The NSSS is exactly the same as that of the current ABWR. As for safety design, it has a double cylinder RCCV (Mark W containment) and in-depth hybrid safety systems (IDHS). The Mark W containment has double FP confinement barriers and the in-containment filtered venting system (IFVS) that enable passively no emergency evacuation outside the immediate vicinity of the plant for a SA. It has a large volume to hold hydrogen, an innovative core catcher (iCC), a passive flooding system and an innovative passive containment cooling system (iPCCS) establishing passively practical elimination of containment failure even in a long term. The IDHS consists of 4 division active safety systems for a DBA, 2 division active safety systems for a SA and built-in passive safety systems (BiPSS) consisting of an isolation condenser (IC) and the iPCCS for a SA. While the conventional PCCS can never cool the S/P, the iPCCS can automatically cool the S/P directly even in a DBA LOCA. That makes it possible for the iB1350 to optimize the active safety systems for a DBA. Sato came up with several optimized configurations of the IDHS that are expected to achieve further cost reduction and enhance its reliability resulting from passive feature of the iPCCS. The IC/iPCCS pool has enough capacity for 7 day grace period. The IC/iPCCS heat exchangers, the core and the spent fuel pool are

  8. Enter B and W: two new meningococcal vaccine programmes launched

    OpenAIRE

    Ladhani, Shamez N; Ramsay, Mary; Borrow, Ray; Riordan, Andrew; Watson, John M; Pollard, Andrew J

    2016-01-01

    In 2015, the UK became the first country in the world to have a comprehensive routine meningococcal vaccine programme targeting all of the main capsular groups of N. meningitidis. 1 An infant vaccine programme against meningococcal capsular group B Neisseria meningitidis (MenB) was launched from 1st September with an aim to reduce endemic MenB disease in early childhood. On 1st August 2015, an adolescent programme against groups A, C, W and Y meningococci (MenACWY) was rolled out to halt a gr...

  9. Verification of criticality safety in on-site spent fuel storage systems

    International Nuclear Information System (INIS)

    Rasmussen, R.W.

    1989-01-01

    On February 15, 1984, Duke Power Company received approval for a two-region, burnup credit, spent fuel storage rack design at both Units 1 and 2 of the McGuire Nuclear Station. Duke also hopes to obtain approval by January of 1990 for a dry spent fuel storage system at the Oconee Nuclear Station, which will incorporate the use of burnup credit in the criticality analysis governing the design of the individual storage units. While experiences in burnup verification for criticality safety for their dry storage system at Oconee are in the future, the methods proposed for burnup verification will be similar to those currently used at the McGuire Nuclear Station in the two-region storage racks installed in both pools. In conclusion, the primary benefit of the McGuire rerack effort has obviously been the amount of storage expansion it provided. A total increase of about 2,000 storage cells was realized, 1,000 of which were the result of pursuing the two-region rather than the conventional poison rack design. Less impacting, but equally as important, however, has been the experience gained during the planning, installation, and operation of these storage racks. This experience should prove useful for future rerack efforts likely to occur at Duke's Catawba Nuclear Station as well as for the current dry storage effort underway for the Oconee Nuclear Station

  10. Experimental study of the temperature distribution in the TRIGA IPR-R1 Brazilian research reactor

    International Nuclear Information System (INIS)

    Mesquita, Amir Zacarias

    2005-01-01

    The TRIGA-IPR-R1 Research Nuclear Reactor has completed 44 years in operation in November 2004. Its initial nominal thermal power was 30 kW. In 1979 its power was increased to 100 kW by adding new fuel elements to the reactor. Recently some more fuel elements were added to the core increasing the power to 250 kW. The TRIGA-IPR-R1 is a pool type reactor with a natural circulation core cooling system. Although the large number of experiments had been carried out with this reactor, mainly on neutron activation analysis, there is not many data on its thermal-hydraulics processes, whether experimental or theoretical. So a number of experiments were carried out with the measurement of the temperature inside the fuel element, in the reactor core and along the reactor pool. During these experiments the reactor was set in many different power levels. These experiments are part of the CDTN/CNEN research program, and have the main objective of commissioning the TRIGA-IPR-R1 reactor for routine operation at 250 kW. This work presents the experimental and theoretical analyses to determine the temperature distribution in the reactor. A methodology for the calibration and monitoring the reactor thermal power was also developed. This methodology allowed adding others power measuring channels to the reactor by using thermal processes. The fuel thermal conductivity and the heat transfer coefficient from the cladding to the coolant were also experimentally valued. lt was also presented a correlation for the gap conductance between the fuel and the cladding. The experimental results were compared with theoretical calculations and with data obtained from technical literature. A data acquisition and processing system and a software were developed to help the investigation. This system allows on line monitoring and registration of the main reactor operational parameters. The experiments have given better comprehension of the reactor thermal-fluid dynamics and helped to develop numerical

  11. Catalytic Reactor for Inerting of Aircraft Fuel Tanks

    Science.gov (United States)

    1974-06-01

    Aluminum Panels After Triphase Corrosion Test 79 35 Inerting System Flows in Various Flight Modes 82 36 High Flow Reactor Parametric Data 84 37 System...AD/A-000 939 CATALYTIC REACTOR FOR INERTING OF AIRCRAFT FUEL TANKS George H. McDonald, et al AiResearch Manufacturing Company Prepared for: Air Force...190th Street 2b. GROUP Torrance, California .. REPORT TITLE CATALYTIC REACTOR FOR INERTING OF AIRCRAFT FUEL TANKS . OESCRIP TIVE NOTEs (Thpe of refpoft

  12. Pulsed laser-deposited nanocrystalline GdB{sub 6} thin films on W and Re as field emitters

    Energy Technology Data Exchange (ETDEWEB)

    Suryawanshi, Sachin R.; More, Mahendra A. [Savitribai Phule Pune University, Department of Physics, Centre for Advanced Studies in Materials Science and Condensed Matter Physics, Pune (India); Singh, Anil K.; Sinha, Sucharita [Bhabha Atomic Research Centre, Laser and Plasma Technology Division, Trombay, Mumbai (India); Phase, Deodatta M. [UGC-DAE Consortium for Scientific Research Indore Centre, Indore (India); Late, Dattatray J. [CSIR-National Chemical Laboratory, Physical and Materials Chemistry Division, Pune (India)

    2016-10-15

    Gadolinium hexaboride (GdB{sub 6}) nanocrystalline thin films were grown on tungsten (W), rhenium (Re) tips and foil substrates using optimized pulsed laser deposition (PLD) technique. The X-ray diffraction analysis reveals formation of pure, crystalline cubic phase of GdB{sub 6} on W and Re substrates, under the prevailing PLD conditions. The field emission (FE) studies of GdB{sub 6}/W and GdB{sub 6}/Re emitters were performed in a planar diode configuration at the base pressure ∝10{sup -8} mbar. The GdB{sub 6}/W and GdB{sub 6}/Re tip emitters deliver high emission current densities of ∝1.4 and 0.811 mA/cm{sup 2} at an applied field of ∝6.0 and 7.0 V/μm, respectively. The Fowler-Nordheim (F-N) plots were found to be nearly linear showing metallic nature of the emitters. The noticeably high values of field enhancement factor (β) estimated using the slopes of the F-N plots indicate that the PLD GdB{sub 6} coating on W and Re substrates comprises of high-aspect-ratio nanostructures. Interestingly, the GdB{sub 6}/W and GdB{sub 6}/Re planar emitters exhibit excellent current stability at the preset values over a long-term operation, as compared to the tip emitters. Furthermore, the values of workfunction of the GdB{sub 6}/W and GdB6/Re emitters, experimentally measured using ultraviolet photoelectron spectroscopy, are found to be same, ∝1.6 ± 0.1 eV. Despite possessing same workfunction value, the FE characteristics of the GdB{sub 6}/W emitter are markedly different from that of GdB{sub 6}/Re emitter, which can be attributed to the growth of GdB{sub 6} films on W and Re substrates. (orig.)

  13. Physical security at research reactors

    International Nuclear Information System (INIS)

    Clark, R.A.

    1977-01-01

    Of the 84 non-power research facilities licensed under 10 CFR Part 50, 73 are active (two test reactors, 68 research reactors and three critical facilities) and are required by 10 CFR Part 73.40 to provide physical protection against theft of SNM and against industrial sabotage. Each licensee has developed a security plan required by 10 CFR Part 50.34(c) to demonstrate the means of compliance with the applicable requirements of 10 CFR Part 73. In 1974, the Commission provided interim guidance for the organization and content of security plans for (a) test reactors, (b) medium power research and training reactors, and (c) low power research and training reactors. Eleven TRIGA reactors, with power levels greater than 250 kW and all other research and training reactors with power levels greater than 100 kW and less than or equal to 5,000 kW are designated as medium power research and training reactors. Thirteen TRIGA reactors with authorized power levels less than 250 kW are considered to be low power research and training reactors. Additional guidance for complying with the requirements of 73.50 and 73.60, if applicable, is provided in the Commission's Regulatory Guides. The Commission's Office of Inspection and Enforcement inspects each licensed facility to assure that an approved security plan is properly implemented with appropriate procedures and physical protection systems

  14. Higher-order radiative corrections for b b ¯→H-W+

    Science.gov (United States)

    Kidonakis, Nikolaos

    2018-02-01

    I present higher-order radiative corrections from collinear and soft-gluon emission for the associated production of a charged Higgs boson with a W boson. The calculation uses expressions from resummation at next-to-leading-logarithm accuracy. From the resummed cross section I derive analytical formulas at approximate next-to-next-to-leading order and next-to-next-to-next-to-leading order. Total cross sections are presented for the process b b ¯→H-W+ at various LHC energies. The transverse momentum and rapidity distributions of the charged Higgs boson are also calculated.

  15. 76 FR 33777 - Stewart B. McKinney National Wildlife Refuge, Middlesex County, CT; Comprehensive Conservation...

    Science.gov (United States)

    2011-06-09

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R5-R-2011-N043; BAC-4311-K9-S3] Stewart B. McKinney National Wildlife Refuge, Middlesex County, CT; Comprehensive Conservation Plan and... headquarters located in Middlesex County, CT. This notice complies with our CCP policy to: (1) Advise other...

  16. Reactor core conversion studies of Ghana: Research Reactor-1 and proposal for addition of safety rod

    International Nuclear Information System (INIS)

    Odoi, H.C.

    2014-06-01

    The inclusion of an additional safety rod in conjunction with a core conversion study of Ghana Research Reactor-1 (GHARR-1) was carried out using neutronics, thermal hydraulics and burnup codes. The study is based on a recommendation by Integrated Safety Assessment for Research Reactors (INSARP) mission to incorporate a safety rod to the reactor safety system as well as the need to replace the reactor fuel with LEU. Conversion from one fuel type to another requires a complete re-evaluation of the safety analysis. Changes to the reactivity worth, shutdown margin, power density and material properties must be taken into account, and appropriate modifications made. Neutronics analysis including burnup was studied followed by thermal hydraulics analyses which comprise steady state and transients. Four computer codes were used for the analysis; MCNP, REBUS, PLTEP and PARET. The neutronics analysis revealed that the LEU core must be operated at 34 Kw in order to attain the flux of 1.0E12 n/cm 2 .s as the nominal flux of the HEU core. The auxiliary safety rod placed at a modified irradiation site gives a better worth than the cadmium capsules. For core excess reactivity of 4 mk, 348 fuel pins would be appropriate for the GHARR-1 LEU core. Results indicate that flux level of 1.0E12 n/cm 2 .s in the inner irradiation channel will not be compromised, if the power of the LEU core is increased to 34 kW. The GHARR-1 core using LEU-U0 2 -12.5% fuel can be operated for 23 shim cycles, with cycles length 2.5 years, for over 57 years at the 17 kW power level. All 23 LEU cycles meet the ∼ 4.0 mk excess reactivity required at the beginning of cycle . For comparison, the MNSR HEU reference core can also be operated for 23 shim cycles, but with a cycle length of 2.0 years for just over 46 years at 15.0kW power level. It is observed that the GHARR-1 core with LEU UO 2 fuel enriched to 12.5% and a power level of 34 kW can be operated ∼25% longer than the current HEU core operated at

  17. First measurement of the b-jet cross section in events with a W boson in pp collisions at square root(s) = 1.96 TeV.

    Science.gov (United States)

    Aaltonen, T; Adelman, J; Akimoto, T; Alvarez González, B; Amerio, S; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Apollinari, G; Apresyan, A; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Barria, P; Bartos, P; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Beecher, D; Behari, S; Bellettini, G; Bellinger, J; Benjamin, D; Beretvas, A; Beringer, J; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bridgeman, A; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burke, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Calancha, C; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carls, B; Carlsmith, D; Carosi, R; Carrillo, S; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavaliere, V; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Chwalek, T; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Compostella, G; Convery, M E; Conway, J; Cordelli, M; Cortiana, G; Cox, C A; Cox, D J; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Dagenhart, D; Datta, M; Davies, T; de Barbaro, P; De Cecco, S; Deisher, A; De Lorenzo, G; Dell'Orso, M; Deluca, C; Demortier, L; Deng, J; Deninno, M; Derwent, P F; Di Canto, A; di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Elagin, A; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Ferrazza, C; Field, R; Flanagan, G; Forrest, R; Frank, M J; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; Garcia, J E; Garfinkel, A F; Garosi, P; Genser, K; Gerberich, H; Gerdes, D; Gessler, A; Giagu, S; Giakoumopoulou, V; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C M; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Han, B-Y; Han, J Y; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hays, C; Heck, M; Heijboer, A; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hewamanage, S; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Hussein, M; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; James, E; Jang, D; Jayatilaka, B; Jeon, E J; Jha, M K; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Kar, D; Karchin, P E; Kato, Y; Kephart, R; Ketchum, W; Keung, J; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, H W; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kreps, M; Kroll, J; Krop, D; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhr, T; Kulkarni, N P; Kurata, M; Kwang, S; Laasanen, A T; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, E; Lee, H S; Lee, S W; Leone, S; Lewis, J D; Lin, C-S; Linacre, J; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, C; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lovas, L; Lucchesi, D; Luci, C; Lueck, J; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis-Katsikakis, A; Margaroli, F; Marino, C; Marino, C P; Martin, A; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Mathis, M; Mattson, M E; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzione, A; Merkel, P; Mesropian, C; Miao, T; Miladinovic, N; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyake, H; Moed, S; Moggi, N; Mondragon, M N; Moon, C S; Moore, R; Morello, M J; Morlock, J; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Nett, J; Neu, C; Neubauer, M S; Neubauer, S; Nielsen, J; Nodulman, L; Norman, M; Norniella, O; Nurse, E; Oakes, L; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Orava, R; Osterberg, K; Pagan Griso, S; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Peiffer, T; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Pianori, E; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Pueschel, E; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Renton, P; Renz, M; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rodriguez, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Rutherford, B; Saarikko, H; Safonov, A; Sakumoto, W K; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savoy-Navarro, A; Schlabach, P; Schmidt, A; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sforza, F; Sfyrla, A; Shalhout, S Z; Shears, T; Shepard, P F; Shimojima, M; Shiraishi, S; Shochet, M; Shon, Y; Shreyber, I; Simonenko, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spreitzer, T; Squillacioti, P; Stanitzki, M; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Strycker, G L; Suh, J S; Sukhanov, A; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thompson, G A; Thomson, E; Tipton, P; Ttito-Guzmán, P; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Totaro, P; Tourneur, S; Trovato, M; Tsai, S-Y; Tu, Y; Turini, N; Ukegawa, F; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Vellidis, C; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Volobouev, I; Volpi, G; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wagner-Kuhr, J; Wakisaka, T; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Weinelt, J; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Wilbur, S; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Würthwein, F; Xie, S; Yagil, A; Yamamoto, K; Yamaoka, J; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yi, K; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zhang, X; Zheng, Y; Zucchelli, S

    2010-04-02

    The cross section for jets from b quarks produced with a W boson has been measured in pp collision data from 1.9 fb(-1) of integrated luminosity recorded by the CDF II detector at the Tevatron. The W+b-jets process poses a significant background in measurements of top quark production and prominent searches for the Higgs boson. We measure a b-jet cross section of 2.74+/-0.27(stat)+/-0.42(syst) pb in association with a single flavor of leptonic W boson decay over a limited kinematic phase space. This measured result cannot be accommodated in several available theoretical predictions.

  18. J.B. McLachlan: a biography

    Energy Technology Data Exchange (ETDEWEB)

    Frank, D.

    1999-07-01

    This social history and biography of James Bryson McLaughlin (1869-1916) describes McLaughlin's leadership as an educator and instigator in organizing Nova Scotia's coal miners during the labour wars in the 1920s. McLaughlin's background and childhood, education, reputation, religion, family life, health, and death are described. Included are descriptions of the life of coal miners in Cape Breton, radical left politics in Canada and the organizers involved, the political economy of the coal industry, child labour, churches, coal markets and prices, company towns and housing, mining disasters and fatalities, elections, First World War efforts, the depression, immigrants, and strikes. The labour organizations, companies, churches, and politicians involved in the struggles for union acceptance are discussed. 872 refs., 7 figs., 24 photos.

  19. Analysis of the ZPPR-15 Critical Experiments with ENDF/B-V.2 and ENDF/B-VII.0 Data

    International Nuclear Information System (INIS)

    Kim, Sang Ji; Yang, Won Sik; Lee, Changho

    2008-01-01

    This paper presents the analysis results for the ZPPR-15 critical experiments. Using the ENDF/B-V.2 and ENDF/B-VII.0 data, three loading configurations of the ZPPR-15 Phase A experiments were analyzed with the ANL code suite for a fast reactor neutronics analysis, including the recently updated MC 2 -2 code. For the VIM Monte Carlo analyses with 3-D as-built models, the ENDF/B-VII.0 data improved the core multiplication factors by 0.21 to 0.37 %Δk, relative to the ENDF/B-V.2 data. With the plate heterogeneity effects taken into account by the SDX 1-D unit cell calculations, the DIF3D nodal transport solutions with the ENDF/B-V.2 data showed a good agreement for the core multiplication factors with the VIM Monte Carlo results to within 0.12 %Δk, but those with the ENDF/B-VII.0 data showed relatively larger deviations. Sensitivity studies based on the RZ models with homogenized cells showed excellent agreement for the core multiplication factors between the deterministic and Monte Carlo calculations to within 0.1 %Δk for both ENDF/B data. These results indicate that the MC 2 -2 methods are adequate for generating the multigroup cross sections for a fast reactor analysis, but the SDX process to account for the heterogeneity effect needs to be improved for the ENDF/B-VII.0 data. (authors)

  20. GPU v. B and W lawsuit review and its effect on TMI-1 (Docket 50-289)

    International Nuclear Information System (INIS)

    1983-09-01

    This report documents a review by the Nuclear Regulatory Commission (NRC) staff of the General Public Utilities Corporation, et al. v. the Babcock and Wilcox Company, et al. (GPU v. B and W) lawsuit record to assess whether any of the staff's previous conclusions or their principal bases presented at the Three Mile Island Unit 1 (TMI-1) restart hearing, supporting restart of TMI-1, should be amended in light of the information contained in the lawsuit record. Details of the lawsuit record are provided in the appendices contained in Volume II of this report

  1. GPU v. B and W lawsuit review and its effect on TMI-1 (Docket 50-289)

    Energy Technology Data Exchange (ETDEWEB)

    1983-09-01

    This report documents a review by the Nuclear Regulatory Commission (NRC) staff of the General Public Utilities Corporation, et al. v. the Babcock and Wilcox Company, et al. (GPU v. B and W) lawsuit record to assess whether any of the staff's previous conclusions or their principal bases presented at the Three Mile Island Unit 1 (TMI-1) restart hearing, supporting restart of TMI-1, should be amended in light of the information contained in the lawsuit record. Details of the lawsuit record are provided in the appendices contained in Volume II of this report.

  2. Babcock and Wilcox model for predicting in-reactor densification

    International Nuclear Information System (INIS)

    Buescher, B.J.; Pegram, J.W.

    1977-07-01

    The B and W densification model is based on a correlation between in-reactor densification and a thermal resintering test. The densification model has been found to predict in-reactor densification with a remarkable degree of accuracy for fuel pellets operated at heat rates above 5 kW/ft and with considerable conservatism for pellelts operating at heat rates below 5 kW/ft

  3. Environmental Assessment: Demolition of McGuire Central Heat Plant at Joint Base McGuire-Dix-Lakehurst, New Jersey

    Science.gov (United States)

    2012-06-01

    insulation, boiler, holding tank and duct coverings, floor tiles , window caulking/glazing, and corrugated building siding. The asbestos insulation and...facility, with the Bulk Fuel Storage area and the golf course located between them. BOMARC is located several miles from the proposed solar sites...Architectural Resources The Central Heat Plant was constructed in 1956. It is a flat- roofed building originally rectangular in form, and is now L-shaped. The

  4. Research reactors in Austria - Present situation

    International Nuclear Information System (INIS)

    Boeck, H.; Musilek, A.; Villa, M.

    2005-01-01

    In the past decades Austria operated three research reactors, the 10 MW ASTRA reactor at Seibersdorf, the 250 kW TRIGA reactor at the Atominstitut and the 1 kW Argonaut reactor at the Technical University in Graz. Since the shut down of the ASTRA on July 31th, 1999 and its immediate decommissioning reactor and the shut down of the Argonaut reactor in Graz on August 31st, 2004 only one reactor remains operational for keeping nuclear competence in Austria which is the 250 kW TRIGA Mark II reactor. (author)

  5. 1000 kW ICRH amplifiers for MFTF-B

    International Nuclear Information System (INIS)

    Boksberger, U.

    1986-01-01

    For the startup of the MFTF-B ICRH heating will be applied. Two commercial amplifiers derived from standard broadcast transmitters provide 1000 kW RF power each into a matching system for any VSWR as high as 1.5. Emphasis is put on the specific environment of magnetic fields and seismic loads as well as to the particular RF power control requirements and remote operation. Also addressed is the amplifier's performance into a typical load. The load variations due to the MFTF-B plasma coupling were calculated by TRW

  6. MC2-2: a code to calculate fast neutron spectra and multigroup cross sections

    International Nuclear Information System (INIS)

    Henryson, H. II; Toppel, B.J.; Stenberg, C.G.

    1976-06-01

    MC 2 -2 is a program to solve the neutron slowing down problem using basic neutron data derived from the ENDF/B data files. The spectrum calculated by MC 2 -2 is used to collapse the basic data to multigroup cross sections for use in standard reactor neutronics codes. Four different slowing down formulations are used by MC 2 -2: multigroup, continuous slowing down using the Goertzel-Greuling or Improved Goertzel-Greuling moderating parameters, and a hyper-fine-group integral transport calculation. Resolved and unresolved resonance cross sections are calculated accounting for self-shielding, broadening and overlap effects. This document provides a description of the MC 2 -2 program. The physics and mathematics of the neutron slowing down problem are derived and detailed information is provided to aid the MC 2 -2 user in preparing input for the program and implementation of the program on IBM 370 or CDC 7600 computers

  7. CAD-based Monte Carlo program for integrated simulation of nuclear system SuperMC

    International Nuclear Information System (INIS)

    Wu, Yican; Song, Jing; Zheng, Huaqing; Sun, Guangyao; Hao, Lijuan; Long, Pengcheng; Hu, Liqin

    2015-01-01

    Highlights: • The new developed CAD-based Monte Carlo program named SuperMC for integrated simulation of nuclear system makes use of hybrid MC-deterministic method and advanced computer technologies. SuperMC is designed to perform transport calculation of various types of particles, depletion and activation calculation including isotope burn-up, material activation and shutdown dose, and multi-physics coupling calculation including thermo-hydraulics, fuel performance and structural mechanics. The bi-directional automatic conversion between general CAD models and physical settings and calculation models can be well performed. Results and process of simulation can be visualized with dynamical 3D dataset and geometry model. Continuous-energy cross section, burnup, activation, irradiation damage and material data etc. are used to support the multi-process simulation. Advanced cloud computing framework makes the computation and storage extremely intensive simulation more attractive just as a network service to support design optimization and assessment. The modular design and generic interface promotes its flexible manipulation and coupling of external solvers. • The new developed and incorporated advanced methods in SuperMC was introduced including hybrid MC-deterministic transport method, particle physical interaction treatment method, multi-physics coupling calculation method, geometry automatic modeling and processing method, intelligent data analysis and visualization method, elastic cloud computing technology and parallel calculation method. • The functions of SuperMC2.1 integrating automatic modeling, neutron and photon transport calculation, results and process visualization was introduced. It has been validated by using a series of benchmarking cases such as the fusion reactor ITER model and the fast reactor BN-600 model. - Abstract: Monte Carlo (MC) method has distinct advantages to simulate complicated nuclear systems and is envisioned as a routine

  8. Zasób Flores Oratorii – norbertańskiej silvae rerum przechowywanej w Bibliotece Prowincjalnej Franciszkanów w Gnieźnie

    Directory of Open Access Journals (Sweden)

    Zbigniew Joskowski

    2012-01-01

    Full Text Available Artykuł prezentuje zasób norbertańskiej silvae rerum przechowywanej obecnie w dziale zbiorów specjalnych Biblioteki Prowincjalnej Franciszkanów w Gnieźnie (BPFG. Sylwa stanowi swoistą bibliotekę: zbiór odpisóww, oracji dotyczących bieżącego życia politycznego XVIII wieku, dzieł poetyckich, życzeń, powinszowań okazjonalnych, a także twórczości własnej nieznanego zakonnika norbertańskiego – twórcy i właściciela sylwy.

  9. Powder Metallurgy of Uranium Alloy Fuels for TRU-Burning Reactors Final Technical Report

    International Nuclear Information System (INIS)

    McDeavitt, Sean M.

    2011-01-01

    beginning of the materials processing setup. Also included within this section is a thesis proposal by Jeff Hausaman. Appendix C contains the public papers and presentations introduced at the 2010 American Nuclear Society Winter Meeting. Appendix A - MSNE theses of David Garnetti and Grant Helmreich and proposal by Jeff Hausaman A.1 December 2009 Thesis by David Garnetti entitled 'Uranium Powder Production Via Hydride Formation and Alpha Phase Sintering of Uranium and Uranium-Zirconium Alloys for Advanced Nuclear Fuel Applications' A.2 September 2009 Presentation by David Garnetti (same title as document in Appendix B.1) A.3 December 2010 Thesis by Grant Helmreich entitled 'Characterization of Alpha-Phase Sintering of Uranium and Uranium-Zirconium Alloys for Advanced Nuclear Fuel Applications' A.4 October 2010 Presentation by Grant Helmreich (same title as document in Appendix B.3) A.5 Thesis Proposal by Jeffrey Hausaman entitled 'Hot Extrusion of Alpha Phase Uranium-Zirconium Alloys for TRU Burning Fast Reactors' Appendix B - External presentations introduced at the 2010 ANS Winter Meeting B.1 J.S. Hausaman, D.J. Garnetti, and S.M. McDeavitt, 'Powder Metallurgy of Alpha Phase Uranium Alloys for TRU Burning Fast Reactors,' Proceedings of 2010 ANS Winter Meeting, Las Vegas, Nevada, USA, November 7-10, 2010 B.2 PowerPoint Presentation Slides from C.1 B.3 G.W. Helmreich, W.J. Sames, D.J. Garnetti, and S.M. McDeavitt, 'Uranium Powder Production Using a Hydride-Dehydride Process,' Proceedings of 2010 ANS Winter Meeting, Las Vegas, Nevada, USA, November 7-10, 2010 B.4. PowerPoint Presentation Slides from C.3 B.5 Poster Presentation from C.3 Appendix C - Fuel cycle research and development undergraduate materials and poster presentation C.1 Poster entitled 'Characterization of Alpha-Phase Sintering of Uranium and Uranium-Zirconium Alloys' presented at the Fuel Cycle Technologies Program Annual Meeting C.2 April 2011 Honors Undergraduate Thesis by William Sames, Research Fellow

  10. Chemical Abundance Analysis of Moving Group W11450 (Latham 1)

    Science.gov (United States)

    O'Connell, Julia E.; Martens, Kylee; Frinchaboy, Peter M.

    2016-12-01

    We present elemental abundances for all seven stars in Moving Group W11450 (Latham 1) to determine if they may be chemically related. These stars appear to be both spatially and kinematically related, but no spectroscopic abundance analysis exists in literature. Abundances for eight elements were derived via equivalent width analyses of high-resolution (R ˜ 60,000), high-signal-to-noise ratio ( ˜ 100) spectra obtained with the Otto Struve 2.1 m telescope and the Sandiford Echelle Spectrograph at McDonald Observatory. The large star-to-star scatter in metallicity, -0.55 ≤ [Fe/H] ≤slant 0.06 dex (σ = 0.25), implies these stars were not produced from the same chemically homogeneous molecular cloud, and are therefore not part of a remnant or open cluster as previously proposed. Prior to this analysis, it was suggested that two stars in the group, W11449 and W11450, are possible wide binaries. The candidate wide binary pair show similar chemical abundance patterns with not only iron but with other elements analyzed in this study, suggesting the proposed connection between these two stars may be real.

  11. Research reactors in Argentina

    International Nuclear Information System (INIS)

    Carlos Ruben Calabrese

    1999-01-01

    Argentine Nuclear Development started in early fifties. In 1957, it was decided to built the first a research reactor. RA-1 reactor (120 kw, today licensed to work at 40 kW) started operation in January 1958. Originally RA-1 was an Argonaut (American design) reactor. In early sixties, the RA-1 core was changed. Fuel rods (20% enrichment) was introduced instead the old Argonaut core design. For that reason, a critical facility named RA-0 was built. After that, the RA-3 project started, to build a multipurpose 5 MW nuclear reactor MTR pool type, to produce radioisotopes and research. For that reason and to define the characteristics of the RA-3 core, another critical facility was built, RA-2. Initially RA-3 was a 90 % enriched fuel reactor, and started operation in 1967. When Atucha I NPP project started, a German design Power Reactor, a small homogeneous reactor was donated by the German Government to Argentina (1969). This was RA-4 reactor (20% enrichment, 1W). In 1982, RA-6 pool reactor achieved criticality. This is a 500 kW reactor with 90% enriched MTR fuel elements. In 1990, RA-3 started to operate fueled by 20% enriched fuel. In 1997, the RA-8 (multipurpose critical facility located at Pilcaniyeu) started to operate. RA-3 reactor is the most important CNEA reactor for Argentine Research Reactors development. It is the first in a succession of Argentine MTR reactors built by CNEA (and INVAP SE ) in Argentina and other countries: RA-6 (500 kW, Bariloche-Argentina), RP-10 (10MW, Peru), NUR (500 kW, Algeria), MPR (22 MW, Egypt). The experience of Argentinian industry permits to compete with foreign developed countries as supplier of research reactors. Today, CNEA has six research reactors whose activities have a range from education and promotion of nuclear activity, to radioisotope production. For more than forty years, Argentine Research Reactors are working. The experience of Argentine is important, and argentine firms are able to compete in the design and

  12. Theoretical study for ICRF sustained LHD type p-{sup 11}B reactor

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Tsuguhiro (ed.)

    2003-04-01

    This is a summary of the workshop on 'Theoretical Study for ICRF Sustained LHD Type p-{sup 11}B Reactor' held in National Institute for Fusion Science (NIFS) on July 25, 2002. In the workshop, study of LHD type D-{sup 3}He reactor is also reported. A review concerning the advanced nuclear fusion fuels is also attached. This review was reported at the workshop of last year. The development of the p-{sup 11}B reactor research which uses the LHD magnetic field configuration has been briefly summarized in section 1. In section 2, an integrated report on advanced nuclear fusion fuels is given. Ignition conditions in a D-{sup 3}He helical reactor are summarized in section 3. 0-dimensional particle and power balance equations are solved numerically assuming the ISS95 confinement law including a confinement factor ({gamma}{sub HH}). It is shown that high average beta plasma confinement, a large confinement factor ({gamma}{sub HH} > 3) and the hot ion mode (T{sub i}/T{sub e} > 1.4) are necessary to achieve the ignition of the D-{sup 3}He helical reactor. Characteristics of ICRF sustained p-{sup 11}B reactor are analyzed in section 4. The nuclear fusion reaction rate < {sigma}{upsilon} > is derived assuming a quasilinear plateau distribution function (QPDF) for protons, and an ignition condition of p-{sup 11}B reactor is shown to be possible. The 3 of the presented papers are indexed individually. (J.P.N.)

  13. Microstructural evolution of HFIR-irradiated low activation F82H and F82H-10B steels

    International Nuclear Information System (INIS)

    Wakai, E.; Shiba, K.; Sawai, T.; Hashimoto, N.; Robertson, J.P.; Klueh, R.L.

    1998-01-01

    Microstructures of reduced-activation F82H (8Cr-2W-0.2V-0.04Ta) and the F82H steels doped with 10 B, irradiated at 250 and 300 C to 3 and 57 dpa in the High Flux Isotope Reactor (HFIR), were examined by TEM. In the F82H irradiated at 250 C to 3 dpa, dislocation loops, small unidentified defect clusters with a high number density, and a few MC precipitates were observed in the matrix. The defect microstructure after 300 C irradiation to 57 dpa is dominated by the loops, and the number density of loops was lower than that of the F82H- 10 B steel. Cavities were observed in the F82H- 10 B steels, but the swelling value is insignificant. Small particles of M 6 C formed on the M 23 C 6 carbides that were present in both steels before the irradiation at 300 C to 57 dpa. A low number density of MC precipitate particles formed in the matrix during irradiation at 300 C to 57 dpa

  14. Benchmarking the new JENDL-4.0 library on criticality experiments of a research reactor with oxide LEU (20 w/o) fuel, light water moderator and beryllium reflectors

    International Nuclear Information System (INIS)

    Liem, Peng Hong; Sembiring, Tagor Malem

    2012-01-01

    Highlights: ► Benchmark calculations of the new JENDL-4.0 library. ► Thermal research reactor with oxide LEU fuel, H 2 O moderator and Be reflector. ► JENDL-4.0 library shows better C/E values for criticality evaluations. - Abstract: Benchmark calculations of the new JENDL-4.0 library on the criticality experiments of a thermal research reactor with oxide low enriched uranium (LEU, 20 w/o) fuel, light water moderator and beryllium reflector (RSG GAS) have been conducted using a continuous energy Monte Carlo code, MVP-II. The JENDL-4.0 library shows better C/E values compared to the former library JENDL-3.3 and other world-widely used latest libraries (ENDF/B-VII.0 and JEFF-3.1).

  15. Final Environmental Assessment: Solar Panel Systems at Joint Base McGuire-Dix-Lakehurst New Jersey

    Science.gov (United States)

    2012-03-01

    would be within 1,000 feet of Site B along this road include Dunkin Donuts , Dollar General, and Thunderbird Bowling Lanes. Site C is located along...that would be within 1,000 feet of the solar farm along this road include Dunkin Donuts , Dollar General, and Thunderbird Bowling Lanes. However, these...Plan CO Carbon monoxide CO2 Carbon dioxide CRM Cultural Resources Manager DoD Department of Defense DRMO Defense Reutilization and Marketing

  16. Discovery and Rossiter-McLauglin effect of exoplanet kepler-8b

    DEFF Research Database (Denmark)

    Jenkins...[], Jon M.; Borucki, W.J.; Koch, D. G.

    2010-01-01

    We report on the discovery and the Rossiter-McLaughlin (R-M) effect of Kepler-8b, a transiting planet identified by the NASA Kepler Mission. Kepler photometry and Keck-HIRES radial velocities yield the radius and mass of the planet around this F8IV subgiant host star. The planet has a radius R P...

  17. Analysis and testing of W-DHR system for decay heat removal in the lead-cooled ELSY reactor

    International Nuclear Information System (INIS)

    Bandini, Giacomino; Meloni, Paride; Polidori, Massimiliano; Gaggini, Piero; Labanti, Valerio; Tarantino, Mariano; Cinotti, Luciano; Presciuttini, Leonardo

    2009-01-01

    An innovative LFR system that complies with GEN IV goals is under design in the frame of ELSY European project. ELSY is a lead-cooled pool-type reactor of about 1500 MW thermal power which normally relies on the secondary system for decay heat removal. Since the secondary system is not safety-grade and must be fully depressurized in case of detection of a steam generator tube rupture, an independent and much reliable decay heat removal (DHR) system is foreseen on the primary side. Owing to the limited capability of the Reactor Vessel Air Cooling System (RVACS) in this large power reactor, additional safety-grade loops equipped with coolers immersed in the primary coolant are necessary for an efficient removal of decay heat. Some of these loops (W-DHR) are of innovative design and may operate with water at atmospheric pressure. In the frame of the ICE program to be performed on the integral facility CIRCE at ENEA/Brasimone research centre within the EUROTRANS European project, integral circulation experiments with core heat transport and heat removal by steam generator will be conducted in a reactor pool-type configuration. Taking advantage from this experimental program, a mock-up of W-DHR heat exchanger will be tested in order to investigate its functional behavior for decay heat removal. Some pre-test calculations of W-DHR heat exchanger operation in CIRCE have been performed with the RELAP5 thermal-hydraulic code in order to support the heat exchanger design and test conduct. In this paper the experimental activity to be conducted in CIRCE and main results from W-DHR pre-test calculations are presented, along with a preliminary investigation of the W-DHR system efficiency in ELSY configuration. (author)

  18. GPU v. B and W lawsuit review and its effect on TMI-1 (Docket 50-289). Volume 2. Appendices

    International Nuclear Information System (INIS)

    1983-09-01

    Volume II of the GPU v. B and W lawsuit review contains four appendices supporting the review of the GPU v. B and W lawsuit discussed in Volume I of this report. As outlined in the Background section of Volume I under (3) Review Method Utilized by the Staff, the GPU v. B and W lawsuit review was partitioned into 10 categories. The 154 certification items and the 19 long-term actions (hearing items or restart issues) resulting from Commission Orders and the hearing process were each placed in one or more of the 10 categories. These appendices contain the hearing items by category; lawsuit record by category; category location matrix for lawsuit record; and uncategorized lawsuit record

  19. New developments in the McStas neutron instrument simulation package

    International Nuclear Information System (INIS)

    Willendrup, P K; Knudsen, E B; Klinkby, E; Nielsen, T; Farhi, E; Filges, U; Lefmann, K

    2014-01-01

    The McStas neutron ray-tracing software package is a versatile tool for building accurate simulators of neutron scattering instruments at reactors, short- and long-pulsed spallation sources such as the European Spallation Source. McStas is extensively used for design and optimization of instruments, virtual experiments, data analysis and user training. McStas was founded as a scientific, open-source collaborative code in 1997. This contribution presents the project at its current state and gives an overview of the main new developments in McStas 2.0 (December 2012) and McStas 2.1 (expected fall 2013), including many new components, component parameter uniformisation, partial loss of backward compatibility, updated source brilliance descriptions, developments toward new tools and user interfaces, web interfaces and a new method for estimating beam losses and background from neutron optics.

  20. Properties of Waste from Coal Gasification in Entrained Flow Reactors in the Aspect of Their Use in Mining Technology / Właściwości odpadów ze zgazowania węgla w reaktorach dyspersyjnych w aspekcie ich wykorzystania w technologiach górniczych

    Science.gov (United States)

    Pomykała, Radosław

    2013-06-01

    ęgla lub węgla z dodatkami: bitumin (żużel S1), czy biomasy (popiół A2, żużel S2). W polskim górnictwie podziemnym wyróżnić można kilka technologii podsadzkowych, w których do transportu materiału wykorzystywana jest woda. Tradycyjnie oraz ze względów historycznych, terminem "podsadzka hydrauliczna" określa się tę, która spełnia wymagania normy PN-93/G-11010. Do najważniejszych cech takiej podsadzki hydraulicznej zaliczyć należy wypełnienia uprzednio wydzielonej pustki poeksploatacyjnej, materiałem o jak najmniejszej ściśliwości oraz o jak największej wodoprzepuszczalności. Materiał taki, po odprowadzeniu wody ma stanowić mechaniczna podporę stropu, a proces podsadzania jest ściśle powiązany z procesem eksploatacji, jako sposób likwidacji zrobów. Najczęściej stosowanymi materiałami są piasek podsadzkowy oraz odpady górnicze lub hutnicze (Lisowski, 1997). Od ponad dwudziestu lat, w polskim górnictwie węgla kamiennego obecna jest również inna technologia podsadzkowa, w której do transportu materiałów wykorzystywana jest woda. W tym przypadku części stałe to materiały drobnoziarniste, najczęściej popioły różnych typów, które po wymieszaniu z wodą tworzą zawiesinę (stąd termin "zawiesiny popiołowo-wodne"). Polska norma PN-G-11011:1998 wyróżnia dwie odmiany takich zawiesin i definiuje je, jako "podsadzkę zestalaną" oraz "mieszaninę do doszczelniania zrobów". Podstawową ideą przyświecającą stosowaniu zawiesin drobnoziarnistych w technologiach górniczych była początkowo troska o zagospodarowaniu odpadów energetycznych, a następnie górniczych (Mazurkiewicz i in., 1998; Piotrowski i in., 2006; Piotrowski, 2010; Plewa i Mysłek, 2000; Plewa i Sobota, 2002). Obecnie technologia zawiesinowa na stałe zagościła w kopalniach węgla kamiennego stając się m.in. nieodzownym środkiem profilaktyki pożarowej i metanowej (Dziurzyński i Pomykała, 2006; Palarski, 2004; Pomykała, 2006). W artykule

  1. PsB multiprotein complex of Dictyostelium discoideum. Demonstration of cellulose binding activity and order of protein subunit assembly.

    Science.gov (United States)

    McGuire, V; Alexander, S

    1996-06-14

    The differentiated spores of Dictyostelium are surrounded by an extracellular matrix, the spore coat, which protects them from environmental factors allowing them to remain viable for extended periods of time. This presumably is a major evolutionary advantage. This unique extracellular matrix is composed of cellulose and glycoproteins. Previous work has shown that some of these spore coat glycoproteins exist as a preassembled multiprotein complex (the PsB multiprotein complex) which is stored in the prespore vesicles (Watson, N., McGuire, V., and Alexander, S (1994) J. Cell Sci. 107, 2567-2579). Later in development, the complex is synchronously secreted from the prespore vesicles and incorporated into the spore coat. We now have shown that the PsB complex has a specific in vitro cellulose binding activity. The analysis of mutants lacking individual subunits of the PsB complex revealed the relative order of assembly of the subunit proteins and demonstrated that the protein subunits must be assembled for cellulose binding activity. These results provide a biochemical explanation for the localization of this multiprotein complex in the spore coat.

  2. Installation Restoration Program (IRP) Stage 3, Operable Unit B engineering Evaluation/Cost Analysis - Environmental Assessment for McClellan AFB/EM, McClellan AFB, California

    Science.gov (United States)

    1990-12-01

    U U U � o 0. .. . .. .. . ..0 C f 88 11 g 88 2= c c= 61 =" l w oA ID - f mW CD 0 x P.- I- W x- hi 8I fmd /06ETLO/V’dI V0 0 a 1 -,, C 22 2t ? i2...aa a a I I I 1 a a a a U a fta a a a a a a a a a a a a a * a a a a a a a a a * a a a I a a a a ft a a a I * a a a a * a aa I* a I a a a ac~ a a a ft a...Ba J.Ja ’-ft a -. aB I a a fta a Oa a ~ afla ft a 0-aQa a ft * * a * ~ d aa OaeO B a* - a a SIa I ft a a ma a £ a a ~a 3 -di I a a saga a ft a a ~SJI

  3. Environmental Impact Statement for BOMARC Missile Site, McGuire AFB, New Jersey. Volume 2. Public Hearings, Comments, and Consultation Letters. Appendices 2-1 through 2-6

    Science.gov (United States)

    1992-05-22

    rolesies00SO0A5C Cite must be cleaned up end thot there is no advent... to Omet period for on oddtimi 30 days. so are sot able gose n ontb goe.o lgeeeor...Hargrove, Chief Incirommmental Impacts Srench KC11 W tclsr one Sharon m.i1 XEMAC/LEfV Scott Air Force ess Illinois 6322I beer Ne. Sells mhe Snvlro.51fta

  4. GCMS/MS Analyses of Biological Samples in Support of Evaluation of Toxicity Associated with Intravenous Exposure to VX Stereoisomers in Guinea Pigs

    Science.gov (United States)

    2017-07-01

    ASSOCIATED WITH INTRAVENOUS EXPOSURE TO VX STEREOISOMERS IN GUINEA PIGS ECBC-TR-1465 Disclaimer The findings in this report are not to be...VX Stereoisomers in Guinea Pigs 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) McGuire, Jeffrey M.; Wright...lung, liver, kidney, and brain) that were obtained from guinea pigs intravenously exposed to various concentrations of O-ethyl S-(2

  5. The MC160 Protein Expressed by the Dermatotropic Poxvirus Molluscum Contagiosum Virus Prevents Tumor Necrosis Factor Alpha-Induced NF-κB Activation via Inhibition of I Kappa Kinase Complex Formation

    Science.gov (United States)

    Nichols, Daniel Brian; Shisler, Joanna L.

    2006-01-01

    The pluripotent cytokine tumor necrosis factor alpha (TNF-α) binds to its cognate TNF receptor I (TNF-RI) to stimulate inflammation via activation of the NF-κB transcription factor. To prevent the detrimental effects of TNF-α in keratinocytes infected with the molluscum contagiosum virus (MCV), this poxvirus is expected to produce proteins that block at least one step of the TNF-RI signal transduction pathway. One such product, the MC160 protein, is predicted to interfere with this cellular response because of its homology to other proteins that regulate TNF-RI-mediated signaling. We report here that expression of MC160 molecules did significantly reduce TNF-α-mediated NF-κB activation in 293T cells, as measured by gene reporter and gel mobility shift assays. Since we observed that MC160 decreased other NF-κB activation pathways, namely those activated by receptor-interacting protein, TNF receptor-associated factor 2, NF-κB-inducing kinase, or MyD88, we hypothesized that the MC160 product interfered with I kappa kinase (IKK) activation, an event common to multiple signal transduction pathways. Indeed, MC160 protein expression was associated with a reduction in in vitro IKK kinase activity and IKK subunit phosphorylation. Further, IKK1-IKK2 interactions were not detected in MC160-expressing cells, under conditions demonstrated to induce IKK complex formation, but interactions between the MC160 protein and the major IKK subunits were undetectable. Surprisingly, MC160 expression correlated with a decrease in IKK1, but not IKK2 levels, suggesting a mechanism for MC160 disruption of IKK1-IKK2 interactions. MCV has probably retained its MC160 gene to inhibit NF-κB activation by interfering with signaling via multiple biological mediators. In the context of an MCV infection in vivo, MC160 protein expression may dampen the cellular production of proinflammatory molecules and enhance persistent infections in host keratinocytes. PMID:16378960

  6. Peculiarities of structure state and mechanical characteristics in ion-plasma condensates of quasibinary system borides W2B5-TiB2

    Directory of Open Access Journals (Sweden)

    Sobol O.V.

    2006-01-01

    Full Text Available In order to create high-durable, wear-resistant materials for a wide range of functional applications, comparative investigations of the structure and mechanical characteristics of ion-plasma Ti-W-B nano-crystalline condensates were carried out. The range of condensation rates 0.11÷0.25nm/s was found to be critical for the coatings obtained from the target with 80 vol% W2B5-20 vol% TiB2. Below this, a phase with a cubic lattice (W,TiB0.7…1.2(O,N,C0.3…0.2 formed, while over this range, a solid solution (W,TiB2 with a hexagonal lattice and element composition close to the sputtered target was observed. The structure state of the material changed from cluster-crystalline (under low sputter potentials U=0.6…1.0 kV to textured- crystalline (under U>2.2 kV. Structure perfection improvement with U increase results in higher hardness and elastic modulus of condensates. The conditions of cluster component formation and its effect on hardness and elastic modulus of condensates are discussed. .

  7. Cleanup Verification Package for the 118-B-1, 105-B Solid Waste Burial Ground

    International Nuclear Information System (INIS)

    Capron, J.M.

    2008-01-01

    This cleanup verification package documents completion of remedial action, sampling activities, and compliance criteria for the 118-B-1, 105-B Solid Waste Burial Ground. This waste site was the primary burial ground for general wastes from the operation of the 105-B Reactor and P-10 Tritium Separation Project and also received waste from the 105-N Reactor. The burial ground received reactor hardware, process piping and tubing, fuel spacers, glassware, electrical components, tritium process wastes, soft wastes and other miscellaneous debris

  8. Mass of the b quark and B -meson decay constants from Nf=2+1+1 twisted-mass lattice QCD

    DEFF Research Database (Denmark)

    Bussone, A.; Carrasco, N.; Dimopoulos, P

    2016-01-01

    We present precise lattice computations for the b-quark mass, the quark mass ratios mb/mc and mb/ms as well as the leptonic B-decay constants. We employ gauge configurations with four dynamical quark flavors, up-down, strange and charm, at three values of the lattice spacing (a∼0.06-0.09 fm......) and for pion masses as low as 210 MeV. Interpolation in the heavy quark mass to the bottom quark point is performed using ratios of physical quantities computed at nearby quark masses exploiting the fact that these ratios are exactly known in the static quark mass limit. Our results are also extrapolated...... to the physical pion mass and to the continuum limit and read mb(MS,mb)=4.26(10) GeV, mb/mc=4.42(8), mb/ms=51.4(1.4), fBs=229(5) MeV, fB=193(6) MeV, fBs/fB=1.184(25) and (fBs/fB)/(fK/fπ)=0.997(17)....

  9. Zastosowanie pola magnetycznego oraz promieniowania optycznego w leczeniu zespołów bólowych kręgosłupa, w szczególności rwy kulszowej

    Directory of Open Access Journals (Sweden)

    Jarosław Pasek

    2012-04-01

    Full Text Available Wstęp: Rwa kulszowa, ischialgia (łac. ischias to zespół objawów związanych z uciskiem na przebiegu nerwów rdzeniowych L4, L5 lub S1 tworzących nerw kulszowy. Wiedza na temat leczenia zmienia się radykalnie i coraz częściej w leczeniu stosuje się wybrane metody fizykoterapeutyczne. W ostatnich latach ukazuje się coraz więcej publikacji dotyczących praktycznego wykorzystania w medycynie pól magnetycznych niskiej częstotliwości. Duża różnorodność wskazań oraz zastosowań w praktyce przynosi szerokie spektrum możliwości leczniczych. Materiał i metoda: Badaniami objęto grupę 47 pacjentów z rozpoznaniem rwy kulszowej spowodowanej zmianami zwyrodnieniowymi krążka międzykręgowego. Pacjentów podzielono na 3 grupy badawcze i poddano odpowiednio zabiegom magnetoterapii, magnetostymulacji i magnetoledoterapii w celu porównania przeprowadzonej terapii. Dokonano subiektywnej oceny odczuwanych dolegliwości bólowych w skali VAS. Dodatkowo posłużono się ankietą, w której oceniono częstość zażywania leków przeciwbólowych. Do oceny jakości życia wykorzystano skalę EuroQol. U każdego pacjenta podczas badania fizykalnego wykonano test Lasègue’a. Wyniki: Wykazano statystyczne zmniejszenie nasilenia odczuwanych dolegliwości bólowych w skali VAS badanych pacjentów (p<0,01, znaczną redukcję zażywanych leków przeciwbólowych oraz poprawę jako- ści życia ocenianej w skali EuroQol (p<0,01 po zastosowaniu zabiegów pola magnetycznego niskiej częstotliwości. Wnioski: Terapia polem magnetycznym bez względu na zastosowaną metodę zmniejsza odczuwane dolegliwości bólowe, co wpływa na poprawę jakości życia leczonych chorych. Zastosowana terapia przyczynia się również do ograniczenia przyjmowania leków przeciwbólowych. W badaniu nie stwierdzono znaczącej przewagi którejś z analizowanych metod w odniesieniu do otrzymanych wyników leczenia.

  10. Probiotyki i prebiotyki w profilaktyce i leczeniu chorób u dzieci

    Directory of Open Access Journals (Sweden)

    Leokadia Bąk-Romaniszyn

    2010-11-01

    Full Text Available Probiotyki to mikroorganizmy, które wywierają korzystne działanie na organizm gospodarza po spożyciu przez niego odpowiedniej dawki określonego szczepu. Najczęściej jako probiotyki stosowane są bakterie kwasu mlekowego Lactobacillus i Bifidobacterium oraz wybrane szczepy Streptococcus, Bacillus, a także drożdże Saccharomyces boulardii. Probiotyki wpływają korzystnie na skład środowiska ekologicznego przewodu pokarmowego, wykazując antagonizm w stosunku do drobnoustrojów chorobotwórczych kolonizujących błonę śluzową przewodu pokarmowego. Obecność w jelicie bakterii fermentacyjnych, głównie pałeczek kwasu mlekowego, a zwłaszcza typów adhezyjnych, chroni przed dyslokacją bakteryjną i enterotoksemią, normalizuje zaburzenia motoryki jelit i zmniejsza objawy nietolerancji laktozy. Prebiotyki to substancje naturalnie zawarte w żywności (bądź do niej dodawane, które selektywnie pobudzają wzrost i/lub aktywność wybranych szczepów bakterii probiotycznych obecnych w przewodzie pokarmowym. Probiotyki i prebiotyki, jak również ich połączenie – synbiotyki, występują w pożywieniu, mieszankach mlecznych, preparatach farmakologicznych, dodatkach do żywności, suplementach dietetycznych i w sposób naturalny poprawiają stan naszego zdrowia oraz mają coraz większe znaczenie w nowoczesnej medycynie. W pracy omówiono udział probiotyków i prebiotyków w kształtowaniu się biocenozy przewodu pokarmowego oraz w profilaktyce i leczeniu wybranych chorób u dzieci, jak: biegunki bakteryjne i wirusowe, dysbioza poantybiotykowa, martwica jelit noworodków, kolka jelitowa, nieswoiste zapalenia jelit, zaburzenia czynnościowe przewodu pokarmowego.

  11. McStas 1.1. A freeware package for neutron Monte Carlo ray-tracing simulations

    International Nuclear Information System (INIS)

    Lefmann, K.; Nielsen, K.

    1999-01-01

    Neutron simulation is becoming an indispensable tool for neutron instrument design. At Risoe National Laboratory, a user-friendly, versatile, and fast simulation package, McStas has been developed, which may be freely downloaded from our website. An instrument is described in the McStas meta-language and is composed of elements from the McStas component library, which is under constant development and debugging by both the users and us. The McStas front- and back-ends take care of performing the simulations and displaying their results, respectively. McStas 1.1 facilities detailed simulations of complicated triple-axis instruments like the Riso RITA spectrometer, and it is equally well equipped for time-of flight spectrometers. At ECNS'99, a brief tutorial of McStas including a few on-line demonstrations is presented. Further, results from the latest simulation work in the growing McStas user group are presented and the future of this project is discussed. (author)

  12. TRIGLAV-W a Windows computer program package with graphical users interface for TRIGA reactor core management calculations

    International Nuclear Information System (INIS)

    Zagar, T.; Zefran, B.; Slavic, S.; Snoj, L.; Ravnik, M.

    2006-01-01

    TRIGLAV-W is a program package for reactor calculations of TRIGA Mark II research reactor cores. This program package runs under Microsoft Windows operating system and has new friendly graphical user interface (GUI). The main part of the package is the TRIGLAV code based on two dimensional diffusion approximation for flux distribution calculation. The new GUI helps the user to prepare the input files, runs the main code and displays the output files. TRIGLAV-W has a user friendly GUI also for the visualisation of the calculation results. Calculation results can be visualised using 2D and 3D coloured graphs for easy presentations and analysis. In the paper the many options of the new GUI are presented along with the results of extensive testing of the program. The results of the TRIGLAV-W program package were compared with the results of WIMS-D and MCNP code for calculations of TRIGA benchmark. TRIGLAV-W program was also tested using several libraries developed under IAEA WIMS-D Library Update Project. Additional literature and application form for TRIGLAV-W program package beta testing can be found at http://www.rcp.ijs.si/triglav/. (author)

  13. Sex-specific allelic transmission bias suggests sexual conflict at MC1R.

    Science.gov (United States)

    Ducret, Valérie; Gaigher, Arnaud; Simon, Céline; Goudet, Jérôme; Roulin, Alexandre

    2016-09-01

    Sexual conflict arises when selection in one sex causes the displacement of the other sex from its phenotypic optimum, leading to an inevitable tension within the genome - called intralocus sexual conflict. Although the autosomal melanocortin-1-receptor gene (MC1R) can generate colour variation in sexually dichromatic species, most previous studies have not considered the possibility that MC1R may be subject to sexual conflict. In the barn owl (Tyto alba), the allele MC1RWHITE is associated with whitish plumage coloration, typical of males, and the allele MC1RRUFOUS is associated with dark rufous coloration, typical of females, although each sex can express any phenotype. Because each colour variant is adapted to specific environmental conditions, the allele MC1RWHITE may be more strongly selected in males and the allele MC1RRUFOUS in females. We therefore investigated whether MC1R genotypes are in excess or deficit in male and female fledglings compared with the expected Hardy-Weinberg proportions. Our results show an overall deficit of 7.5% in the proportion of heterozygotes in males and of 12.9% in females. In males, interannual variation in assortative pairing with respect to MC1R explained the year-specific deviations from Hardy-Weinberg proportions, whereas in females, the deficit was better explained by the interannual variation in the probability of inheriting the MC1RWHITE or MC1RRUFOUS allele. Additionally, we observed that sons inherit the MC1RRUFOUS allele from their fathers on average slightly less often than expected under the first Mendelian law. Transmission ratio distortion may be adaptive in this sexually dichromatic species if males and females are, respectively, selected to display white and rufous plumages. © 2016 John Wiley & Sons Ltd.

  14. Instrumentation renewal at the FIR 1 research reactor in Finland

    International Nuclear Information System (INIS)

    Bars, Bruno; Kall, Leif

    1982-01-01

    The Finnish TRIGA Mark II reactor (FIR 1 100 kW, later 250 kW steady state power and pulsing capability up to 250 MW) has been in operation for 20 years. The reactor is the only research reactor in Finland and is an important research training and service facility, which obviously will be operated for 10...20 years ahead. The mechanical parts of the reactor are in good shape. Some minor modifications have previously been made in the instrumentation. However, the original instrumentation could hardly have been used for 10...20 years ahead without extensive modifications and modernization. After a careful evaluation and planning process the whole reactor instrumentation was renewed in 1981 at a cost of about 400 000 dollar. The renewal was carried out in cooperation with the Central Research Institute for Physics (KFKI) at the Hungarian Academy of Sciences, which delivered the nuclear part of the instrumentation and with the Finnish company Valmet Oy Instrument Works, which delivered the conventional instrumentation, including the automatic power control system and the control console. The instrumentation, which is located in-a new isolated control room is based on modern industrial standard modular units with standardized signal ranges, electronic testing possibilities, galvanically isolated outputs etc. The instrument renewal project was brought successfully to completion in November 1981 after only about 10 working days of shut down time. The reactor is now in routine operation and the experiences gained from the new instrumentation are excellent. (author)

  15. Cost-constrained design point for the Reversed-Field Pinch Reactor (RFPR)

    International Nuclear Information System (INIS)

    Hagenson, R.L.; Krakowski, R.A.

    1978-01-01

    A broad spectrum of Reversed-Field Pinch Reactor (RFPR) operating modes are compared on an economics basis. An RFPR with superconducting coils and an air-core poloidal field transformer optimizes to give a minimum cost system when compared to normal-conducting coils and the iron-core transformer used in earlier designs. An interim design is described that exhibits a thermally stable, unrefueled, 21 s burn (burnup 50 percent) with an energy containment time equal to 200 times the Bohm time, which is consistent with present-day tokamak experiments. This design operates near the minimum energy state (THETA = B/sub THETA/(r/sub w/)/[B/sub z/] = 2.0 and F = B/sub z/(r/sub w/)/[B/sub z/] = 1.0 from the High Beta Model) of the RFP configuration. This cost-optimized design produces a reactor of 1.5-m minor radius and 12.8-m major radius, that generates 1000 MWe (net) with a recirculating power fraction of 0.15 at a direct capital cost of 970 $/kWe

  16. Neutron noise measurement technique in a coupled reactor

    International Nuclear Information System (INIS)

    Genoud, J.P.

    1976-01-01

    Describes work carried out on the swimming pool reactor at the Physikalisch-Technische Bundesanstalt at Braunschweig. The reactor has two multiplying zones, is light water moderated, with 90% enriched 235 U fuel. There is a D 2 0 reservoir between the two parts of the reactor. Signal/noise ratio obtained by means of ionisation chamber type neutron detectors of 10 -13 amp/u.f. sensitivity is of the order of 40 dB and band frequency 1.5 kHz. Spectral density of the interzone interaction energy was obtained by use of Fourier transforms, previously corrected by a Hanning window. (S.W.)

  17. Thermal hydraulic analysis of the IPR-R1 TRIGA research reactor using a RELAP5 model

    International Nuclear Information System (INIS)

    Costa, Antonella L.; Reis, Patricia Amelia L.; Pereira, Claubia; Veloso, Maria Auxiliadora F.; Mesquita, Amir Z.; Soares, Humberto V.

    2010-01-01

    The RELAP5 code is widely used for thermal hydraulic studies of commercial nuclear power plants. Current investigations and code adaptations have demonstrated that the RELAP5 code can be also applied for thermal hydraulic analysis of nuclear research reactors with good predictions. Therefore, as a contribution to the assessment of RELAP5/MOD3.3 for research reactors analysis, this work presents steady-state and transient calculation results performed using a RELAP5 model to simulate the IPR-R1 TRIGA research reactor at 50 kilowatts (kW) of power operation. The reactor is located in the Nuclear Technology Development Center (CDTN), Brazil. It is a 250 kW, light water moderated and cooled, graphite-reflected, open pool type research reactor. The development and the assessment of a RELAP5 model for the IPR-R1 TRIGA are presented. Experimental data were considered in the process of the RELAP5 model validation. The RELAP5 results were also compared with calculated data from the STHIRP-1 (Research Reactors Thermal Hydraulic Simulation) code. The results obtained have shown that the RELAP5 model for the IPR-R1 TRIGA reproduces the actual steady-state reactor behavior in good agreement with the available data.

  18. Aldose reductase inhibitors from the leaves of Myrciaria dubia (H. B. & K.) McVaugh.

    Science.gov (United States)

    Ueda, H; Kuroiwa, E; Tachibana, Y; Kawanishi, K; Ayala, F; Moriyasu, M

    2004-11-01

    Ellagic acid (1) and its two derivatives, 4-O-methylellagic acid (2) and 4-(alpha-rhamnopyranosyl)ellagic acid (3) were isolated as inhibitors of aldose reductase (AR) from Myrciaria dubia (H. B. & K.) McVaugh. Compound 2 was the first isolated from the nature. Compound 3 showed the strongest inhibition against human recombinant AR (HRAR) and rat lens AR (RLAR). Inhibitory activity of compound 3 against HRAR (IC50 value = 4.1 x 10(-8) M) was 60 times more than that of quercetin (2.5 x 10(-6) M). The type of inhibition against HRAR was uncompetitive.

  19. IPR-R1 TRIGA research reactor decommissioning plan

    International Nuclear Information System (INIS)

    Andrade Grossi, Pablo; Oliveira de Tello, Cledola Cassia; Mesquita, Amir Zacarias

    2008-01-01

    The International Atomic Energy Agency (IAEA) is concerning to establish or adopt standards of safety for the protection of health, life and property in the development and application of nuclear energy for peaceful purposes. In this way the IAEA recommends that decommissioning planning should be part of all radioactive installation licensing process. There are over 200 research reactors that have either not operated for a considerable period of time and may never return to operation or, are close to permanent shutdown. Many countries do not have a decommissioning policy, and like Brazil not all installations have their decommissioning plan as part of the licensing documentation. Brazil is signatory of Joint Convention on the safety of spent fuel management and on the safety of radioactive waste management, but until now there is no decommissioning policy, and specifically for research reactor there is no decommissioning guidelines in the standards. The Nuclear Technology Development Centre (CDTN/CNEN) has a TRIGA Mark I Research Reactor IPR-R1 in operation for 47 years with 3.6% average fuel burn-up. The original power was 100 k W and it is being licensed for 250 k W, and it needs the decommissioning plan as part of the licensing requirements. In the paper it is presented the basis of decommissioning plan, an overview and the end state / final goal of decommissioning activities for the IPR-R1, and the Brazilian ongoing activities about this subject. (author)

  20. Computational analysis of neutronic parameters for TRIGA Mark-II research reactor using evaluated nuclear data libraries ENDF/B-VII.0 and JENDL-3.3

    International Nuclear Information System (INIS)

    Altaf, M.H.; Badrun, N.H.; Chowdhury, M.T.

    2015-01-01

    Highlights: • SRAC-PIJ code and SRAC-CITATION have been utilized to model the core. • Most of the simulated results show no significant differences with references. • Thermal peak flux varies a bit due to up condition of TRIGA. • ENDF/B-VII.0 and JENDL-3.3 libraries perform well for neutronics analysis of TRIGA. - Abstract: Important kinetic parameters such as effective multiplication factor, k eff , excess reactivity, neutron flux and power distribution, and power peaking factors of TRIGA Mark II research reactor in Bangladesh have been calculated using the comprehensive neutronics calculation code system SRAC 2006 with the evaluated nuclear data libraries ENDF/B-VII.0 and JENDL-3.3. In the code system, PIJ code was employed to obtain cross section of the core cells, followed by the integral calculation of neutronic parameters of the reactor conducted by CITATION code. All the analyses were performed using the 7-group macroscopic cross section library. Results were compared to the experimental data, the safety analysis report (SAR) of the reactor provided by General Atomic as well as to the simulated values by numerically benchmarked MCNP4C, WIMS-CITATION and SRAC-CITATION codes. The maximum power densities at the hot spot were found to be 169.7 W/cc and 170.1 W/cc for data libraries ENDF/B-VII.0 and JENDL-3.3, respectively. Similarly, the total peaking factors based on ENDF/B-VII.0 and JENDL-3.3 were calculated as 5.68 and 5.70, respectively, which were compared to the original SAR value of 5.63, as well as to MCNP4C, WIMS-CITATION and SRAC-CITATION results. It was found in most cases that the calculated results demonstrate a good agreement with our experiments and published works. Therefore, this analysis benchmarks the code system and will be helpful to enhance further neutronics and thermal hydraulics study of the reactor

  1. Power transients of Ghana research reactor-1 using PARET/ANL thermal hydraulic code

    International Nuclear Information System (INIS)

    Ampomah-Amoaka, E.; Akaho, E.H.K.; Anim-Sampong, S.; Nyarko, B.J.B.

    2010-01-01

    PARET/ANL(Version 7.3 of 2007) thermal-hydraulic code was used to perform transient analysis of the Ghana Research Reactor-1.The reactivities inserted were 2.1mk and 4mk.The peak power of 5.81kW was obtained for 2.1 mk insertion whereas the peak power for 4mk insertion of reactivity was 92.32kW.These results compare closely with experiments and theoretical studies conducted previously.

  2. Safety assessment of McB-E60 (extract of a Momordica sp.: Subchronic toxicity study in rats

    Directory of Open Access Journals (Sweden)

    Narendra S. Deshmukh

    Full Text Available Momordica charantia plant is consumed as a foodstuff in some south Asian curries while its extract preparations have been traditionally used for lowering blood glucose levels in patients with diabetes mellitus. Nutritional Health Institute Laboratories (NHIL, LLC, Florida informed that it patented a new plant McB, as an interhybrid of three plants of Momordica genus. The objective of the present study was to investigate potential adverse effects, if any, of McB-E60 (extract of a Momordica sp. in rats following subchronic administration. Sprague-Dawley rats (10/sex/group were administered via oral gavage 0 (control, 250, 500 and 1000 mg/kg body weight (bw/day of McB-E60 for 90 days. Additional 28-day recovery groups were maintained at control and high dose levels. No mortality or significant and adverse changes in clinical signs, neurological signs, body weight gain or feed intake were noted. No toxicologically significant changes in hematology, clinical chemistry, urinalysis and organ weights were noted. Gross and microscopic pathology examinations did not reveal treatment-related abnormalities. Any changes noted were incidental and within historical control ranges. Based on the results of this study, the No-Observed-Effect Level (NOEL for McB-E60 (extract of a Momordica sp. was determined as greater than 1000 mg/kg bw/day, the highest dose tested. Keywords: Dietary supplement, Safety, Toxicity

  3. MC1R and the response of melanocytes to ultraviolet radiation

    International Nuclear Information System (INIS)

    Rouzaud, Francois; Kadekaro, Ana Luisa; Abdel-Malek, Zalfa A.; Hearing, Vincent J.

    2005-01-01

    The constitutive color of our skin plays a dramatic role in our photoprotection from solar ultraviolet radiation (UVR) that reaches the Earth and in minimizing DNA damage that gives rise to skin cancer. More than 120 genes have been identified and shown to regulate pigmentation, one of the key genes being melanocortin 1 receptor (MC1R) that encodes the melanocortin 1 receptor (MC1R), a seven-transmembrane G protein-coupled receptor expressed on the surface of melanocytes. Modulation of MC1R function regulates melanin synthesis by melanocytes qualitatively and quantitatively. The MC1R is regulated by the physiological agonists α-melanocyte-stimulating hormone (αMSH) and adrenocorticotropic hormone (ACTH), and antagonist agouti signaling protein (ASP). Activation of the MC1R by binding of an agonist stimulates the synthesis of eumelanin primarily via activation of adenylate cyclase. The significance of cutaneous pigmentation lies in the photoprotective effect of melanin, particularly eumelanin, against sun-induced carcinogenesis. Epidermal melanocytes and keratinocytes respond to UVR by increasing their expression of αMSH and ACTH, which up-regulate the expression of MC1R, and consequently enhance the response of melanocytes to melanocortins. Constitutive skin pigmentation dramatically affects the incidence of skin cancer. The pigmentary phenotype characterized by red hair, fair complexion, inability to tan and tendency to freckle is an independent risk factor for all skin cancers, including melanoma. The MC1R gene is highly polymorphic in human populations, and allelic variation at this locus accounts, to a large extent, for the variation in pigmentary phenotypes and skin phototypes (SPT) in humans. Several allelic variants of the MC1R gene are associated with the red hair and fair skin (RHC) phenotype, and carrying one of these variants is thought to diminish the ability of the epidermis to respond to DNA damage elicited by UVR. The MC1R gene is considered a

  4. MC1R and the response of melanocytes to ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Rouzaud, Francois [Laboratory of Cell Biology, National Cancer Institute, National Institutes of Health, Building 37, Room 2132, Bethesda, MD 20892 (United States); Kadekaro, Ana Luisa [Department of Dermatology, University of Cincinnati, College of Medicine, Cincinnati, OH 45267 (United States); Abdel-Malek, Zalfa A. [Department of Dermatology, University of Cincinnati, College of Medicine, Cincinnati, OH 45267 (United States); Hearing, Vincent J. [Laboratory of Cell Biology, National Cancer Institute, National Institutes of Health, Building 37, Room 2132, Bethesda, MD 20892 (United States)]. E-mail: hearingv@nih.gov

    2005-04-01

    The constitutive color of our skin plays a dramatic role in our photoprotection from solar ultraviolet radiation (UVR) that reaches the Earth and in minimizing DNA damage that gives rise to skin cancer. More than 120 genes have been identified and shown to regulate pigmentation, one of the key genes being melanocortin 1 receptor (MC1R) that encodes the melanocortin 1 receptor (MC1R), a seven-transmembrane G protein-coupled receptor expressed on the surface of melanocytes. Modulation of MC1R function regulates melanin synthesis by melanocytes qualitatively and quantitatively. The MC1R is regulated by the physiological agonists {alpha}-melanocyte-stimulating hormone ({alpha}MSH) and adrenocorticotropic hormone (ACTH), and antagonist agouti signaling protein (ASP). Activation of the MC1R by binding of an agonist stimulates the synthesis of eumelanin primarily via activation of adenylate cyclase. The significance of cutaneous pigmentation lies in the photoprotective effect of melanin, particularly eumelanin, against sun-induced carcinogenesis. Epidermal melanocytes and keratinocytes respond to UVR by increasing their expression of {alpha}MSH and ACTH, which up-regulate the expression of MC1R, and consequently enhance the response of melanocytes to melanocortins. Constitutive skin pigmentation dramatically affects the incidence of skin cancer. The pigmentary phenotype characterized by red hair, fair complexion, inability to tan and tendency to freckle is an independent risk factor for all skin cancers, including melanoma. The MC1R gene is highly polymorphic in human populations, and allelic variation at this locus accounts, to a large extent, for the variation in pigmentary phenotypes and skin phototypes (SPT) in humans. Several allelic variants of the MC1R gene are associated with the red hair and fair skin (RHC) phenotype, and carrying one of these variants is thought to diminish the ability of the epidermis to respond to DNA damage elicited by UVR. The MC1R gene is

  5. Coupling of a 2.5 kW steam reformer with a 1 kW el PEM fuel cell

    Science.gov (United States)

    Mathiak, J.; Heinzel, A.; Roes, J.; Kalk, Th.; Kraus, H.; Brandt, H.

    The University of Duisburg-Essen has developed a compact multi-fuel steam reformer suitable for natural gas, propane and butane. This steam reformer was combined with a polymer electrolyte membrane fuel cell (PEM FC) and a system test of the process chain was performed. The fuel processor comprises a prereformer step, a primary reformer, water gas shift reactors, a steam generator, internal heat exchangers in order to achieve an optimised heat integration and an external burner for heat supply as well as a preferential oxidation step (PROX) as CO purification. The fuel processor is designed to deliver a thermal hydrogen power output from 500 W to 2.5 kW. The PEM fuel cell stack provides about 1 kW electrical power. In the following paper experimental results of measurements of the single components PEM fuel cell and fuel processor as well as results of the coupling of both to form a process chain are presented.

  6. Environmental Impact Statement for BOMARC Missile Site, McGuire AFB, New Jersey. Volume 3. Methodology Development. Appendices 3-1 through 3-8

    Science.gov (United States)

    1992-05-01

    wild, but are extant in cultivation . It is likely that some of these will not warrant listing, while others will be found to be in greater danger of...region (North-West Italy). Journal of Environmental Radioactivity 5:71-81. Connell, D.W., and Miller, G.J., 1984. Chemistry and Ecotoxicology of...Rare in most of the Pine Region, but occasional in cultivated areas near towns. Gray Squirrel (Sciarus carolinensis) Occasional throughout the Pine

  7. Functional Characterization of MC1R-TUBB3 Intergenic Splice Variants of the Human Melanocortin 1 Receptor.

    Directory of Open Access Journals (Sweden)

    Cecilia Herraiz

    Full Text Available The melanocortin 1 receptor gene (MC1R expressed in melanocytes is a major determinant of skin pigmentation. It encodes a Gs protein-coupled receptor activated by α-melanocyte stimulating hormone (αMSH. Human MC1R has an inefficient poly(A site allowing intergenic splicing with its downstream neighbour Tubulin-β-III (TUBB3. Intergenic splicing produces two MC1R isoforms, designated Iso1 and Iso2, bearing the complete seven transmembrane helices from MC1R fused to TUBB3-derived C-terminal extensions, in-frame for Iso1 and out-of-frame for Iso2. It has been reported that exposure to ultraviolet radiation (UVR might promote an isoform switch from canonical MC1R (MC1R-001 to the MC1R-TUBB3 chimeras, which might lead to novel phenotypes required for tanning. We expressed the Flag epitope-tagged intergenic isoforms in heterologous HEK293T cells and human melanoma cells, for functional characterization. Iso1 was expressed with the expected size. Iso2 yielded a doublet of Mr significantly lower than predicted, and impaired intracellular stability. Although Iso1- and Iso2 bound radiolabelled agonist with the same affinity as MC1R-001, their plasma membrane expression was strongly reduced. Decreased surface expression mostly resulted from aberrant forward trafficking, rather than high rates of endocytosis. Functional coupling of both isoforms to cAMP was lower than wild-type, but ERK activation upon binding of αMSH was unimpaired, suggesting imbalanced signaling from the splice variants. Heterodimerization of differentially labelled MC1R-001 with the splicing isoforms analyzed by co-immunoprecipitation was efficient and caused decreased surface expression of binding sites. Thus, UVR-induced MC1R isoforms might contribute to fine-tune the tanning response by modulating MC1R-001 availability and functional parameters.

  8. 75 FR 43556 - TA-W-73,381, MT Rail Link, Inc., Missoula, MT; TA-W-73,381A, Billings, MT; TA-W-73,381B, Laurel...

    Science.gov (United States)

    2010-07-26

    ... DEPARTMENT OF LABOR Employment and Training Administration TA-W-73,381, MT Rail Link, Inc., Missoula, MT; TA-W-73,381A, Billings, MT; TA-W-73,381B, Laurel, MT; TA-W-73,381C, Livingston, MT; TA-W-73... Helena, Montana. The amended notice applicable to TA-W-73,381 is hereby issued as follows: All workers of...

  9. Process Innovation, Product Differentiation, and Channel Structure: Strategic Incentives in a Duopoly

    OpenAIRE

    Sudheer Gupta; Richard Loulou

    1998-01-01

    In this paper we analyze the joint implications of two effects: (a) inserting independent profit-maximizing retailers into the channel system provides “buffering” to the manufacturers from price competition when their products are highly substitutable and intrachannel contracts are observable (as shown by McGuire and Staelin 1983 under the assumption of constant marginal production costs), and, (b) lack of channel coordination results in a reduction in manufacturer's incentives to invest in e...

  10. Determination of the neutron spectrum at different locations in the Argentine RA-1 Reactor; Determinacion del espectro neutronico en distintas posiciones del reactor RA-1

    Energy Technology Data Exchange (ETDEWEB)

    Lerner, A M; Madariaga, M R [Autoridad Regulatoria Nuclear, Buenos Aires (Argentina)

    1999-12-31

    Full text: It is well known that the RA-1 reactor is used to irradiate different types of materials with neutrons. The Radio dosimetry Group (which belongs to the Nuclear Regulatory Authority) uses its fast column for the design, calibration and set up of criticality dosimeters as well as for a quick assessment of the dose to workers in case of an accident. With such purpose, Au(1), Au under Cd and In(2) foils were irradiated to estimate absolute thermal, epithermal and fast neutron fluxes at the irradiation location. The accuracy of this estimation is higher when the response to the present neutron spectrum of the different materials constituting the detectors is better known. This, in turn, requires the previous knowledge of such spectrum (a detailed energy dependence of neutron flux) at the analysed location. In this work a neutronic calculation is presented at the fast irradiation location. The whole calculation was carried out following two different methodologies, and considering a power of 40 kW. The reactor and its surroundings were represented by a simplified one-dimensional model, as a concentric cylindrical set of regions. Figures are drawn representing fast and thermal fluxes (with the cut at 0.4 eV) as a function of the distance to the core centre. The neutron flux (in n/cm{sup 2}sec.eV) as a function of energy is also shown at the fast irradiation location. Values of flux (in n/cm{sup 2}.sec.eV) are also provided as a function of energy in other typical locations, as well as the equivalent integrated flux values (in n/cm{sup 2}.sec). ((1) According to the reaction Au{sup 197}(n,{gamma})Au{sup 198}, having a cross section of {sigma}{sub 0}=98.8b for thermal neutrons. (2) According to the reaction In{sup 115}(n,n`)In{sup 115m}, with a cross section of some 70 mb for neutrons with energies above 1.2MeV). (author) [Espanol] Texto completo: Como se sabe, el reactor RA1 se utiliza para irradiar con neutrones distintos tipos de materiales. El grupo de

  11. Mark I 1/5-scale boiling water reactor pressure suppression experiment. Quick-look report for test numbers 1.0(a) and 1.0(b) performed on March 4 and 8, 1977

    International Nuclear Information System (INIS)

    McCauley, E.W.; Pitts, J.H.

    1977-01-01

    The experimental results obtained from pressure suppression experiment numbers 1.0(a) and 1.0(b) that were performed on the Lawrence Livermore Laboratory's 1 / 5 -scale boiling water reactor (BWR) Mark I pressure suppression experimental facility are summarized

  12. Dosimetry of fission neutrons in a 1-W reactor, UTR-KINKI

    CERN Document Server

    Endo, S; Yoshitake, Y

    2002-01-01

    The energy spectrum of fission neutrons in the biological irradiation field of the Kinki University reactor, UTR-KINKI, has been determined by a multi-foil activation analysis coupled with artificial neural network techniques and a Au-foil activation method. The mean neutron energy was estimated to be 1.26+-0.05 MeV from the experimentally determined spectrum. Based on this energy value and other information, the neutron dose rate was estimated to be 19.7+-1.4 cGy/hr. Since this dose rate agrees with that measured by a pair of ionizing chambers (21.4 cGy/hr), we conclude that the mean neutron energy could be estimated with reasonable accuracy in the irradiation field of UTR-KINKI. (author)

  13. CONTAIN LMR/1B-Mod.1, A computer code for containment analysis of accidents in liquid-metal-cooled nuclear reactors

    International Nuclear Information System (INIS)

    Murata, K.K.; Carroll, D.E.; Bergeron, K.D.; Valdez, G.D.

    1993-01-01

    The CONTAIN computer code is a best-estimate, integrated analysis tool for predicting the physical, chemical, and radiological conditions inside a nuclear reactor containment building following the release of core material from the primary system. CONTAIN is supported primarily by the U. S. Nuclear Regulatory Commission (USNRC), and the official code versions produced with this support are intended primarily for the analysis of light water reactors (LWR). The present manual describes CONTAIN LMR/1B-Mod. 1, a code version designed for the analysis of reactors with liquid metal coolant. It is a variant of the official CONTAIN 1.11 LWR code version. Some of the features of CONTAIN-LMR for treating the behavior of liquid metal coolant are in fact present in the LWR code versions but are discussed here rather than in the User's Manual for the LWR versions. These features include models for sodium pool and spray fires. In addition to these models, new or substantially improved models have been installed in CONTAIN-LMR. The latter include models for treating two condensables (sodium and water) simultaneously, sodium atmosphere and pool chemistry, sodium condensation on aerosols, heat transfer from core-debris beds and to sodium pools, and sodium-concrete interactions. A detailed description of each of the above models is given, along with the code input requirements

  14. Do cosmological data rule out f (R ) with w ≠-1 ?

    Science.gov (United States)

    Battye, Richard A.; Bolliet, Boris; Pace, Francesco

    2018-05-01

    We review the equation of state (EoS) approach to dark sector perturbations and apply it to f (R ) gravity models of dark energy. We show that the EoS approach is numerically stable and use it to set observational constraints on designer models. Within the EoS approach we build an analytical understanding of the dynamics of cosmological perturbations for the designer class of f (R ) gravity models, characterized by the parameter B0 and the background equation of state of dark energy w . When we use the Planck cosmic microwave background temperature anisotropy, polarization, and lensing data as well as the baryonic acoustic oscillation data from SDSS and WiggleZ, we find B0<0.006 (95% C.L.) for the designer models with w =-1 . Furthermore, we find B0<0.0045 and |w +1 |<0.002 (95% C.L.) for the designer models with w ≠-1 . Previous analyses found similar results for designer and Hu-Sawicki f (R ) gravity models using the effective field theory approach [Raveri et al., Phys. Rev. D 90, 043513 (2014), 10.1103/PhysRevD.90.043513; Hu et al., Mon. Not. R. Astron. Soc. 459, 3880 (2016), 10.1093/mnras/stw775]; therefore this hints for the fact that generic f (R ) models with w ≠-1 can be tightly constrained by current cosmological data, complementary to solar system tests [Brax et al., Phys. Rev. D 78, 104021 (2008), 10.1103/PhysRevD.78.104021; Faulkner et al., Phys. Rev. D 76, 063505 (2007), 10.1103/PhysRevD.76.063505]. When compared to a w CDM fluid with the same sound speed, we find that the equation of state for f (R ) models is better constrained to be close to -1 by about an order of magnitude, due to the strong dependence of the perturbations on w .

  15. Material Control and Accounting Design Considerations for High-Temperature Gas Reactors

    International Nuclear Information System (INIS)

    Bjornard, Trond; Hockert, John

    2011-01-01

    The subject of this report is domestic safeguards and security by design (2SBD) for high-temperature gas reactors, focusing on material control and accountability (MC and A). The motivation for the report is to provide 2SBD support to the Next Generation Nuclear Plant (NGNP) project, which was launched by Congress in 2005. This introductory section will provide some background on the NGNP project and an overview of the 2SBD concept. The remaining chapters focus specifically on design aspects of the candidate high-temperature gas reactors (HTGRs) relevant to MC and A, Nuclear Regulatory Commission (NRC) requirements, and proposed MC and A approaches for the two major HTGR reactor types: pebble bed and prismatic. Of the prismatic type, two candidates are under consideration: (1) GA's GT-MHR (Gas Turbine-Modular Helium Reactor), and (2) the Modular High-Temperature Reactor (M-HTR), a derivative of Areva's Antares reactor. The future of the pebble-bed modular reactor (PBMR) for NGNP is uncertain, as the PBMR consortium partners (Westinghouse, PBMR (Pty) and The Shaw Group) were unable to agree on the path forward for NGNP during 2010. However, during the technology assessment of the conceptual design phase (Phase 1) of the NGNP project, AREVA provided design information and technology assessment of their pebble bed fueled plant design called the HTR-Module concept. AREVA does not intend to pursue this design for NGNP, preferring instead a modular reactor based on the prismatic Antares concept. Since MC and A relevant design information is available for both pebble concepts, the pebble-bed HTGRs considered in this report are: (1) Westinghouse PBMR; and (2) AREVA HTR-Module. The DOE Office of Nuclear Energy (DOE-NE) sponsors the Fuel Cycle Research and Development program (FCR and D), which contains an element specifically focused on the domestic (or state) aspects of SBD. This Material Protection, Control and Accountancy Technology (MPACT) program supports the present

  16. Osteogenic gene expression of murine osteoblastic (MC3T3-E1) cells under cyclic tension

    International Nuclear Information System (INIS)

    Kao, C T; Chen, C C; Cheong, U-I; Liu, S L; Huang, T H

    2014-01-01

    Low-level laser therapy (LLLT) can promote cell proliferation. The remodeling ability of the tension side of orthodontic teeth affects post-orthodontic stability. The purpose of the present study was to investigate the osteogenic effects of LLLT on osteoblast-like cells treated with a simulated tension system that provides a mechanical tension regimen. Murine osteoblastic (MC3T3-E1) cells were cultured in a Flexcell strain unit with programmed loads of 12% elongation at a frequency of 0.5 Hz for 24 and 48 h. The cultured cells were treated with a low-level diode laser using powers of 5 J and 10 J. The proliferation of MC3T3-E1 cells was determined using the Alamar Blue assay. The expression of osteogenic genes (type I collagen (Col-1), osteopontin (OPN), osteocalcin (OC), osteoprotegerin (OPG), receptor activator of nuclear factor kappa B ligand (RANKL), bone morphologic protein (BMP-2), and bone morphologic protein (BMP-4)) in MC3T3-E1 cells was analyzed using reverse transcription polymerase chain reaction (RT-PCR). The data were analyzed using one-way analysis of variance. The proliferation rate of tension-cultured MC3T3-E1 cells under 5 J and 10 J LLLT increased compared with that of the control group (p < 0.05). Prominent mineralization of the MC3T3-E1 cells was visible using a von Kossa stain in the 5 J LLLT group. Osteogenic genes (Col-1, OC, OPG and BMP-2) were significantly expressed in the MC3T3-E1 cells treated with 5 J and 10 J LLLT (p < 0.05). LLLT in tension-cultured MC3T3-E1 cells showed synergistic osteogenic effects, including increases in cell proliferation and Col-1, OPN, OC, OPG and BMP-2 gene expression. LLLT might be beneficial for bone remodeling on the tension side of orthodontics. (paper)

  17. Induction of Cyp1a1 and Cyp1b1 and formation of DNA adducts in C57BL/6, Balb/c, and F1 mice following in utero exposure to 3-methylcholanthrene

    International Nuclear Information System (INIS)

    Xu Mian; Nelson, Garret B.; Moore, Joseph E.; McCoy, Thomas P.; Dai, Jian; Manderville, Richard A.; Ross, Jeffrey A.; Miller, Mark Steven

    2005-01-01

    Fetal mice are more sensitive to chemical carcinogens than are adults. Previous studies from our laboratory demonstrated differences in the mutational spectrum induced in the Ki-ras gene from lung tumors isolated from [D2 x B6D2F1]F2 mice and Balb/c mice treated in utero with 3-methylcholanthrene (MC). We thus determined if differences in metabolism, adduct formation, or adduct repair influence strain-specific responses to transplacental MC exposure in C57BL/6 (B6), Balb/c (BC), and reciprocal F1 crosses between these two strains of mice. The induction of Cyp1a1 and Cyp1b1 in fetal lung and liver tissue was determined by quantitative fluorescent real-time PCR. MC treatment caused maximal induction of Cyp1a1 and Cyp1b1 RNA 2-8 h after injection in both organs. RNA levels for both genes then declined in both fetal organs, but a small biphasic, secondary increase in Cyp1a1 was observed specifically in the fetal lung 24-48 h after MC exposure in all four strains. Cyp1a1 induction by MC at 4 h was 2-5 times greater in fetal liver (7000- to 16,000-fold) than fetal lung (2000- to 6000-fold). Cyp1b1 induction in both fetal lung and liver was similar and much lower than that observed for Cyp1a1, with induction ratios of 8- to 18-fold in fetal lung and 10- to 20-fold in fetal liver. The overall kinetics and patterns of induction were thus very similar across the four strains of mice. The only significant strain-specific effect appeared to be the relatively poor induction of Cyp1b1 in the parental strain of B6 mice, especially in fetal lung tissue. We also measured the levels of MC adducts and their disappearance from lung tissue by the P 32 post-labeling assay on gestation days 18 and 19 and postnatal days 1, 4, 11, and 18. Few differences were seen between the different strains of mice; the parental strain of B6 mice had nominally higher levels of DNA adducts 2 (gestation day 19) and 4 (postnatal day 1) days after injection, although this was not statistically significant

  18. Benchmark testing of Canadol-2.1 for heavy water reactor

    International Nuclear Information System (INIS)

    Liu Ping

    1999-01-01

    The new version evaluated nuclear data library of ENDF-B 6.5 has been released recently. In order to compare the quality of evaluated nuclear data CENDL-2.1 with ENDF-B 6.5, it is necessary to do benchmarks testing for them. In this work, CENDL-2.1 and ENDF-B 6.5 were used to generated the WIMS-69 group library respectively, and benchmarks testing was done for the heavy water reactor, using WIMS5A code. It is obvious that data files of CENDL-2.1 is better than that of old WIMS library for the heavy water reactors calculations, and is in good agreement with those of ENDF-B 6.5

  19. Thermal and fast reactor benchmark testing of ENDF/B-6.4

    International Nuclear Information System (INIS)

    Liu Guisheng

    1999-01-01

    The benchmark testing for B-6.4 was done with the same benchmark experiments and calculating method as for B-6.2. The effective multiplication factors k eff , central reaction rate ratios of fast assemblies and lattice cell reaction rate ratios of thermal lattice cell assemblies were calculated and compared with testing results of B-6.2 and CENDL-2. It is obvious that 238 U data files are most important for the calculations of large fast reactors and lattice thermal reactors. However, 238 U data in the new version of ENDF/B-6 have not been renewed. Only data of 235 U, 27 Al, 14 N and 2 D have been renewed in ENDF/B-6.4. Therefor, it will be shown that the thermal reactor benchmark testing results are remarkably improved and the fast reactor benchmark testing results are not improved

  20. A metric graph satisfying w41=1$w_4^1 = 1$ that cannot be lifted to a curve satisfying dim⁡ (W41=1$\\dim \\;(W_4^1 = 1$

    Directory of Open Access Journals (Sweden)

    Coppens Marc

    2016-01-01

    Full Text Available For all integers g ≥ 6 we prove the existence of a metric graph G with w41=1$w_4^1 = 1$ such that G has Clifford index 2 and there is no tropical modification G′ of G such that there exists a finite harmonic morphism of degree 2 from G′ to a metric graph of genus 1. Those examples show that not all dimension theorems on the space classifying special linear systems for curves have immediate translation to the theory of divisors on metric graphs.

  1. PARR-2: reactor description and experiments

    International Nuclear Information System (INIS)

    Wyne, M.F.; Meghji, J.H.

    1990-12-01

    PARR-2 is a miniature neutron source reactor (MNSR) research reactor has been designed at the rate of 27 kW. Reactor assembly comprises of peaking characteristics with a self limiting flux. In this report reactor description with its assembly and instrumentation control system has been explained. The reactor engineering and physics experiments which can be performed on this reactor are explained in this report. PARR-2 is fueled with HEU fuel pins which are about 90% enriched in U-235. Specific requirements for the safety of the reactor, its building and the personnel, normal instrumentation as required in an industrial environment is sufficient. (A.B.)

  2. Powder Metallurgy of Uranium Alloy Fuels for TRU-Burning Reactors Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    McDeavitt, Sean M

    2011-04-29

    outlining the beginning of the materials processing setup. Also included within this section is a thesis proposal by Jeff Hausaman. Appendix C contains the public papers and presentations introduced at the 2010 American Nuclear Society Winter Meeting. Appendix A—MSNE theses of David Garnetti and Grant Helmreich and proposal by Jeff Hausaman A.1 December 2009 Thesis by David Garnetti entitled “Uranium Powder Production Via Hydride Formation and Alpha Phase Sintering of Uranium and Uranium-Zirconium Alloys for Advanced Nuclear Fuel Applications” A.2 September 2009 Presentation by David Garnetti (same title as document in Appendix B.1) A.3 December 2010 Thesis by Grant Helmreich entitled “Characterization of Alpha-Phase Sintering of Uranium and Uranium-Zirconium Alloys for Advanced Nuclear Fuel Applications” A.4 October 2010 Presentation by Grant Helmreich (same title as document in Appendix B.3) A.5 Thesis Proposal by Jeffrey Hausaman entitled “Hot Extrusion of Alpha Phase Uranium-Zirconium Alloys for TRU Burning Fast Reactors” Appendix B—External presentations introduced at the 2010 ANS Winter Meeting B.1 J.S. Hausaman, D.J. Garnetti, and S.M. McDeavitt, “Powder Metallurgy of Alpha Phase Uranium Alloys for TRU Burning Fast Reactors,” Proceedings of 2010 ANS Winter Meeting, Las Vegas, Nevada, USA, November 7-10, 2010 B.2 PowerPoint Presentation Slides from C.1 B.3 G.W. Helmreich, W.J. Sames, D.J. Garnetti, and S.M. McDeavitt, “Uranium Powder Production Using a Hydride-Dehydride Process,” Proceedings of 2010 ANS Winter Meeting, Las Vegas, Nevada, USA, November 7-10, 2010 B.4. PowerPoint Presentation Slides from C.3 B.5 Poster Presentation from C.3 Appendix C—Fuel cycle research and development undergraduate materials and poster presentation C.1 Poster entitled “Characterization of Alpha-Phase Sintering of Uranium and Uranium-Zirconium Alloys” presented at the Fuel Cycle Technologies Program Annual Meeting C.2 April 2011 Honors Undergraduate Thesis

  3. Calculation of the source term for a S1B-sequence at a VVER-1000 type reactor. Part 1

    International Nuclear Information System (INIS)

    Sdouz, G.

    1990-10-01

    The behaviour of the source term in a VVER-1000 type reactor is calculated using the 'Source Term Code Package' (STCP). The input data are based on the russian plant Zaporozhye-5. The selected accident sequence is a small break LOCA in the hot leg followed by loss offsite and onsite electric power (S 1 B-sequence). According to the course of the calculation the results are presented and analyzed for each program. Except for the noble gases all release fractions are lower than 10 -4 . 18 refs., 10 tabs. (Author)

  4. Temperature dependence of the interfacial magnetic anisotropy in W/CoFeB/MgO

    Directory of Open Access Journals (Sweden)

    Kyoung-Min Lee

    2017-06-01

    Full Text Available The interfacial perpendicular magnetic anisotropy in W/CoFeB (1.2 ∼ 3 nm/MgO thin film structures is strongly dependent on temperature, and is significantly reduced at high temperature. The interfacial magnetic anisotropy is generally proportional to the third power of magnetization, but an additional factor due to thermal expansion is required to explain the temperature dependence of the magnetic anisotropy of ultrathin CoFeB films. The reduction of the magnetic anisotropy is more prominent for the thinner films; as the temperature increases from 300 K to 400 K, the anisotropy is reduced ∼50% for the 1.2-nm-thick CoFeB, whereas the anisotropy is reduced ∼30% for the 1.7-nm-thick CoFeB. Such a substantial reduction of magnetic anisotropy at high temperature is problematic for data retention when incorporating W/CoFeB/MgO thin film structures into magneto-resistive random access memory devices. Alternative magnetic materials and structures are required to maintain large magnetic anisotropy at elevated temperatures.

  5. Ice condenser containment analysis with the GOTHIC code

    International Nuclear Information System (INIS)

    Yadon, T.P.

    1996-01-01

    Analytical methodologies have recently been developed by Duke Power Company (Duke) to calculate the thermodynamic response of the ice condenser containment buildings at the McGuire and Catawba Nuclear Stations to high-energy line breaks. The GOTHIC computer code (Version 4.0) was utilized for these analyses. In the ice condenser containment design, a large mass of ice stored within the containment building is used to absorb the energy released from high-energy line breaks, thereby limiting the peak pressure and temperature in the containment building to within design limits. The McGuire and Catawba Nuclear Stations (both two-unit, 3411 MWth four-loop Westinghouse plants) are of the ice condenser containment design

  6. A 1-V 60-μW 85-dB dynamic range continuous-time third-order sigma-delta modulator

    International Nuclear Information System (INIS)

    Li Yuanwen; Qi Da; Dong Yifeng; Xu Jun; Ren Junyan

    2009-01-01

    A 1-V third order one-bit continuous-time (CT) EA modulator is presented. Designed in the SMIC mixed-signal 0.13-μm CMOS process, the modulator utilizes active RC integrators to implement the loop filter. An efficient circuit design methodology for the CT ΣΔ modulator is proposed and verified. Low power dissipation is achieved through the use of two-stage class A/AB amplifiers. The presented modulator achieves 81.4-dB SNDR and 85-dB dynamic range in a 20-kHz bandwidth with an over sampling ratio of 128. The total power consumption of the modulator is only 60 μW from a 1-V power supply and the prototype occupies an active area of 0.12 mm 2 . (semiconductor integrated circuits)

  7. Reactors. Nuclear propulsion ships

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2001-01-01

    This article has for object the development of nuclear-powered ships and the conception of the nuclear-powered ship. The technology of the naval propulsion P.W.R. type reactor is described in the article B.N.3 141 'Nuclear Boilers ships'. (N.C.)

  8. Plans for use of ENDF/B in reactor research in Indonesia

    International Nuclear Information System (INIS)

    Santoso, B.; Syaukat, A.; Subki, I.; Ganesan, S.

    1989-07-01

    Nuclear data are numerical constants of nature which quantify the nuclear behaviour of all elements and isotopes which make up the reactor medium and its environment, and which are needed as input for performing design calculations for safe and reliable operation of nuclear reactors. The nuclear data are available in the form of recommended values in specially formatted computerized files such as the Evaluated Nuclear Data File-B, known as ENDF/B. The development of base technology in the scheme of original reactor design calculations involves the mastering of the art of ENDF/B data processing. This paper briefly discusses the current status of this activity in Jakarta and gives an account of the future plans, with emphasis on the role of ENDF/B in reactor calculations. (author). 15 refs, 9 figs

  9. THYDE-B1/MOD1: a computer code for analysis of small-break loss-of-coolant accident of boiling water reactors

    International Nuclear Information System (INIS)

    Muramatsu, Ken; Akimoto, Masayuki

    1982-08-01

    THYDE-B1/MOD1 is a computer code to analyze thermo-hydraulic transients of the reactor cooling system of a BWR, mainly during a small-break loss-of-coolant accidnet (SB-LOCA) with a special emphasis on the behavior of pressure and mixture level in the pressure vessel. The coolant behavior is simulated with a volume-and-junction method based on assumptions of thermal equilibrium and homogeneous conditions for two-phase flow. A characteristic feature of this code is a three-region representation of the state of the coolant in a control volume, in which three regions, i.e., subcooled liquid, saturated mixture and saturated steam regions are allowed to exist. The regions are separated by moving boundaries, tracked by mass and energy balances for each region. The interior of the pressure vessel is represented by two volumes with three regions: one for inside of the shroud and the other for outside, while other portions of the system are treated with homogeneous model. This method, although it seems to be very simple, has been verified to be adequate for cases of BWR SB-LOCAs in which the hydraulic transient is relatively slow and the cooling of the core strongly depends on the mixture level behavior in the vessel. In order to simulate the system behavior, THYDE-B1 is provided with analytical models for reactor kinetics, heat generation and conduction in fuel rods and structures, heat transfer between coolant and solid surfaces, coolant injection systems, breaks and discharge systems, jet pumps, recirculation pumps, and so on. The verification of the code has been conducted. A good predictability of the code has been indicated through the comparison of calculated results with experimental data provided by ROSA-III small-break tests. This report presents the analytical models, solution method, and input data requirements of the THYDE-B1/MOD1 code. (author)

  10. Targeting the S1P Axis and Development of a Novel Therapy for Obesity-Related Triple-Negative Breast Cancer

    Science.gov (United States)

    2016-09-01

    Kain, B.W. Day, B.W. Stringer, B. Daniels, M.A. Laaksonen, C. Teo , K.L. McDonald, A.S. Don, A metabolic shift favoring sphingosine 1-phosphate at the...doi:10.1186/1755-1536-3-12. 3. Haslene-Hox H, Oveland E, Berg KC , Kolmannskog O, Woie K, Salvesen HB, et al. A new method for isolation of interstitial

  11. Neutron irradiation effects on grain-refined W and W-alloys

    International Nuclear Information System (INIS)

    Hasegawa, A.; Fukuda, M.; Tanno, T.; Nogami, S.; Yabuuchi, K.; Tanaka, T.; Muroga, T.

    2014-10-01

    Microstructural data of neutron irradiated Tungsten (W) such as size and number density of voids and precipitates obtained by W up to 1.5dpa irradiation in the temperature range of 400-800degC were compiled quantitatively. Nucleation and growth process of these defects were clarified and a qualitative prediction of the damage structure development and hardening of W in fusion reactor environments were made taking into account the solid transmutation effects for the first time. To improve recrystallization behavior and low temperature embrittlement, grain refined-W alloys were fabricated by K- or La-doping method. Rhenium addition to the grain refining process was also examined to improve mechanical properties. Characterizations of unirradiated materials were performed. (author)

  12. mc1r Pathway regulation of zebrafish melanosome dispersion

    DEFF Research Database (Denmark)

    Richardson, Jennifer; Lundegaard, Pia Rengtved; Reynolds, Natalie L

    2008-01-01

    Zebrafish rapidly alter their pigmentation in response to environmental changes. For black melanocytes, this change is due to aggregation or dispersion of melanin in the cell. Dispersion and aggregation are controlled by intracellular cyclic adenosine monophosphate (cAMP) levels, which increase...... in mammals, and melanosome dispersal in cold-blood vertebrates, the pathway components are highly conserved. However, it has only been assumed that mc1r mediates melanosome dispersal in fish. Here, using morpholino oligonucleotides designed to knockdown mc1r expression, we find that mc1r morphants are unable...... to disperse melanosomes when grown in dark conditions. We also use chemical modifiers of the cAMP pathway, and find an unexpected response to the specific phosphodiesterase 4 (PDE4) inhibitor, rolipram, in melanosome dispersal. When treated with the drug, melanosomes fail to fully disperse in dark conditions...

  13. Increased expression of Matrix Metalloproteinase 9 in liver from NZB/W F1 mice received antibody against human parvovirus B19 VP1 unique region protein

    Directory of Open Access Journals (Sweden)

    Hsu Gwo-Jong

    2009-01-01

    Full Text Available Abstract Background Human parvovirus B19 infection has been postulated to the anti-phospholipid syndrome (APS in autoimmunity. However, the influence of anti-B19-VP1u antibody in autoimmune diseases is still obscure. Methods To elucidate the effect of anti-B19-VP1u antibodies in systemic lupus erythematosus (SLE, passive transfer of rabbit anti-B19-VP1u IgG was injected intravenously into NZB/W F1 mice. Results Significant reduction of platelet count and prolonged thrombocytopenia time were detected in anti-B19-VP1u IgG group as compared to other groups, whereas significant increases of anti-B19-VP1u, anti-phospholipid (APhL, and anti-double strand DNA (dsDNA antibody binding activity were detected in anti-B19-VP1u group. Additionally, significant increases of matrix metalloproteinase-9 (MMP9 activity and protein expression were detected in B19-VP1u IgG group. Notably, phosphatidylinositol 3-phosphate kinase (PI3K and phosphorylated extracellular signal-regulated kinase (ERK proteins were involved in the induction of MMP9. Conclusion These experimental results firstly demonstrated the aggravated effects of anti-B19-VP1u antibody in disease activity of SLE.

  14. Measurement of the $W+b$-jet and $W+c$-jet differential production cross sections in $p\\bar{p}$ collisions at $\\sqrt{s}=1.96$ TeV

    CERN Document Server

    Abazov, Victor Mukhamedovich; Acharya, Bannanje Sripath; Adams, Mark Raymond; Adams, Todd; Agnew, James P; Alexeev, Guennadi D; Alkhazov, Georgiy D; Alton, Andrew K; Askew, Andrew Warren; Atkins, Scott; Augsten, Kamil; Avila, Carlos A; Badaud, Frederique; Bagby, Linda F; Baldin, Boris; Bandurin, Dmitry V; Banerjee, Sunanda; Barberis, Emanuela; Baringer, Philip S; Bartlett, JFrederick; Bassler, Ursula Rita; Bazterra, Victor; Bean, Alice L; Begalli, Marcia; Bellantoni, Leo; Beri, Suman B; Bernardi, Gregorio; Bernhard, Ralf Patrick; Bertram, Iain A; Besancon, Marc; Beuselinck, Raymond; Bhat, Pushpalatha C; Bhatia, Sudeep; Bhatnagar, Vipin; Blazey, Gerald Charles; Blessing, Susan K; Bloom, Kenneth A; Boehnlein, Amber S; Boline, Daniel Dooley; Boos, Edward E; Borissov, Guennadi; Borysova, Maryna; Borysov, Oleksandr; Brandt, Andrew; Brandt, Oleg; Brock, Raymond L; Bross, Alan D; Brown, Duncan Paul; Bu, Xue-Bing; Buehler, Marc; Buescher, Volker; Bunichev, Viacheslav Yevgenyevich; Burdin, Sergey; Buszello, Claus Peter; Camacho-Perez, Enrique; Casey, Brendan Cameron Kieran; Castilla-Valdez, Heriberto; Caughron, Seth Aaron; Chakrabarti, Subhendu; Chan, Kwok Ming Leo; Chandra, Avdhesh; Chapon, Emilien; Chen, Guo; Cho, Sung-Woong; Choi, Suyong; Choudhary, Brajesh C; Cihangir, Selcuk; Claes, Daniel R; Clutter, Justace Randall; Cooke, Michael P; Cooper, William Edward; Corcoran, Marjorie D; Couderc, Fabrice; Cousinou, Marie-Claude; Cutts, David; Das, Amitabha; Davies, Gavin John; de Jong, Sijbrand Jan; De La Cruz-Burelo, Eduard; Deliot, Frederic; Demina, Regina; Denisov, Dmitri S; Denisov, Sergei P; Desai, Satish Vijay; Deterre, Cecile; DeVaughan, Kayle Otis; Diehl, HThomas; Diesburg, Michael; Ding, Pengfei; Dominguez, DAaron M; Dubey, Abhinav Kumar; Dudko, Lev V; Duperrin, Arnaud; Dutt, Suneel; Eads, Michael T; Edmunds, Daniel L; Ellison, John A; Elvira, VDaniel; Enari, Yuji; Evans, Harold G; Evdokimov, Valeri N; Faure, Alexandre; Feng, Lei; Ferbel, Thomas; Fiedler, Frank; Filthaut, Frank; Fisher, Wade Cameron; Fisk, HEugene; Fortner, Michael R; Fox, Harald; Fuess, Stuart C; Garbincius, Peter H; Garcia-Bellido, Aran; Garcia-Gonzalez, Jose Andres; Gavrilov, Vladimir B; Geng, Weigang; Gerber, Cecilia Elena; Gershtein, Yuri S; Ginther, George E; Gogota, Olga; Golovanov, Georgy Anatolievich; Grannis, Paul D; Greder, Sebastien; Greenlee, Herbert B; Grenier, Gerald Jean; Gris, Phillipe Luc; Grivaz, Jean-Francois; Grohsjean, Alexander; Gruenendahl, Stefan; Gruenewald, Martin Werner; Guillemin, Thibault; Gutierrez, Gaston R; Gutierrez, Phillip; Haley, Joseph Glenn Biddle; Han, Liang; Harder, Kristian; Harel, Amnon; Hauptman, John Michael; Hays, Jonathan M; Head, Tim; Hebbeker, Thomas; Hedin, David R; Hegab, Hatim; Heinson, Ann; Heintz, Ulrich; Hensel, Carsten; Heredia-De La Cruz, Ivan; Herner, Kenneth Richard; Hesketh, Gavin G; Hildreth, Michael D; Hirosky, Robert James; Hoang, Trang; Hobbs, John D; Hoeneisen, Bruce; Hogan, Julie; Hohlfeld, Mark; Holzbauer, Jenny Lyn; Howley, Ian James; Hubacek, Zdenek; Hynek, Vlastislav; Iashvili, Ia; Ilchenko, Yuriy; Illingworth, Robert A; Ito, Albert S; Jabeen, Shabnam; Jaffre, Michel J; Jayasinghe, Ayesh; Jeong, Min-Soo; Jesik, Richard L; Jiang, Peng; Johns, Kenneth Arthur; Johnson, Emily; Johnson, Marvin E; Jonckheere, Alan M; Jonsson, Per Martin; Joshi, Jyoti; Jung, Andreas Werner; Juste, Aurelio; Kajfasz, Eric; Karmanov, Dmitriy Y; Katsanos, Ioannis; Kaur, Manbir; Kehoe, Robert Leo Patrick; Kermiche, Smain; Khalatyan, Norayr; Khanov, Alexander; Kharchilava, Avto; Kharzheev, Yuri N; Kiselevich, Ivan Lvovich; Kohli, Jatinder M; Kozelov, Alexander V; Kraus, James Alexander; Kumar, Ashish; Kupco, Alexander; Kurca, Tibor; Kuzmin, Valentin Alexandrovich; Lammers, Sabine Wedam; Lebrun, Patrice; Lee, Hyeon-Seung; Lee, Seh-Wook; Lee, William M; Lei, Xiaowen; Lellouch, Jeremie; Li, Dikai; Li, Hengne; Li, Liang; Li, Qi-Zhong; Lim, Jeong Ku; Lincoln, Donald W; Linnemann, James Thomas; Lipaev, Vladimir V; Lipton, Ronald J; Liu, Huanzhao; Liu, Yanwen; Lobodenko, Alexandre; Lokajicek, Milos; Lopes de Sa, Rafael; Luna-Garcia, Rene; Lyon, Adam Leonard; Maciel, Arthur KA; Madar, Romain; Magana-Villalba, Ricardo; Malik, Sudhir; Malyshev, Vladimir L; Mansour, Jason; Martinez-Ortega, Jorge; McCarthy, Robert L; Mcgivern, Carrie Lynne; Meijer, Melvin M; Melnitchouk, Alexander S; Menezes, Diego D; Mercadante, Pedro Galli; Merkin, Mikhail M; Meyer, Arnd; Meyer, Jorg Manfred; Miconi, Florian; Mondal, Naba K; Mulhearn, Michael James; Nagy, Elemer; Narain, Meenakshi; Nayyar, Ruchika; Neal, Homer A; Negret, Juan Pablo; Neustroev, Petr V; Nguyen, Huong Thi; Nunnemann, Thomas P; Hernandez Orduna, Jose de Jesus; Osman, Nicolas Ahmed; Osta, Jyotsna; Pal, Arnab; Parashar, Neeti; Parihar, Vivek; Park, Sung Keun; Partridge, Richard A; Parua, Nirmalya; Patwa, Abid; Penning, Bjoern; Perfilov, Maxim Anatolyevich; Peters, Reinhild Yvonne Fatima; Petridis, Konstantinos; Petrillo, Gianluca; Petroff, Pierre; Pleier, Marc-Andre; Podstavkov, Vladimir M; Popov, Alexey V; Prewitt, Michelle; Price, Darren; Prokopenko, Nikolay N; Qian, Jianming; Quadt, Arnulf; Quinn, Gene Breese; Ratoff, Peter N; Razumov, Ivan A; Ripp-Baudot, Isabelle; Rizatdinova, Flera; Rominsky, Mandy Kathleen; Ross, Anthony; Royon, Christophe; Rubinov, Paul Michael; Ruchti, Randal C; Sajot, Gerard; Sanchez-Hernandez, Alberto; Sanders, Michiel P; Santos, Angelo Souza; Savage, David G; Savitskyi, Mykola; Sawyer, HLee; Scanlon, Timothy P; Schamberger, RDean; Scheglov, Yury A; Schellman, Heidi M; Schwanenberger, Christian; Schwienhorst, Reinhard H; Sekaric, Jadranka; Severini, Horst; Shabalina, Elizaveta K; Shary, Viacheslav V; Shaw, Savanna; Shchukin, Andrey A; Simak, Vladislav J; Skubic, Patrick Louis; Slattery, Paul F; Smirnov, Dmitri V; Snow, Gregory R; Snow, Joel Mark; Snyder, Scott Stuart; Soldner-Rembold, Stefan; Sonnenschein, Lars; Soustruznik, Karel; Stark, Jan; Stoyanova, Dina A; Strauss, Michael G; Suter, Louise; Svoisky, Peter V; Titov, Maxim; Tokmenin, Valeriy V; Tsai, Yun-Tse; Tsybychev, Dmitri; Tuchming, Boris; Tully, Christopher George T; Uvarov, Lev; Uvarov, Sergey L; Uzunyan, Sergey A; Van Kooten, Richard J; van Leeuwen, Willem M; Varelas, Nikos; Varnes, Erich W; Vasilyev, Igor A; Verkheev, Alexander Yurievich; Vertogradov, Leonid S; Verzocchi, Marco; Vesterinen, Mika; Vilanova, Didier; Vokac, Petr; Wahl, Horst D; Wang, Michael HLS; Warchol, Jadwiga; Watts, Gordon Thomas; Wayne, Mitchell R; Weichert, Jonas; Welty-Rieger, Leah Christine; Williams, Mark Richard James; Wilson, Graham Wallace; Wobisch, Markus; Wood, Darien Robert; Wyatt, Terence R; Xie, Yunhe; Yamada, Ryuji; Yang, Siqi; Yasuda, Takahiro; Yatsunenko, Yuriy A; Ye, Wanyu; Ye, Zhenyu; Yin, Hang; Yip, Kin; Youn, Sungwoo; Yu, Jiaming; Zennamo, Joseph; Zhao, Tianqi Gilbert; Zhou, Bing; Zhu, Junjie; Zielinski, Marek; Zieminska, Daria; Zivkovic, Lidija

    2015-04-09

    We present a measurement of the cross sections for the associated production of a $W$ boson with at least one heavy quark jet, $b$ or $c$, in proton-antiproton collisions. Data corresponding to an integrated luminosity of 8.7 fb$^{-1}$ recorded with the D0 detector at the Fermilab Tevatron \\ppbar Collider at $\\sqrt{s}=1.96$ TeV are used to measure the cross sections differentially as a function of the jet transverse momenta in the range 20 to 150 GeV. These results are compared to calculations of perturbative QCD theory as well as predictions from Monte Carlo generators.

  15. New features in McStas, version 1.5

    DEFF Research Database (Denmark)

    Åstrand, P.O.; Lefmann, K.; Farhi, E.

    2002-01-01

    The neutron ray-tracing simulation package McStas has attracted numerous users, and the development of the package continues with version 1.5 released at the ICNS 2001 conference. New features include: support for neutron polarisation, labelling of neutrons, realistic source and sample components......, and interface to the Riso instrument-control software TASCOM. We give a general introduction to McStas and present the latest developments. In particular, we give an example of how the neutron-label option has been used to locate the origin of a spurious side-peak, observed in an experiment with RITA-1 at Riso....

  16. New features in McStas, version 1.5

    International Nuclear Information System (INIS)

    Aastrand, P.O.; Lefmann, K.; Nielsen, K.; Skaarup, P.; Farhi, E.

    2002-01-01

    The neutron ray-tracing simulation package McStas has attracted numerous users, and the development of the package continues with version 1.5 released at the ICNS 2001 conference. New features include: support for neutron polarisation, labelling of neutrons, realistic source and sample components, and interface to the Riso instrument-control software TASCOM. We give a general introduction to McStas and present the latest developments. In particular, we give an example of how the neutron-label option has been used to locate the origin of a spurious side-peak, observed in an experiment with RITA-1 at Riso. (orig.)

  17. FiR 1 reactor in service for boron neutron capture therapy (BNCT) and isotope production

    International Nuclear Information System (INIS)

    Auterinen, I.; Salmenhaara, S.E.J. . Author

    2004-01-01

    The FiR 1 reactor, a 250 kW Triga reactor, has been in operation since 1962. The main purpose for the existence of the reactor is now the Boron Neutron Capture Therapy (BNCT), but FiR 1 has also an important national role in providing local enterprises and research institutions in the fields of industrial measurements, pharmaceuticals, electronics etc. with isotope production and activation analysis services. In the 1990's a BNCT treatment facility was built at the FiR 1 reactor located at Technical Research Centre of Finland. A special new neutron moderator material Fluental TM (Al+AlF3+Li) developed at VTT ensures the superior quality of the neutron beam. Also the treatment environment is of world top quality after a major renovation of the whole reactor building in 1997. Recently the lithiated polyethylene neutron shielding of the beam aperture was modified to ease the positioning of the patient close to the beam aperture. Increasing the reactor power to 500 kW would allow positioning of the patient further away from the beam aperture. Possibilities to accomplish a safety analysis for this is currently under considerations. Over thirty patients have been treated at FiR 1 since May 1999, when the license for patient treatment was granted to the responsible BNCT treatment organization, Boneca Corporation. Currently three clinical trial protocols for tumours in the brain as well as in the head and neck region are recruiting patients. (author)

  18. Swelling and swelling resistance possibilities of austenitic stainless steels in fusion reactors

    International Nuclear Information System (INIS)

    Maziasz, P.J.

    1983-01-01

    Fusion reactor helium generation rates in stainless steels are intermediate to those found in EBR-II and HFIR, and swelling in fusion reactors may differ from the fission swelling behavior. Advanced titanium-modified austenitic stainless steels exhibit much better void swelling resistance than AISI 316 under EBR-II (up to approx. 120 dpa) and HFIR (up to approx. 44 dpa) irradiations. The stability of fine titanium carbide (MC) precipitates plays an important role in void swelling resistance for the cold-worked titanium-modified steels irradiated in EBR-II. Futhermore, increased helium generation in these steels can (a) suppress void conversion, (b) suppress radiation-induced solute segregation (RIS), and (c) stabilize fine MC particles, if sufficient bubble nucleation occurs early in the irradation. The combined effects of helium-enhanced MC stability and helium-suppressed RIS suggest better void swelling resistance in these steels for fusion service than under EBR-II irradiation

  19. Modernization of the CDTN IPR-R1 TRIGA reactor instrumentation and control

    International Nuclear Information System (INIS)

    Mesquita, A.Z.; Costa, A.C.L.; Souza, R.M.G.P.

    2009-01-01

    The control system of the IPR-R1 was changed in 1995. Although since the year's 80 was generalized the use of microprocessor technology and video monitors for visual interface, in the IPR-R1 control room it was used analogical system by relay-based logic, and were maintained the mechanical strip chart recorders (ink-pen drive) to measure, monitor and store the operational parameters. It was maintained the measure and the control of, practically, the same variables of the original system, although the reactor power already have been upgraded to 100 kW and began the studies to increase it to 250 kW, which is the current core configuration. For 250 kW operations the fuel heat transfer becomes important and new parameters should be used as safety operational limits. A state-of-the-art instrumentation and control system using microprocessor technology is proposed to replace the present analogical systems. The new system can eliminates most manual data logging, provides automatic or manual reactor operation modes, provides complete real-time operator display, replays historical operating data on monitor or printer, eliminates spare parts replacement problems and meets all applicable international standards as NRC and IEE specifications. This paper describes the research project in process in CDTN that has as objective the modernization of the IPR-R1 TRIGA reactor instrumentation and control of the operational variables. The project also will improve the accomplishment of neutronic and thermal-hydraulic experiments, foreseen in the CDTN research program. (author)

  20. Operational performance of the development of a 15 kW parabolic trough mid-temperature solar receiver/reactor for hydrogen production

    International Nuclear Information System (INIS)

    Hong, Hui; Liu, Qibin; Jin, Hongguang

    2012-01-01

    Highlights: ► A 15 kW solar chemical receiver/reactor for hydrogen production was developed. ► The solar thermochemical efficiency of the receiver/reactor was in the range of 20–28%. ► Hydrogen production exceeding 80% was achieved. ► The research results extend the application of mid-temperature solar thermal energy. -- Abstract: In this paper, we report the operational performance and energy conversion efficiency of a developed 15 kW solar chemical receiver/reactor for hydrogen production. A concentrated solar heat of around 200–300 °C was utilized to provide process heat to drive methanol steam reforming. A modified 15 kW direct-irradiation solar reactor coupled with a linear receiver positioned along the focal line of a one-axis parabolic trough concentrator was used. The experiments were conducted from 200 to 300 °C under a mean solar flux of 300–800 W/m 2 and a reactant feeding rate of 6 kg/h. Reactants were continuously fed, and the attained conversion rate of methanol was more than 70% at 700 W/m 2 . The typical solar thermochemical efficiency of solar thermal energy converted into chemical energy was in the 20–28% range. The overall energy efficiency of input solar power conversion into chemical energy reached up to 17% and may be further increased by improving solar field efficiency. Hydrogen production exceeding 80% was achieved. In addition, preliminary economic evaluation was performed, and methods for further improvement were proposed. This paper proves that solar hydrogen production is feasible by combining solar thermal energy with alternative fuel at around 200–300 °C, which is much lower than the temperature of other solar thermochemical processes. This may offer an economic approach to solar fuel production and extend the application of mid-temperature solar thermal energy.

  1. Comparative analysis between P1 and B1 equations for neutron moderation

    International Nuclear Information System (INIS)

    Martinez, Aquilino Senra; Silva, Fernando Carvalho da; Cardoso, Carlos Eduardo Santos

    2000-01-01

    In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

  2. Experimental study of the temperature distribution in the TRIGA IPR-R1 Brazilian research reactor; Investigacao experimental da distribuicao de temperaturas no reator nuclear de pesquisa TRIGA IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Amir Zacarias

    2005-07-01

    The TRIGA-IPR-R1 Research Nuclear Reactor has completed 44 years in operation in November 2004. Its initial nominal thermal power was 30 kW. In 1979 its power was increased to 100 kW by adding new fuel elements to the reactor. Recently some more fuel elements were added to the core increasing the power to 250 kW. The TRIGA-IPR-R1 is a pool type reactor with a natural circulation core cooling system. Although the large number of experiments had been carried out with this reactor, mainly on neutron activation analysis, there is not many data on its thermal-hydraulics processes, whether experimental or theoretical. So a number of experiments were carried out with the measurement of the temperature inside the fuel element, in the reactor core and along the reactor pool. During these experiments the reactor was set in many different power levels. These experiments are part of the CDTN/CNEN research program, and have the main objective of commissioning the TRIGA-IPR-R1 reactor for routine operation at 250 kW. This work presents the experimental and theoretical analyses to determine the temperature distribution in the reactor. A methodology for the calibration and monitoring the reactor thermal power was also developed. This methodology allowed adding others power measuring channels to the reactor by using thermal processes. The fuel thermal conductivity and the heat transfer coefficient from the cladding to the coolant were also experimentally valued. lt was also presented a correlation for the gap conductance between the fuel and the cladding. The experimental results were compared with theoretical calculations and with data obtained from technical literature. A data acquisition and processing system and a software were developed to help the investigation. This system allows on line monitoring and registration of the main reactor operational parameters. The experiments have given better comprehension of the reactor thermal-fluid dynamics and helped to develop numerical

  3. Caffeic acid phenethyl ester inhibits 3-MC-induced CYP1A1 expression through induction of hypoxia-inducible factor-1α

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyung Gyun [Department of Toxicology, College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of); Han, Eun Hee [Division of Life Science, Korea Basic Science Institute, Daejeon (Korea, Republic of); Im, Ji Hye; Lee, Eun Ji; Jin, Sun Woo [Department of Toxicology, College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of); Jeong, Hye Gwang, E-mail: hgjeong@cnu.ac.kr [Department of Toxicology, College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of)

    2015-09-25

    Caffeic acid phenethyl ester (CAPE), a natural component of propolis, is reported to have anticarcinogenic properties, although its precise chemopreventive mechanism remains unclear. In this study, we examined the effects of CAPE on 3-methylcholanthrene (3-MC)-induced CYP1A1 expression and activities. CAPE reduced the formation of the benzo[a]pyrene-DNA adduct. Moreover, CAPE inhibited 3-MC-induced CYP1A1 activity, mRNA expression, protein level, and promoter activity. CAPE treatment also decreased 3-MC-inducible xenobiotic-response element (XRE)-linked luciferase, aryl hydrocarbons receptor (AhR) transactivation and nuclear localization. CAPE induced hypoxia inducible factor-1α (HIF-1α) protein level and HIF-1α responsible element (HRE) transcriptional activity. CAPE-mediated HIF-1α reduced 3-MC-inducible CYP1A1 protein expression. Taken together, CAPE decreases 3-MC-mediated CYP1A1 expression, and this inhibitory response is associated with inhibition of AhR and HIF-1α induction. - Highlights: • CAPE reduced the formation of the benzo[a]pyrene-DNA adduct. • CAPE inhibited 3-MC-induced CYP1A1 expression. • CAPE induced HIF-1α induction. • CAPE-mediated HIF-1α reduced 3-MC-inducible CYP1A1 expression.

  4. A search for W± H → μvb$\\bar{b}$ production at the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Anastasoaie, Carmen Miruna [Radboud Univ. Nijmegen (Netherlands)

    2008-02-06

    All known experimental results on fundamental particles and their interactions can be described to great accuracy by a theory called the Standard Model. In the Standard Model of particle physics, the masses of particles are explained through the Higgs mechanism. The Higgs boson is the only Standard Model particle not discovered yet, and its observation or exclusion is an important test of the Standard Model. While the Standard Model predicts that a Higgs boson should exist, it does not exactly predict its mass. Direct searches have excluded a Higgs with mH < 114.4 GeV at 95% confidence level, while indirect measurements indicate that the mass should be less than 144 GeV. This analysis looks for W±H → μvμb$\\bar{b}$ in 1 fb-1 of data collected with the D0 detector in p$\\bar{p}$ collisions with √s = 1.96 TeV. The analysis strategy relies on the tracking, calorimetry and muon reconstruction of the D0 experiment. The signature is a muon, missing transverse energy (ET) to account for the neutrino and two b-jets. The Higgs mass is reconstructed using the invariant mass of the two jets. Backgrounds are W±b$\\bar{b}$, W± c$\\bar{c}$, W± + light jets (W±jj) (and the corresponding backgrounds with a Z boson), t$\\bar{t}$, single top production, and QCD multijet background.

  5. Can T1 w/T2 w ratio be used as a myelin-specific measure in subcortical structures? Comparisons between FSE-based T1 w/T2 w ratios, GRASE-based T1 w/T2 w ratios and multi-echo GRASE-based myelin water fractions.

    Science.gov (United States)

    Uddin, Md Nasir; Figley, Teresa D; Marrie, Ruth Ann; Figley, Chase R

    2018-03-01

    Given the growing popularity of T 1 -weighted/T 2 -weighted (T 1 w/T 2 w) ratio measurements, the objective of the current study was to evaluate the concordance between T 1 w/T 2 w ratios obtained using conventional fast spin echo (FSE) versus combined gradient and spin echo (GRASE) sequences for T 2 w image acquisition, and to compare the resulting T 1 w/T 2 w ratios with histologically validated myelin water fraction (MWF) measurements in several subcortical brain structures. In order to compare these measurements across a relatively wide range of myelin concentrations, whole-brain T 1 w magnetization prepared rapid acquisition gradient echo (MPRAGE), T 2 w FSE and three-dimensional multi-echo GRASE data were acquired from 10 participants with multiple sclerosis at 3 T. Then, after high-dimensional, non-linear warping, region of interest (ROI) analyses were performed to compare T 1 w/T 2 w ratios and MWF estimates (across participants and brain regions) in 11 bilateral white matter (WM) and four bilateral subcortical grey matter (SGM) structures extracted from the JHU_MNI_SS 'Eve' atlas. Although the GRASE sequence systematically underestimated T 1 w/T 2 w values compared to the FSE sequence (revealed by Bland-Altman and mountain plots), linear regressions across participants and ROIs revealed consistently high correlations between the two methods (r 2 = 0.62 for all ROIs, r 2 = 0.62 for WM structures and r 2 = 0.73 for SGM structures). However, correlations between either FSE-based or GRASE-based T 1 w/T 2 w ratios and MWFs were extremely low in WM structures (FSE-based, r 2 = 0.000020; GRASE-based, r 2 = 0.0014), low across all ROIs (FSE-based, r 2 = 0.053; GRASE-based, r 2 = 0.029) and moderate in SGM structures (FSE-based, r 2 = 0.20; GRASE-based, r 2 = 0.17). Overall, our findings indicated a high degree of correlation (but not equivalence) between FSE-based and GRASE-based T 1 w/T 2 w ratios, and low correlations between T 1 w/T 2 w ratios and MWFs. This

  6. Language: Functionalism versus Authenticity | McGuire | Indo-Pacific ...

    African Journals Online (AJOL)

    While the syntactic and grammatical perspective, which predominates in the educational context, presents language as an institutionalized, authoritarian and self-contained system, Saussurean linguistics provides a view of language as a complex, self-contained, technical system, as such reflecting the nature of modern ...

  7. Exploring the engineering limit of heat flux of a W/RAFM divertor target for fusion reactors

    Science.gov (United States)

    Mao, X.; Fursdon, M.; Chang, X. B.; Zhang, J. W.; Liu, P.; Ellwood, G.; Qian, X. Y.; Qin, S. J.; Peng, X. B.; Barrett, T. R.; Liu, P.

    2018-06-01

    The design and development of a fusion reactor divertor plasma facing component (PFC) is one of the many challenging issues on the road to commercial use of fusion energy. The divertor PFC is expected to exhaust steady state heat loads in the region of 10 MW m‑2 while keeping temperatures and thermo-mechanical stresses in its structure within the allowable limits. For ITER (International Thermo-Nuclear Experimental Reactor) a water cooled W/CuCrZr divertor PFC concept has been developed. However, this concept is not necessarily assured for use in future fusion reactors mainly because the neutron radiation dose would be at least an order magnitude higher, resulting in limited thermo-mechanical performance and considerably more activated waste products. In the present study, a water cooled divertor PFC using reduced activation ferritic-martensitic (RAFM) steel as the heat sink pipe has been designed with pressurised water reactor-like cooling conditions (pressure of 15.5 MPa, velocity of 10–20 m s‑1 and temperature of 300 °C). The PFC is made up of a number of rectangular tungsten tiles, each with an inner circular hole (so-called monoblocks), joined onto a RAFM steel pipe with copper interlayers. The thermo-mechanical performance of the PFC has been studied in detail. The heat transfer coefficient between the RAFM pipe inner surface and the water was calculated using published correlations. Geometric parameters and water velocity were optimized with finite element (FE) thermal analysis, to achieve acceptable temperatures in the structure given the target exhaust heat load of 10 MW m‑2. Under this heat load and the optimised thermal design parameters, the structure of the PFC was further assessed by mechanical analysis. We find that under these conditions the RAFM steel pipe experiences cyclic plasticity, and fails the common linear elastic ratchetting (3 Sm) rule. Nevertheless, the designed W/RAFM divertor PFU can withstand 10 MW m‑2 heat load, albeit

  8. Monte Carlo-based validation of the ENDF/MC2-II/SDX cell homogenization path

    International Nuclear Information System (INIS)

    Wade, D.C.

    1979-04-01

    The results are presented of a program of validation of the unit cell homogenization prescriptions and codes used for the analysis of Zero Power Reactor (ZPR) fast breeder reactor critical experiments. The ZPR drawer loading patterns comprise both plate type and pin-calandria type unit cells. A prescription is used to convert the three dimensional physical geometry of the drawer loadings into one dimensional calculational models. The ETOE-II/MC 2 -II/SDX code sequence is used to transform ENDF/B basic nuclear data into unit cell average broad group cross sections based on the 1D models. Cell average, broad group anisotropic diffusion coefficients are generated using the methods of Benoist or of Gelbard. The resulting broad (approx. 10 to 30) group parameters are used in multigroup diffusion and S/sub n/ transport calculations of full core XY or RZ models which employ smeared atom densities to represent the contents of the unit cells

  9. Monte Carlo; based validation of the ENDF/MC2-II/SDX cell homogenization path

    International Nuclear Information System (INIS)

    Wade, D.C.

    1978-11-01

    The results are summarized of a program of validation of the unit cell homogenization prescriptions and codes used for the analysis of Zero Power Reactor (ZPR) fast breeder reactor critical experiments. The ZPR drawer loading patterns comprise both plate type and pin-calandria type unit cells. A prescription is used to convert the three dimensional physical geometry of the drawer loadings into one dimensional calculational models. The ETOE-II/MC 2 -II/SDX code sequence is used to transform ENDF/B basic nuclear data into unit cell average broad group cross sections based on the 1D models. Cell average, broad group anisotropic diffusion coefficients are generated using the methods of Benoist or of Gelbard. The resulting broad (approx. 10 to 30) group parameters are used in multigroup diffusion and S/sub n/ transport calculations of full core XY or RZ models which employ smeared atom densities to represent the contents of the unit cells

  10. Measurement and calculation of spatial and energetic neutron flux in the IEA-R1 reactor core

    International Nuclear Information System (INIS)

    Bittelli, U.D.

    1988-01-01

    This work presents spatial and energetic flux distribution measured in the IEA-R1 reactor core. The thermal neutron flux was measured by gold activation foils (bare and covered with cadmium) in the fuel element number 108 (reaction: 197 Au(n,γ) 198 Au) at 451W overall reactor power. The fast neutron flux was measured by indium activation foils (reaction: 115 In(n,n') 115m In) in the fuel elements number 94 at 4510W overall reactor power. The neutron energy spectrum was adjusted by SAND II code with the data produced by the irradiation of seven activation detectors in the fuel element number 94 at 4510 W overall reactor power. The following reactions were used: 58 Fe(n,γ) 59 Fe, 232 Th(n,γ) 233 Th, 197 Au(n,γ) 198 Au, 59 Co(n,γ) 60 Co, 54 Fe(n,p) 54 Mn, 24 Mg(n,p) 24 Na, 47 Ti(n,p) 47 Sc, 48 Ti(n,p) 48 Sc and 115 In(n,n') 115m In. The experimental results compared to those obtained by CITATION (spatial distribution flux) and HAMMER (energetic distribution flux) code, showed good agreement. The results presented in this work are a good contribution for a better knowledge of spatial and energetic neutron flux distribution in the IEA-R1 reactor core, besides that the experimental procedure is easily applicable to another situations. (autor) [pt

  11. Refurbishment of Pakistan research reactor (PARR-1) for stainless steel lining of the reactor pool

    International Nuclear Information System (INIS)

    Salahuddin, A.; Israr, M.; Hussain, M.

    2002-01-01

    Pakistan Research Reactor-1 (PARR-1) is a pool-type research reactor. Reactor aging has resulted in the increase of water seepage from the concrete walls of the reactor pool. To stop the seepage, it was decided to augment the existing pool walls with an inner lining of stainless steel. This could be achieved only if the pool walls could be accessed unhindered and without excessive radiation doses. For this purpose a partial decommissioning was done by removing all active core components including standard/control fuel elements, reflector elements, beam tubes, thermal shield, core support structure, grid plate and the pool's ceramic tiles, etc. An overall decommissioning program was devised which included procedures specific to each item. This led to the development of a fuel transport cask for transportation, and an interim fuel storage bay for temporary storage of fuel elements (until final disposal). The safety of workers and the environment was ensured by the use of specially designed remote handling tools, appropriate shielding and pre-planned exposure reduction procedures based on the ALARA principle. During the implementation of this program, liquid and solid wastes generated were legally disposed of. It is felt that the experience gained during the refurbishment of PARR-1 to install the stainless steel liner will prove useful and better planning and execution for the future decommissioning of PARR-1, in particular, and for other research reactors like PARR-2 (27 kW MNSR), in general. Furthermore, due to the worldwide activities on decommissioning, especially those communicated through the IAEA CRP on 'Decommissioning Techniques for Research Reactors', the importance of early planning has been well recognized. This has made possible the implementation of some early steps like better record keeping, rehiring of trained manpower, and creation of interim and final waste storage. (author)

  12. Development of melanoma-targeted polymer micelles by conjugation of a melanocortin 1 receptor (MC1R) specific ligand.

    Science.gov (United States)

    Barkey, Natalie M; Tafreshi, Narges K; Josan, Jatinder S; De Silva, Channa R; Sill, Kevin N; Hruby, Victor J; Gillies, Robert J; Morse, David L; Vagner, Josef

    2011-12-08

    The incidence of malignant melanoma is rising faster than that of any other cancer in the United States. Because of its high expression on the surface of melanomas, MC1R has been investigated as a target for selective imaging and therapeutic agents against melanoma. Eight ligands were screened against cell lines engineered to overexpress MC1R, MC4R, or MC5R. Of these, compound 1 (4-phenylbutyryl-His-dPhe-Arg-Trp-NH(2)) exhibited high (0.2 nM) binding affinity for MC1R and low (high nanomolar) affinities for MC4R and MC5R. Functionalization of the ligand at the C-terminus with an alkyne for use in Cu-catalyzed click chemistry was shown not to affect the binding affinity. Finally, formation of the targeted polymer, as well as the targeted micelle formulation, also resulted in constructs with low nanomolar binding affinity.

  13. Nuclear Regulatory Commission Issuances, August 1981

    International Nuclear Information System (INIS)

    1981-01-01

    Contents include: Issuances of the Nuclear Regulatory Commission--Metropolitan Edison Company (Three Mile Island Nuclear Station, Unit No. 1), Metropolitan Edison Company, et al. (Three Mile Island Nuclear Station, Unit 1), Westinghouse Electric Corp. (Export of LEU to the Philippines); Issuances of Atomic Safety and Licensing Appeal Boards--Duke Power Company (Amendment to Materials License SNM-1773--Transportation of Spent Fuel from Oconee Nuclear Station for Storage at McGuire Nuclear Station); Issuances of the Atomic Safety Licensing Boards--Commonwealth Edison Company (Byron Station, Units 1 and 2), Dairyland Power Cooperative (La Crosse Boiling Water Reactor, Operating License and Show Cause), Florida Power and Light Company (St. Lucie Plant, Unit No. 2), Florida Power and Light Company (Turkey Point Nuclear Generating, Units 3 and 4), Metropolitan Edison Company (Three Mile Island Nuclear Station, Unit 1) Pacific Gas and Electric Company (Diablo Canyon Nuclear Power Plant, Units 1 and 2), The Regents of the University of California (UCLA Research Reactor), The Toledo Edison Company, et al. (Davis-Besse Nuclear Power Station, Units 2 and 3: Terminiation of Proceedings); Issuances of the Directors Denial--Florida Power and Light Company

  14. Reactor as furnace and reactor as lamp

    International Nuclear Information System (INIS)

    Goldanskii, V.I.

    1992-01-01

    There are presented general characteristics of the following ways of transforming of nuclear energy released in reactors into chemical : ordinary way (i.e. trough the heat, mechanical energy and electricity); chemonuclear synthesis ; use of high-temperature fuel elements (reactor as furnace); use of the mixed nγ-radiation of reactors; use of the radiation loops; radiation - photochemical synthesis (reactor as lamp). Advantage and disadvantages of all above variants are compared. The yield of the primary product of fixation of nitrogen (nitric oxide NO) in reactor with the high-temperature (above ca. 1900degC) fuel elements (reactor-furnace) can exceed W ∼ 200 kg per gram of burned uranium. For the latter variant (reactor-lamp) the yield of chemical products can reach W ∼ 60 kg. per gram of uranium. Such values of W are close to or even strongly exceed the yields of chemical products for other abovementioned variants and - what is particularly important - are not connected to the necessity of archscrupulous removal of radioactive contamination of products. (author)

  15. A study of reactor neutrino monitoring at the experimental fast reactor JOYO

    International Nuclear Information System (INIS)

    Furuta, H.; Fukuda, Y.; Hara, T.; Haruna, T.; Ishihara, N.; Ishitsuka, M.; Ito, C.; Katsumata, M.; Kawasaki, T.; Konno, T.; Kuze, M.; Maeda, J.; Matsubara, T.; Miyata, H.; Nagasaka, Y.; Nitta, K.; Sakamoto, Y.; Suekane, F.; Sumiyoshi, T.; Tabata, H.

    2012-01-01

    We carried out a study of neutrino detection at the experimental fast reactor JOYO using a 0.76 tons gadolinium loaded liquid scintillator detector. The detector was set up on the ground level at 24.3 m from the JOYO reactor core of 140 MW thermal power. The measured neutrino event rate from reactor on-off comparison was 1.11±1.24(stat.)±0.46(syst.) events/day. Although the statistical significance of the measurement was not enough, backgrounds in such a compact detector at the ground level were studied in detail and MC simulations were found to describe the data well. A study for improvement of the detector for future such experiments is also shown.

  16. Dynamic multi-coil tailored excitation for transmit B1 correction at 7 Tesla.

    Science.gov (United States)

    Umesh Rudrapatna, S; Juchem, Christoph; Nixon, Terence W; de Graaf, Robin A

    2016-07-01

    Tailored excitation (TEx) based on interspersing multiple radio frequency pulses with linear gradient and higher-order shim pulses can be used to obtain uniform flip angle in the presence of large radio frequency transmission (B 1+) inhomogeneity. Here, an implementation of dynamic, multislice tailored excitation using the recently developed multi-coil nonlinear shim hardware (MC-DTEx) is reported. MC-DTEx was developed and tested both in a phantom and in vivo at 7 T, and its efficacy was quantitatively assessed. Predicted outcomes of MC-DTEx and DTEx based on spherical harmonic shims (SH-DTEx) were also compared. For a planned 30 ° flip angle, in a phantom, the standard deviation in excitation improved from 28% (regular excitation) to 12% with MC-DTEx. The SD in in vivo excitation improved from 22 to 12%. The improvements achieved with experimental MC-DTEx closely matched the theoretical predictions. Simulations further showed that MC-DTEx outperforms SH-DTEx for both scenarios. Successful implementation of multislice MC-DTEx is presented and is shown to be capable of homogenizing excitation over more than twofold B 1+ variations. Its benefits over SH-DTEx are also demonstrated. A distinct advantage of MC hardware over SH shim hardware is the absence of significant eddy current effects, which allows for a straightforward, multislice implementation of MC-DTEx. Magn Reson Med 76:83-93, 2016. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  17. Verification of MC{sup 2}-3 Doppler Sample Models in ZPPR-15 D Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Min Jae; Hartanto, Donny; Kim, Sang Ji [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    In this paper, the change of reaction rate and broadened cross section were estimated by as-built MCNP models for metallic uranium sample in ZPPR-15D using ENDF/B-VII.0 library, and the results were compared with deterministic calculations provided in previous work. The Doppler broadening is an instant feedback mechanism that improves safety and stability for both thermal and fast reactors. Therefore, the accuracy of Doppler coefficient becomes an important parameter in reactor design as well as in the safety analysis. The capability of the Doppler worth calculation by a modern computer code suites such as MC2-3 and DIF3DVARIANT, has been validated against the Zero Power Physics Reactor-15 (ZPPR-15) Doppler worth measurement experiments. For the same experiments, our previous work suggested four different MC2-3 Doppler sample models for enhanced accuracy, which are combinations of heterogeneous models and the super cell approach. The MOC and MOC-SPC models showed the smallest error in estimating the U-238 total cross section of Doppler sample N-11, and the Doppler broadening effects are well applied to the cross section compared to other two models, HOM and SPC. The effects of the super cell approach can be hardly seen, since the broadened cross section is almost the same with and without the super cell approach. Comparing the transition of reaction density, MOC and MOC-SPC models also show similar behavior as MCNP's with minor errors. As a conclusion, we could obtain more consistent broadened cross section as well as reaction density transition by providing heterogeneous models from MC2-3's MOC module.

  18. Boosted W/Z Tagging at ATLAS

    CERN Document Server

    Dattagupta, Aparajita; The ATLAS collaboration

    2016-01-01

    A detailed study of the techniques for identifying boosted hadronically decaying W or Z bosons is presented. The best performing algorithm for reconstructing, grooming and tagging bosonic jets as seen in studies using 8 TeV data and simulation is validated for W bosons with a wide range of transverse momenta using 13 TeV data and MC simulations. The same is studied for Z bosons in 13 TeV MC simulation. Improvement in tagger performance using detector tracking information is also studied. In addition, given that a hadronic jet has been identified as resulting from the hadronic decay of a W or Z, a technique is developed to discriminate between W and Z bosons using 8 TeV data. The alternative of using variable-R jets for capturing the hadronic decay products compared to standard techniques is also discussed.

  19. Isolation and Characterization of Plantaricin Produced by Lactobacillus plantarum Strains (IIA-1A5, IIA-1B1, IIA-2B2

    Directory of Open Access Journals (Sweden)

    I. I. Arief

    2013-08-01

    Full Text Available Bacteriocins produced by Indonesian lactic acid bacteria Lactobacillus plantarum IIA-1A5, IIA-1B1, IIA-2B2 were purified and characterized. Plantaricin W gene had been successfully amplified from all strains. This amplicon showed the expected 200 bp size of plantaricin W gene. This bacteriocins purified from L. plantarum IIA-1A5, IIA-1B1, and IIA-2B2 were named plantaricin IIA-1A5, IIA-1B1, and IIA-2B2. Purification by cation exchange chromatography increased the purity (fold and activity of plantaricins. Purity of plantaricin IIA-1A5 was increased by 3.13 fold with specific activity 13.40 AU/mg. Plantaricin IIA-1B1 had 2.98 fold purity with specific activity 5.12 AU/mg, while purity of plantaricin IIA-2B2 was 1.37 fold with specific activity 7.70 AU/mg. All plantaricins could inhibit the growth of pathogenic bacteria, such as Escherichia coli, Salmonella typhimurium, Bacillus cereus, and Staphylococcus aureus. Plantaricins could be digested by trypsin. Stability of plantaricins at 80 oC for 30 min and at 121 oC for 15 min were affected by type of plantaricin and species of pathogenic bacteria. Generally, plantaricin IIA-1A5 was better as antimicrobial agent than plantaricin IIA-1B1 and plantaricin IIA-2B2.

  20. Global Combat Support System-Marine Corps Logistics Chain Management Increment 1 (GCSS-MC LCM Inc 1)

    Science.gov (United States)

    2016-03-01

    Global Combat Support System – Marine Corps (GCSS-MC) is a portfolio of systems that supports logistics elements of command and control, joint...future Marine Corps logistics systems modernization . GCSS-MC/LCM Increment 1 Capability Release 1 (hereinafter Release 1.1) is the baseline

  1. Status of prompt gamma neutron activation analysis (PGAA) at TRR-1/M1 (Thai Research Reactor-1/Modified 1)

    Energy Technology Data Exchange (ETDEWEB)

    Asvavijnijkulchai, Chanchai; Dharmavanij, Wanchai; Siangsanan, Pariwat; Ratanathongchai, Wichian; Chongkum, Somporn [Physics Division, Office of Atomic Energy for Peace, Vibhavadi Rangsit Road, Chatuchak, Bangkok (Thailand)

    1999-08-01

    The first prompt gamma activation analysis (PGAA) was designed, constructed and installed at a 6 inch diameter neutron beam port of the Thai Research Reactor-1/Modified 1 (TRR-1/M1) since 1989. Beam characteristic were made by Gd foil irradiation, X-ray film exposing and densitometry scanning consequently. The thermal neutron flux at sample position was measured by Au foil activation, and was about 1 x 10{sup 7} n.cm{sup 2}.sec{sup -1} at 700 kW operating power. The experiments have been conducted successfully. In 1998, the PGAA facility has been developed for the reactor operating power at 1.2 MW. The new PGAA system, e.g., beam shutter, gamma collimator and biological shields have been designed to reduce the leakage of neutrons and gamma radiation to the acceptance levels in accordance with the International Commission on Radiation Protection Publication 60 (ICRP 60). The construction and installation will be completed in April 1999. (author)

  2. Status of prompt gamma neutron activation analysis (PGAA) at TRR-1/M1 (Thai Research Reactor-1/Modified 1)

    International Nuclear Information System (INIS)

    Asvavijnijkulchai, Chanchai; Dharmavanij, Wanchai; Siangsanan, Pariwat; Ratanathongchai, Wichian; Chongkum, Somporn

    1999-01-01

    The first prompt gamma activation analysis (PGAA) was designed, constructed and installed at a 6 inch diameter neutron beam port of the Thai Research Reactor-1/Modified 1 (TRR-1/M1) since 1989. Beam characteristic were made by Gd foil irradiation, X-ray film exposing and densitometry scanning consequently. The thermal neutron flux at sample position was measured by Au foil activation, and was about 1 x 10 7 n.cm 2 .sec -1 at 700 kW operating power. The experiments have been conducted successfully. In 1998, the PGAA facility has been developed for the reactor operating power at 1.2 MW. The new PGAA system, e.g., beam shutter, gamma collimator and biological shields have been designed to reduce the leakage of neutrons and gamma radiation to the acceptance levels in accordance with the International Commission on Radiation Protection Publication 60 (ICRP 60). The construction and installation will be completed in April 1999. (author)

  3. Enhanced catalytic activity of the nanostructured Co-W-B film catalysts for hydrogen evolution from the hydrolysis of ammonia borane.

    Science.gov (United States)

    Li, Chao; Wang, Dan; Wang, Yan; Li, Guode; Hu, Guijuan; Wu, Shiwei; Cao, Zhongqiu; Zhang, Ke

    2018-08-15

    In this work, nanostructured Co-W-B films are successfully synthesized on the foam sponge by electroless plating method and employed as the catalysts with enhanced catalytic activity towards hydrogen evolution from the hydrolysis of ammonia borane (NH 3 BH 3 , AB) at room temperature. The particle size of the as-prepared Co-W-B film catalysts is varied by adjusting the depositional pH value to identify the most suitable particle size for hydrogen evolution of AB hydrolysis. The Co-W-B film catalyst with the particle size of about 67.3 nm shows the highest catalytic activity and can reach a hydrogen generation rate of 3327.7 mL min -1 g cat -1 at 298 K. The activation energy of the hydrolysis reaction of AB is determined to be 32.2 kJ mol -1 . Remarkably, the as-obtained Co-W-B film is also a reusable catalyst preserving 78.4% of their initial catalytic activity even after 5 cycles in hydrolysis of AB at room temperature. Thus, the enhanced catalytic activity illustrates that the Co-W-B film is a promising catalyst for AB hydrolytic dehydrogenation in fuel cells and the related fields. Copyright © 2018 Elsevier Inc. All rights reserved.

  4. Microcystin-LR Induces Apoptosis via NF-κB /iNOS Pathway in INS-1 Cells

    Directory of Open Access Journals (Sweden)

    Kai Shen

    2011-07-01

    Full Text Available Cyanobacterial toxins, especially the microcystins, are found in eutrophied waters throughout the world, and their potential to impact on human and animal health is a cause for concern. Microcystin-LR (MC-LR is one of the common toxic microcystin congeners and occurs frequently in diverse water systems. Recent work suggested that apoptosis plays a major role in the toxic effects induced by MC-LR in hepatocytes. However, the roles of MC-LR in pancreatic beta cells have not been fully established. The aim of the present study was to assess possible in vitro effects of MC-LR on cell apoptosis in the rat insulinoma cell line, INS-1. Our results demonstrated that MC-LR promoted selectively activation of NF-κB (increasing nuclear p50/p65 translocation and increased the mRNA and protein levels of induced nitric oxide synthase (iNOS. The chronic treatment with MC-LR stimulated nitric oxide (NO production derived from iNOS and induced apoptosis in a dose dependent manner in INS-1 cells. Meanwhile, this effect was inhibited by the NF-κB inhibitor PDTC, which reversed the apoptosis induced by MC-LR. Our observations indicate that MC-LR induced cell apoptosis via an iNOS-dependent pathway. A well-known nuclear transcription factor, NF-κB, is activated and mediates intracellular nitric oxide synthesis. We suggest that the apoptosis induced by chronic MC-LR in vivo presents a possible cause of β-cell dysfunction, as a key environmental factor in the development of diabetes mellitus.

  5. Activity report of Reactor Physics Division : 1990

    International Nuclear Information System (INIS)

    Mohanakrishnan, P.

    1991-01-01

    The major Research and Development and Project activities carried out during the year 1990 in Reactor Physics Division are presented in the form of summaries in this report. The various activities are organised under the following areas : (1) Nuclear Data Evaluation, Processing and Validation, (2) Core Physics and Analysis, (3) Reactor Kinetics and Safety Analysis, (4) Noise Analysis, and (5) Radiation Transport and Shielding. FBTR was restarted in July 1990 and the power was raised upto 500 kW. A number of low power physics experiments on reactivity coefficients, kinetics and noise, neutron flux and gamma dose in B cells, were performed, which are discussed in this report. (author). figs., tabs

  6. Substitution of the transmembrane domain of Vpu in simian-human immunodeficiency virus (SHIVKU1bMC33) with that of M2 of influenza A results in a virus that is sensitive to inhibitors of the M2 ion channel and is pathogenic for pig-tailed macaques

    International Nuclear Information System (INIS)

    Hout, David R.; Gomez, Melissa L.; Pacyniak, Erik; Gomez, Lisa M.; Fegley, Barbara; Mulcahy, Ellyn R.; Hill, M. Sarah; Culley, Nathan; Pinson, David M.; Nothnick, Warren; Powers, Michael F.; Wong, Scott W.; Stephens, Edward B.

    2006-01-01

    The Vpu protein of human immunodeficiency virus type 1 has been shown to shunt the CD4 receptor molecule to the proteasome for degradation and to enhance virus release from infected cells. The exact mechanism by which the Vpu protein enhances virus release is currently unknown but some investigators have shown that this function is associated with the transmembrane domain and potential ion channel properties. In this study, we determined if the transmembrane domain of Vpu could be functionally substituted with that of the prototypical viroporin, the M2 protein of influenza A virus. We constructed chimeric vpu gene in which the transmembrane domain of Vpu was replaced with that of the M2 protein of influenza. This chimeric vpu gene was substituted for the vpu gene in the genome of a pathogenic simian human immunodeficiency virus, SHIV KU-1bMC33 . The resulting virus, SHIV M2 , synthesized a Vpu protein that had a slightly different M r compared to the parental SHIV KU-1bMC33 , reflecting the different sizes of the two Vpu proteins. The SHIV M2 was shown to replicate with slightly reduced kinetics when compared to the parental SHIV KU-1bMC33 but electron microscopy revealed that the site of maturation was similar to the parental virus SHIV KU1bMC33 . We show that the replication and spread of SHIV M2 could be blocked with the antiviral drug rimantadine, which is known to target the M2 ion channel. Our results indicate a dose dependent inhibition of SHIV M2 with 100 μM rimantadine resulting in a >95% decrease in p27 released into the culture medium. Rimantadine did not affect the replication of the parental SHIV KU-1bMC33 . Examination of SHIV M2 -infected cells treated with 50 μM rimantadine revealed numerous viral particles associated with the cell plasma membrane and within intracytoplasmic vesicles, which is similar to HIV-1 mutants lacking a functional vpu. To determine if SHIV M2 was as pathogenic as the parental SHIV KU-1bMC33 virus, two pig-tailed macaques

  7. Regiospecific Synthesis of Ring A Fused Withaferin A Isoxazoline Analogues: Induction of Premature Senescence by W-2b in Proliferating Cancer Cells.

    Science.gov (United States)

    Rasool, Faheem; Nayak, Debasis; Katoch, Archana; Faheem, Mir Mohd; Yousuf, Syed Khalid; Hussain, Nazar; Belawal, Chetan; Satti, N K; Goswami, Anindya; Mukherjee, Debaraj

    2017-10-23

    Induction of premature senescence represents a novel functional strategy to curb the uncontrolled proliferation of malignant cancer cells. This study unveils the regiospecific synthesis of novel isoxazoline derivatives condensed to ring A of medicinal plant product Withaferin-A. Intriguingly, the cis fused products with β-oriented hydrogen exhibited excellent cytotoxic activities against proliferating human breast cancer MCF7 and colorectal cancer HCT-116 cells. The most potent derivative W-2b triggered premature senescence along with increase in senescence-associated β-galactosidase activity, G2/M cell cycle arrest, and induction of senescence-specific marker p21 Waf1/Cip1 at its sub-toxic concentration. W-2b conferred a robust increase in phosphorylation of mammalian checkpoint kinase-2 (Chk2) in cancer cells in a dose-dependent manner. Silencing of endogenous Chk2 by siRNA divulged that the amplification of p21 expression and senescence by W-2b was Chk2-dependent. Chk2 activation (either by ectopic overexpression or through treatment with W-2b) suppressed NM23-H1 signaling axis involved in cancer cell proliferation. Finally, W-2b showed excellent in vivo efficacy with 83.8% inhibition of tumor growth at a dose of 25 mg/kg, b.w. in mouse mammary carcinoma model. Our study claims that W-2b could be a potential candidate to limit aberrant cellular proliferation rendering promising improvement in the treatment regime in cancer patients.

  8. Critical role of neuropeptides B/W receptor 1 signaling in social behavior and fear memory.

    Directory of Open Access Journals (Sweden)

    Ruby Nagata-Kuroiwa

    Full Text Available Neuropeptide B/W receptor 1 (NPBWR1 is a G-protein coupled receptor, which was initially reported as an orphan receptor, and whose ligands were identified by this and other groups in 2002 and 2003. To examine the physiological roles of NPBWR1, we examined phenotype of Npbwr1⁻/⁻ mice. When presented with an intruder mouse, Npbwr1⁻/⁻ mice showed impulsive contact with the strange mice, produced more intense approaches toward them, and had longer contact and chasing time along with greater and sustained elevation of heart rate and blood pressure compared to wild type mice. Npbwr1⁻/⁻ mice also showed increased autonomic and neuroendocrine responses to physical stress, suggesting that impairment of NPBWR1 leads to stress vulnerability. We also observed that these mice show abnormality in the contextual fear conditioning test. These data suggest that NPBWR1 plays a critical role in limbic system function and stress responses. Histological and electrophysiological studies showed that NPBWR1 acts as an inhibitory regulator on a subpopulation of GABAergic neurons in the lateral division of the CeA and terminates stress responses. These findings suggest important roles of NPBWR1 in regulating amygdala function during physical and social stress.

  9. Missense and nonsense mutations in melanocortin 1 receptor (MC1R gene of different goat breeds: association with red and black coat colour phenotypes but with unexpected evidences

    Directory of Open Access Journals (Sweden)

    Davoli Roberta

    2009-08-01

    Full Text Available Abstract Background Agouti and Extension loci control the relative amount of eumelanin and pheomelanin production in melanocytes that, in turn, affects pigmentation of skin and hair. The Extension locus encodes the melanocortin 1 receptor (MC1R whose permanent activation, caused by functional mutations, results in black coat colour, whereas other inactivating mutations cause red coat colour in different mammals. Results The whole coding region of the MC1R gene was sequenced in goats of six different breeds showing different coat colours (Girgentana, white cream with usually small red spots in the face; Maltese, white with black cheeks and ears; Derivata di Siria, solid red; Murciano-Granadina, solid black or solid brown; Camosciata delle Alpi, brown with black stripes; Saanen, white; F1 goats and the parental animals. Five single nucleotide polymorphisms (SNPs were identified: one nonsense mutation (p.Q225X, three missense mutations (p.A81V, p.F250V, and p.C267W, and one silent mutation. The stop codon at position 225 should cause the production of a shorter MC1R protein whose functionality may be altered. These SNPs were investigated in a larger sample of animals belonging to the six breeds. The Girgentana breed was almost fixed for the p.225X allele. However, there was not complete association between the presence of red spots in the face and the presence of this allele in homozygous condition. The same allele was identified in the Derivata di Siria breed. However, its frequency was only 33%, despite the fact that these animals are completely red. The p.267W allele was present in all Murciano-Granadina black goats, whereas it was never identified in the brown ones. Moreover, the same substitution was present in almost all Maltese goats providing evidence of association between this mutation and black coat colour. Conclusion According to the results obtained in the investigated goat breeds, MC1R mutations may determine eumelanic and pheomelanic

  10. Application of UPTF data for modeling liquid draindown in the downcomer region of a PWR using RELAP5/MOD2-B&W

    Energy Technology Data Exchange (ETDEWEB)

    Wissinger, G.; Klingenfus, J. [B & W Nuclear Technologies, Lynchburg, VA (United States)

    1995-09-01

    B&W Nuclear Technologies (BWNT) currently uses an evaluation model that analyzes large break loss-of-coolant accidents in pressurized water reactors using several computer codes. These codes separately calculate the system performance during the blowdown, refill, and reflooding phases of the transient. Multiple codes are used, in part, because a single code has been unable to effectively model the transition from blowdown to reflood, particularly in the downcomer region where high steam velocities do not allow the injected emergency core cooling (ECC) liquid to penetrate and begin to refill the vessel lower plenum until after the end of blowdown. BWNT is developing a method using the RELAP5/MOD2-B&W computer code that can correctly predict the liquid draindown behavior in the downcomer during the late blowdown and refill phases. Benchmarks of this method have been performed against Upper Plenum Test Facility (UPTF) data for ECC liquid penetration and valves using both cold leg and downcomer ECC injection. The use of this new method in plant applications should result in the calculation of a shorter refill period, leading to lower peak clad temperature predictions and increased core peaking. This paper identifies changes made to the RELAP/MOD2-B&W code to improve its predictive capabilities with respect to the data obtained in the UPTF tests.

  11. Extensive utilization of training reactor VR-1

    International Nuclear Information System (INIS)

    Matejka, Karel; Sklenka, Lubomir

    2003-01-01

    Full text: The training reactor VR-1 Vrabec ('Sparrow'), operated at the Faculty of Nuclear Sciences and Physical Engineering, Czech Technical University in Prague, was started up on December 3, 1990. Particularly, it is designed and operated for training of students from Czech universities, preparing of experts for the Czech nuclear programme, as well as for certain research and development work, and for information programmes in the sphere of non-military nuclear energy use (public relation). The VR-1 training reactor is a pool-type light-water reactor based on enriched uranium with maximum thermal power 1kWth and short time period up to 5kW th . The moderator of neutrons is light demineralized water (H 2 O) that is also used as a reflector, a biological shielding, and a coolant. Heat is removed from the core with natural convection. The reactor core contains 14 to 18 fuel assemblies IRT-3M, depending on the geometric arrangement and kind of experiments to be performed in the reactor. The core is accommodated in a cylindrical stainless steel vessel - pool, which is filled with water. UR-70 control rods serve the reactor control and safe shutdown. Training of the VR-1 reactor provides students with experience in reactor and neutron physics, dosimetry, nuclear safety, and nuclear installation operation. Students from technical universities and from natural sciences universities come to the reactor for training. Approximately 200 university students are introduced to the reactor (lectures, experiments, experimental and diploma works, etc.) every year. About 12 different faculties from Czech universities use the reactor. International co-operation with European universities in Germany, Hungary, Austria, Slovakia, Holland and UK is frequent. Practical Course on Reactor Physics in Framework of European Nuclear Engineering Network has been newly introduced. Currently, students can try out more than 20 experimental exercises. Further training courses have been included

  12. Associated production of $H(b\\bar b, c\\bar c)$ with a W or a Z in ATLAS

    CERN Document Server

    Nielsen, Jason; The ATLAS collaboration

    2018-01-01

    Results are presented from the ATLAS searches for Standard Model Higgs bosons decaying to a $b\\bar b$ or $c\\bar c$ pair, produced in association with a $W$ or $Z$ boson. The analyzed data correspond to $36.1\\,\\text{fb}^{-1}$ of $13\\,\\text{TeV}$ proton-proton collision data collected in Run 2 of the Large Hadron Collider. The combination of Run 1 and Run 2 data in the $b\\bar b$ channel yields a ratio of the measured production rate to the SM prediction equal to $0.90 \\pm 0.18\\ \\text{(stat.)}^{+0.21}_{-0.19}\\ \\text{(syst.)}$. The observed significance of $3.6\\sigma$ provides evidence for the direct $Hbb$ Yukawa coupling. A similar search for $c\\bar c$ decays results in an upper limit on the production cross section times branching ratio of $2.7\\,\\text{pb}$.

  13. Transient response of Babcock and Wilcox-designed reactors

    International Nuclear Information System (INIS)

    1980-05-01

    On February 26, 1980, the Crystal River Unit No. 3 Nuclear Generating Plant, designed by the Babcock and Wilcox Company (B and W), experienced an incident involving a malfunction in an instrumentation and control system power supply. Faced with the Crystal River Unit 3 incident and the apparently high frequency of such near similar types of transients in other B and W designed plants, a special Task Force was established within the Office of Nuclear Reactor Regulation to provide an assessment of the apparent sensitivity of the B and W designed plants to such transients and the consequences of malfunctions and failures of the integrated control system and non-nuclear instrumentation. This report provides an assessment of these issues

  14. Measured and calculated effective delayed neutron fraction of the IPR-R1 Triga reactor

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Rose Mary G.P.; Dalle, Hugo M.; Campolina, Daniel A.M., E-mail: souzarm@cdtn.b, E-mail: dallehm@cdtn.b, E-mail: campolina@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2011-07-01

    The effective delayed neutron fraction, {beta}{sub eff}, one of the most important parameter in reactor kinetics, was measured for the 100 kW IPR-R1 TRIGA Mark I research reactor, located at the Nuclear Technology Development Center - CDTN, Belo Horizonte, Brazil. The current reactor core has 63 fuel elements, containing about 8.5% and 8% by weight of uranium enriched to 20% in U{sup 235}. The core has cylindrical configuration with an annular graphite reflector. Since the first criticality of the reactor in November 1960, the core configuration and the number of fuel elements have been changed several times. At that time, the reactor power was 30 kW, there were 56 fuel elements in the core, and the {beta}{sub eff} value for the reactor recommended by General Atomic (manufacturer of TRIGA) was 790 pcm. The current {beta}{sub eff} parameter was determined from experimental methods based on inhour equation and on the control rod drops. The estimated values obtained were (774 {+-} 38) pcm and (744 {+-} 20) pcm, respectively. The {beta}{sub eff} was calculated by Monte Carlo transport code MCNP5 and it was obtained 747 pcm. The calculated and measured values are in good agreement, and the relative percentage error is -3.6% for the first case, and 0.4% for the second one. (author)

  15. Use of the VR-1 ''Vrabec'' training reactor

    International Nuclear Information System (INIS)

    Matejka, K.; Kolros, A.; Krops, S.; Polach, S.; Sklenka, L.

    1994-01-01

    An overview is presented of the extent and ways of using the VR-1 training reactor, which is operated by the Faculty of Nuclear Science and Physical Engineering, Czech Technical University in Prague. A list and the characteristics of 16 problems developed for teaching purposes is given, and the 14 faculties and 2 research institutes participating in the teaching activities are listed. The reactor is used in the education and training of nuclear scientists and engineers. The instrumentation, experimental, handling and operating tools, as well as documentation and texts relating to the reactor are described. The following examples of the teaching activities are included: a guided visit to the operating reactor site, reactor dynamics study and delayed neutron measurement, training course, and the basic criticality experiment. Nuclear safety aspects (hypothetical accidents, quality control and system qualification demonstration, safety culture) are stressed during the education. The reactor department is involved in international cooperation projects. (J.B.). 3 refs

  16. Associated production of $H(b\\bar b, c \\bar c)$ with a $W$ or a $Z$ Boson in ATLAS

    CERN Document Server

    Nielsen, Jason; The ATLAS collaboration

    2018-01-01

    Results are presented from the ATLAS search for Standard Model Higgs bosons decaying to a $b\\bar b$ or $c \\bar c$ pair, produced in association with $W$ or $Z$ bosons. The analyzed data correspond to 36.1 fb$^{-1}$ of 13 TeV proton-proton collision data collected in Run 2 of the Large Hadron Collider. The combination of Run 1 and Run 2 data in the $b\\bar b$ channel yields a ratio of the measured production rate to the SM prediction equal to $0.90 \\pm 0.18 \\text{(stat.)} ^{+0.21}_{-0.19} \\text{(syst.)}$. The observed significance of $3.6\\sigma$ provides evidence for the direct $Hbb$ Yukawa coupling. A similar search for $c \\bar c$ decays results in an upper limit on the production cross section times branching ratio.

  17. Influence of Al-W-B Recycled Composite Material on the Properties of High Performance Concrete

    Directory of Open Access Journals (Sweden)

    Baronins Janis

    2015-12-01

    Full Text Available The aim of this study is to obtain high performance boron containing material with sufficient carrying capacity with increased porosity and lower density at the same time. The influence of the different concentrations of Al-W-B powder on the properties of the fresh and hardened HPC was investigated. In the concrete mix design, the allite containing White Portland cement CEM I 52,5 R, granite stone, sand, microsilica, on polycarboxylates based super plasticizer and Al-W-B powder were used. As a source of boron composite material (CM, previously grinded powder containing boron-tungsten fiber and aluminium matrix (CM Al-W-B was used. Grinding was used for processing of CM Al-W-B powder.

  18. Lipozyme IM-catalyzed interesterification for the production of margarine fats in a 1 kg scale stirred tank reactor

    DEFF Research Database (Denmark)

    Zhang, Hong; Xu, Xuebing; Mu, Huiling

    2000-01-01

    Lipozyme IM-catalyzed interesterification of the oil blend between palm stearin and coconut oil (75/25 w/w) was studied for the production of margarine fats in a 1 kg scale batch stirred tank reactor. Parameters such as lipase load, water content, temperature, and reaction time were investigated...

  19. Final Environmental Assessment for the Airfield Safety Zone Vegetation Clearing at Joint Base McGuire-Dix-Lakehurst

    Science.gov (United States)

    2011-10-01

    maintained in a fashion consistent with the Integrated Natural Resources Management Plan (INRMP) and good natural r esources m anagement prac tices as de...existing c onditions g iven f or a r esource a rea is c onsidered the baseline ag ainst w hich potential effects o f i mplementing e ither t he P roposed...American Indian Religious Freedom Act ( 1978), the A rchaeological R esources P rotection A ct ( 1979), and t he Native A merican Graves Protection

  20. Application of JAERI research reactors to education

    International Nuclear Information System (INIS)

    Ogawa, Shigeru; Morozumi, Minoru

    1987-01-01

    At the dawning of the atomic age in Japan, training on reactor operation and reactor engineering experiments has been started in 1958 using JRR-1 (a 50 kW water boiler type reactor with liquid fuel), which was the first research reactor in Japan. The role of the training has been transferred to JRR-4 (a 3500 kW swimming pool type reactor with ETR type fuel) since 1969 due to the decommission of JRR-1. The training courses which have been held are: JRR-1 Short-Term Course for Operation (1958 ∼ 1963) General Course (1961 ∼ ) Reactor Engineering Course (1976 ∼ ) Training Course in Nuclear Technology (International course)(1986 ∼ ). And individual training concerning research reactors for the participants of scientist exchange program sponsored by Science and Technology Agency and of bilateral agreement have been initiated in 1985. The graduates of these courses work as staff members in various fields in nuclear industry. (author)

  1. 40 CFR Table 1 to Subpart W of... - General Provisions Applicability to Subpart W

    Science.gov (United States)

    2010-07-01

    ... Subpart W 1 Table 1 to Subpart W of Part 63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Polyamides Production Pt. 63, Subpt. W, Table 1 Table 1 to Subpart W of Part 63—General Provisions Applicability to Subpart W Reference Applies to subpart W BLR WSR WSR alternative standard, and BLR equipment...

  2. McStas

    DEFF Research Database (Denmark)

    Willendrup, Peter Kjær; Farhi, Emmanuel; Bergbäck Knudsen, Erik

    2014-01-01

    experiments. McStas is being actively used for the design-update of the European Spallation Source (ESS) in Lund. This paper includes an introduction to the McStas package, recent and ongoing simulation projects. Further, new features in releases McStas 1.12c and 2.0 are discussed.......The McStas neutron ray-tracing simulation package is a collaboration between Risø DTU, ILL, University of Copenhagen and the PSI. During its lifetime, McStas has evolved to become the world leading software in the area of neutron scattering simulations for instrument design, optimisation, virtual...

  3. Experience from development and operation of the core surveillance systems SCORPIO

    International Nuclear Information System (INIS)

    Berg, O.; Porsmyr, J.; Adlandsvik, K.A.

    1994-01-01

    The main motivation behind the development of SCORPIO is to make a practical tool for reactor operators which can increase the quality and quantity of information presented on core status and dynamic behaviour. This can first of all improve plant safety as undesired core conditions are detected and prevented. Secondly, more flexible and efficient plant operation is made possible. These improvements are obtained by better surveillance of core instrumentation and through detailed calculations of core behaviour using on-line simulators. The SCORPIO system has two parallel modes of operation: the Core Follow Mode and the Predictive Mode. The system has been in operation at the Ringhals PWR unit 2 in Sweden since the end of 1987 where it runs on Norsk Data mini-computers. Recently, there has been a renewed interest for SCORPIO mainly determined by the utilities' desire to obtain more economical and flexible plant operation. The SCORPIO system has been transferred to Unix based workstations and integrated with the Picasso-2 graphics system. In addition to Ringhals the new system is currently being installed at Nuclear Electri's Sizewell B PWR in UK and Duke Power's Catawba Unit 1,2 and McGuire Unit 1,2, USA. (author). 7 refs, 5 figs

  4. Ab initio calculations of mechanical properties of bcc W-Re-Os random alloys: effects of transmutation of W.

    Science.gov (United States)

    Li, Xiaojie; Schönecker, Stephan; Li, Ruihuan; Li, Xiaoqing; Wang, Yuanyuan; Zhao, Jijun; Johansson, Börje; Vitos, Levente

    2016-06-03

    To examine the effect of neutron transmutation on tungsten as the first wall material of fusion reactors, the elastic properties of W 1-x-y  Re x  Os y (0  ⩽  x, y  ⩽  6%) random alloys in body centered cubic (bcc) structure are investigated systematically using the all-electron exact muffin-tin orbitals (EMTO) method in combination with the coherent-potential approximation (CPA). The calculated lattice constant and elastic properties of pure W are consistent with available experiments. Both Os and Re additions reduce the lattice constant and increase the bulk modulus of W, with Os having the stronger effect. The polycrystalline shear modulus, Young's modulus and the Debye temperature increase (decrease) with the addition of Re (Os). Except for C 11 , the other elastic parameters including C 12 , C 44 , Cauchy pressure, Poisson ratio, B/G, increase as a function of Re and Os concentration. The variations of the latter three parameters and the trend in the ratio of cleavage energy to shear modulus for the most dominant slip system indicate that the ductility of the alloy enhances with increasing Re and Os content. The calculated elastic anisotropy of bcc W slightly increases with the concentration of both alloying elements. The estimated melting temperatures of the W-Re-Os alloy suggest that Re or Os addition will reduce the melting temperature of pure W solid. The classical Labusch-Nabarro model for solid-solution hardening predicts larger strengthening effects in W 1-y  Os y than in W 1-x  Re x . A strong correlation between C' and the fcc-bcc structural energy difference for W 1-x-y  Re x  Os y is revealed demonstrating that canonical band structure dictates the alloying effect on C'. The structural energy difference is exploited to estimate the alloying effect on the ideal tensile strength in the [0 0 1] direction.

  5. The Function of PTP1B in Neuroendocrine Differentation of Prostate Cancer

    Science.gov (United States)

    2009-01-01

    AD_________________ Award Number: W81XWH-07-1-0061 TITLE: The Function of PTP1B in Neuroendocrine...The Function of PTP1B in Neuroendocrine Differentation of Prostate Cancer 5b. GRANT NUMBER W81XWH-07-1-0061 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR...pathways that may be responsible for the neuroendocrine differentiation of prostate cancer cells, particularly the relationship of PTP1B to IL-8

  6. α1B-Adrenergic receptor signaling controls circadian expression of Tnfrsf11b by regulating clock genes in osteoblasts

    Directory of Open Access Journals (Sweden)

    Takao Hirai

    2015-11-01

    Full Text Available Circadian clocks are endogenous and biological oscillations that occur with a period of <24 h. In mammals, the central circadian pacemaker is localized in the suprachiasmatic nucleus (SCN and is linked to peripheral tissues through neural and hormonal signals. In the present study, we investigated the physiological function of the molecular clock on bone remodeling. The results of loss-of-function and gain-of-function experiments both indicated that the rhythmic expression of Tnfrsf11b, which encodes osteoprotegerin (OPG, was regulated by Bmal1 in MC3T3-E1 cells. We also showed that REV-ERBα negatively regulated Tnfrsf11b as well as Bmal1 in MC3T3-E1 cells. We systematically investigated the relationship between the sympathetic nervous system and the circadian clock in osteoblasts. The administration of phenylephrine, a nonspecific α1-adrenergic receptor (AR agonist, stimulated the expression of Tnfrsf11b, whereas the genetic ablation of α1B-AR signaling led to the alteration of Tnfrsf11b expression concomitant with Bmal1 and Per2 in bone. Thus, this study demonstrated that the circadian regulation of Tnfrsf11b was regulated by the clock genes encoding REV-ERBα (Nr1d1 and Bmal1 (Bmal1, also known as Arntl, which are components of the core loop of the circadian clock in osteoblasts.

  7. Tooele Army Depot-North Area Suspected Releases SWMUs. Phase 1 RFI report. Volume 1. Text

    Science.gov (United States)

    1993-12-01

    Maximum Contaminant Level MSL Mean Sea Level NEPA National Environmental Policy Act OB/OD Open Burning/Open Detonation PAH Polycyclic Aromatic...part of a pre-construction environmental assessment (EA), as required by the National Environmental Policy Act (NEPA). The following summarize the...0 1 1M*C!. 43, IV 𔃺 -4C o c a 0fi MA ao W!t 40 CD at w 4Kb CNCD 0 0 CS 40 - 0 e’A * CL m s.a Sc -~ ~ *b C CL 0 WN0 . 0 - at’ 30. qm 2 5--1 z 44

  8. Evaluation of conidia production and mycelial growth in solid culture ...

    African Journals Online (AJOL)

    FATIMAYALBERTO

    2012-10-02

    Oct 2, 2012 ... liquid culture media of different species of ..... Jackson MA, McGuire MR, Lacey LA, Wraight SP (1997). Liquid culture ... fermentation and the substrate in the production of Trichoderma ... Conidiation induction in Penicillium.

  9. Comparative analysis between P1 and B1 equations for neutron moderation; Analise comparativa entre os metodos de obtencao e das solucoes das equacoes P1 e B1 para moderacao de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Aquilino Senra; Silva, Fernando Carvalho da; Cardoso, Carlos Eduardo Santos [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear

    2000-07-01

    In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

  10. Homogeneous SLOWPOKE reactors for replacing SLOWPOKE-2 research reactors and the production of radioisotopes

    International Nuclear Information System (INIS)

    Bonin, H.W.; Hilborn, J.W.; Carlin, G.E.; Gagnon, R.; Busatta, P.

    2014-01-01

    Inspired from the inherently safe SLOWPOKE-2 research reactor, the Homogeneous SLOWPOKE reactor was conceived with a double goal: replacing the heterogeneous SLOWPOKE-2 reactors when they reach end-of-core life to continue their missions of neutron activation analysis and neutron radiography at universities, and to produce radioisotopes such as 99 Mo for medical applications. A homogeneous reactor core allows a much simpler extraction of radioisotopes (such as 99 Mo) for applications in industry and nuclear medicine. The 20 kW Homogeneous SLOWPOKE reactor was modelled using both the deterministic WIMS-AECL and the probabilistic MCNP 5 reactor simulation codes. The homogeneous fuel mixture was a dilute aqueous solution of Uranyl Sulfate (UO 2 SO 4 ) with 994.2 g of 235 U (enrichment at 20%) providing an excess reactivity at operating temperature (40 o C) of 3.8 mk for a molality determined as 1.46 mol kg -1 for a Zircaloy-2 reactor vessel. Because this reactor is intended to replace the core of SLOWPOKE-2 reactors, the Homogeneous SLOWPOKE reactor core had a height about twice its diameter. The reactor could be controlled by mechanical absorber rods in the beryllium reflector, chemical control in the core, or a combination of both. The safety of the Homogeneous SLOWPOKE reactor was analysed for both normal operation and transient conditions. Thermal-hydraulics calculations used COMSOL Multiphysics and the results showed that natural convection was sufficient to ensure adequate reactor cooling in all situations. The most severe transient simulated resulted from a 5.87 mk step positive reactivity insertion to the reactor in operation at critical and at steady state at 20 o C. Peak temperature and power were determined as 83 o C and 546 kW, respectively, reached 5.1 s after the reactivity insertion. However, the power fell rapidly to values below 20 kW some 35 s after the peak and remained below that value thereafter. Both the temperature and void coefficients are

  11. Homogeneous SLOWPOKE reactors for replacing SLOWPOKE-2 research reactors and the production of radioisotopes

    Energy Technology Data Exchange (ETDEWEB)

    Bonin, H.W., E-mail: bonin-h@rmc.ca [Royal Military College of Canada, Kingston, Ontario (Canada); Hilborn, J.W. [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Carlin, G.E. [Ontario Power Generation, Toronto, Ontario (Canada); Gagnon, R.; Busatta, P. [Canadian Forces (Canada)

    2014-07-01

    Inspired from the inherently safe SLOWPOKE-2 research reactor, the Homogeneous SLOWPOKE reactor was conceived with a double goal: replacing the heterogeneous SLOWPOKE-2 reactors when they reach end-of-core life to continue their missions of neutron activation analysis and neutron radiography at universities, and to produce radioisotopes such as {sup 99}Mo for medical applications. A homogeneous reactor core allows a much simpler extraction of radioisotopes (such as {sup 99}Mo) for applications in industry and nuclear medicine. The 20 kW Homogeneous SLOWPOKE reactor was modelled using both the deterministic WIMS-AECL and the probabilistic MCNP 5 reactor simulation codes. The homogeneous fuel mixture was a dilute aqueous solution of Uranyl Sulfate (UO{sub 2}SO{sub 4}) with 994.2 g of {sup 235}U (enrichment at 20%) providing an excess reactivity at operating temperature (40 {sup o}C) of 3.8 mk for a molality determined as 1.46 mol kg{sup -1} for a Zircaloy-2 reactor vessel. Because this reactor is intended to replace the core of SLOWPOKE-2 reactors, the Homogeneous SLOWPOKE reactor core had a height about twice its diameter. The reactor could be controlled by mechanical absorber rods in the beryllium reflector, chemical control in the core, or a combination of both. The safety of the Homogeneous SLOWPOKE reactor was analysed for both normal operation and transient conditions. Thermal-hydraulics calculations used COMSOL Multiphysics and the results showed that natural convection was sufficient to ensure adequate reactor cooling in all situations. The most severe transient simulated resulted from a 5.87 mk step positive reactivity insertion to the reactor in operation at critical and at steady state at 20 {sup o}C. Peak temperature and power were determined as 83 {sup o}C and 546 kW, respectively, reached 5.1 s after the reactivity insertion. However, the power fell rapidly to values below 20 kW some 35 s after the peak and remained below that value thereafter. Both the

  12. Importance of tests for the complete Lorentz structure of the t→W+b vertex at hadron colliders

    International Nuclear Information System (INIS)

    Nelson, C.A.; Kress, B.T.; Lopes, M.; McCauley, T.P.

    1998-01-01

    In a separate paper, the most general Lorentz-invariant decay-density matrix for t→W + b→(l + ν)b, or for t→W + b→(j bar d j u )b, is expressed in terms of eight helicity parameters. The parameters can be used to test for a variety of sources of new physics in t→W + b decay. By stage-two spin-correlation techniques, percent level statistical uncertainties are typical for W-polarimetry measurements of these helicity parameters at the Fermilab Tevatron, and several mill level uncertainties are typical for W-polarimetry measurements at the CERN LHC. Λ b polarimetry could be used to measure the relative phase of the b L and b R amplitudes. copyright 1998 The American Physical Society

  13. Otimização do banho eletrolítico da liga Fe-W-B resistente à corrosão Optimization of the electrolytic bath for electrodeposition of corrosion resistant Fe-W-B alloys

    Directory of Open Access Journals (Sweden)

    Renato Alexandre Costa de Santana

    2007-04-01

    Full Text Available A study on optimization of bath parameters for electrodeposition of Fe-W-B alloys from plating baths containing ammonia and citrate is reported. A 2³ full factorial design was successfully employed for experimental design analysis of the results. The corrosion resistance and amorphous character were evaluated. The bath conditions obtained for depositing the alloy with good corrosion resistance were: 0.01 M iron sulfate, 0.10 M sodium tungstate and 0.60 M ammonium citrate. The alloy was deposited at 12% current efficiency. The alloy obtained had Ecorr -0.841 V and Rp 1.463 x 10(4 Ohm cm². The deposit obtained under these conditions had an amorphous character and no microcracks were observed on its surface. Besides this, the bath conditions obtained for depositing the alloy with the highest deposition efficiency were: 0.09 M iron sulfate, 0.30 M sodium tungstate and 0.50 M ammonium citrate. The alloy was deposited at 50% current efficiency, with an average composition of 34 wt% W, 66 wt% Fe and traces of boron. The alloy obtained had Ecorr -0.800 V and Rp 1.895 x 10³ Ohm cm². Electrochemical corrosion tests verified that the Fe-W-B alloy deposited under both conditions had better corrosion resistance than Fe-Mo-B.

  14. Neutron capture cross section measurements and theoretical calculation for the {sup 186}W(n,γ){sup 187}W reaction

    Energy Technology Data Exchange (ETDEWEB)

    Al-abyad, Mogahed; Mohamed, Gehan Y. [Atomic Energy Authority, Cairo (Egypt). Experimental Nuclear Physics Dept.

    2017-08-01

    Neutron capture cross section (σ{sub 0}) and resonance integral (I{sub 0}) of the reaction {sup 186}W(n,γ){sup 187}W were measured experimentally using the research reactor (ETRR-2) and an Am-Be neutron source, also calculated using TALYS-1.6 code. The present results of σ{sub 0} are (39.08±2.6, 38.75±0.98 and 38.33 barn) and I{sub 0} are (418.5±74, 439.3±36 and 445.5 barn) by using the reactor, neutron source and TALYS-1.6, respectively. The present results are in acceptable agreement with most of the previous experimental and evaluated data as well as the theoretical calculations.

  15. Overview of the Dalat Nuclear Research Reactor

    International Nuclear Information System (INIS)

    Nguyen Nhi Dien; Nguyen Thai Sinh; Luong Ba Vien

    2016-01-01

    The present reactor called Dalat Nuclear Research Reactor (DNRR) has been reconstructed from the former TRIGA Mark II reactor which was designed by General Atomic (GA, San Diego, California, USA), started building in early 1960s, put into operation in 1963 and operated until 1968 at nominal power of 250 kW. In 1975, all fuel elements of the reactor were unloaded and shipped back to the USA. The DNRR is a 500-kW pool-type research reactor using light water as both moderator and coolant. The reactor is used as a neutron source for the purposes of: (1) radioactive isotope production; (2) neutron activation analysis; and (3) research and training

  16. Study of cold neutron sources: Implementation and validation of a complete computation scheme for research reactor using Monte Carlo codes TRIPOLI-4.4 and McStas

    International Nuclear Information System (INIS)

    Campioni, Guillaume; Mounier, Claude

    2006-01-01

    The main goal of the thesis about studies of cold neutrons sources (CNS) in research reactors was to create a complete set of tools to design efficiently CNS. The work raises the problem to run accurate simulations of experimental devices inside reactor reflector valid for parametric studies. On one hand, deterministic codes have reasonable computation times but introduce problems for geometrical description. On the other hand, Monte Carlo codes give the possibility to compute on precise geometry, but need computation times so important that parametric studies are impossible. To decrease this computation time, several developments were made in the Monte Carlo code TRIPOLI-4.4. An uncoupling technique is used to isolate a study zone in the complete reactor geometry. By recording boundary conditions (incoming flux), further simulations can be launched for parametric studies with a computation time reduced by a factor 60 (case of the cold neutron source of the Orphee reactor). The short response time allows to lead parametric studies using Monte Carlo code. Moreover, using biasing methods, the flux can be recorded on the surface of neutrons guides entries (low solid angle) with a further gain of running time. Finally, the implementation of a coupling module between TRIPOLI- 4.4 and the Monte Carlo code McStas for research in condensed matter field gives the possibility to obtain fluxes after transmission through neutrons guides, thus to have the neutron flux received by samples studied by scientists of condensed matter. This set of developments, involving TRIPOLI-4.4 and McStas, represent a complete computation scheme for research reactors: from nuclear core, where neutrons are created, to the exit of neutrons guides, on samples of matter. This complete calculation scheme is tested against ILL4 measurements of flux in cold neutron guides. (authors)

  17. Degradation of corn stalk by the composite microbial system of MC1

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The composite microbial system of MC1 was used to degrade corn stalk in order to determine properties of the degraded products as well as bacterial composition of MC1. Results indicated that the pH of the fermentation broth was typical of lignocellulose degradatioin by MC1, decreasing in the early phase and increasing in later stages of the degradation. The microbial biomass peaked on the day 3 after degradation. The MC1 effeciently degraded the corn stalk by nearly 70% during which its cellulose content decreased by 71.2%, hemicellulose by 76.5% and lignin by 24.6%. The content of water-soluble carbohydrates (WSC) in the fermentation broth increased progressively during the first three days, and decreased thereafter, suggesting an accumulation of WSC in the early phase of the degradation process. Total levels of various volatile products peaked in the third day after degradation , and 7 types of volatile products were detected in the fermentation broth. These were ethanol, acetic acid, 1,2-ethanediol, propanoic acid, butanoic acid, 3-methyl-butanoic acid and glycerine. Six major compounds were quantitatively analysed and the contents of each compound were ethanol (0.584 g/L), acetic acid (0.735 g/L), 1,2-ethanediol (0.772 g/L), propanoic acid (0.026 g/L), butanoic acid (0.018 g/L) and glycerine (4.203 g/L). Characterization of bacterial cells collected from the culture solution, based on 16S rDNA PCR-DGGE analysis of DNAs, showed that the composition of bacterial community in MC1 coincided basically with observations from previous studies. This indicated that the structure of MC1 is very stable during degradation of different lignocellulose materials.

  18. NNLO QCD corrections to associated W H production and H →b b ¯ decay

    Science.gov (United States)

    Caola, Fabrizio; Luisoni, Gionata; Melnikov, Kirill; Röntsch, Raoul

    2018-04-01

    We present a computation of the next-to-next-to-leading-order (NNLO) QCD corrections to the production of a Higgs boson in association with a W boson at the LHC and the subsequent decay of the Higgs boson into a b b ¯ pair, treating the b quarks as massless. We consider various kinematic distributions and find significant corrections to observables that resolve the Higgs decay products. We also find that a cut on the transverse momentum of the W boson, important for experimental analyses, may have a significant impact on kinematic distributions and radiative corrections. We show that some of these effects can be adequately described by simulating QCD radiation in Higgs boson decays to b quarks using parton showers. We also describe contributions to Higgs decay to a b b ¯ pair that first appear at NNLO and that were not considered in previous fully differential computations. The calculation of NNLO QCD corrections to production and decay sub-processes is carried out within the nested soft-collinear subtraction scheme presented by some of us earlier this year. We demonstrate that this subtraction scheme performs very well, allowing a computation of the coefficient of the second-order QCD corrections at the level of a few per mill.

  19. Study of dietary supplements compositions by neutron activation analysis at the VR-1 training reactor

    Science.gov (United States)

    Stefanik, Milan; Rataj, Jan; Huml, Ondrej; Sklenka, Lubomir

    2017-11-01

    The VR-1 training reactor operated by the Czech Technical University in Prague is utilized mainly for education of students and training of various reactor staff; however, R&D is also carried out at the reactor. The experimental instrumentation of the reactor can be used for the irradiation experiments and neutron activation analysis. In this paper, the neutron activation analysis (NAA) is used for a study of dietary supplements containing the zinc (one of the essential trace elements for the human body). This analysis includes the dietary supplement pills of different brands; each brand is represented by several different batches of pills. All pills were irradiated together with the standard activation etalons in the vertical channel of the VR-1 reactor at the nominal power (80 W). Activated samples were investigated by the nuclear gamma-ray spectrometry technique employing the semiconductor HPGe detector. From resulting saturated activities, the amount of mineral element (Zn) in the pills was determined using the comparative NAA method. The results show clearly that the VR-1 training reactor is utilizable for neutron activation analysis experiments.

  20. Search for pair production of vector-like quarks in the bW bW channel from proton-proton collisions at √{ s } = 13TeV

    Science.gov (United States)

    Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Dragicevic, M.; Erö, J.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rabady, D.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van De Klundert, M.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Moortgat, S.; Moreels, L.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Karapostoli, G.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Randle-conde, A.; Seva, T.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Zhang, F.; Cimmino, A.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caputo, C.; Caudron, A.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Jafari, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Vidal Marono, M.; Wertz, S.; Beliy, N.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Custódio, A.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Santoro, A.; Sznajder, A.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Fernandez Perez Tomei, T. R.; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Stoykova, S.; Sultanov, G.; Dimitrov, A.; Glushkov, I.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhang, S.; Zhao, J.; Ban, Y.; Chen, G.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; El-khateeb, E.; Elgammal, S.; Ellithi Kamel, A.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Pekkanen, J.; Voutilainen, M.; Härkönen, J.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Lehti, S.; Lindén, T.; Luukka, P.; Tuominen, E.; Tuominiemi, J.; Tuovinen, E.; Talvitie, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Givernaud, A.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Zghiche, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Khvedelidze, A.; Tsamalaidze, Z.; Autermann, C.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Verlage, T.; Zhukov, V.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Lingemann, J.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Gizhko, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Guthoff, M.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kalogeropoulos, A.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Raspereza, A.; Roland, B.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Spannagel, S.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Bein, S.; Blobel, V.; Centis Vignali, M.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marchesini, I.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanelderen, L.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Freund, B.; Friese, R.; Giffels, M.; Gilbert, A.; Haitz, D.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Giakoumopoulou, V. A.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Karathanasis, G.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Kousouris, K.; Evangelou, I.; Foudas, C.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Csanad, M.; Filipovic, N.; Pasztor, G.; Veres, G. I.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Zsigmond, A. J.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Chawla, R.; Dhingra, N.; Kalsi, A. K.; Kaur, A.; Kaur, M.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Bhawandeep, U.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy, D.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Robutti, E.; Tosi, S.; Benaglia, A.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Redaelli, N.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Bisello, D.; Boletti, A.; Carlin, R.; Carvalho Antunes De Oliveira, A.; Checchia, P.; Dall'Osso, M.; De Castro Manzano, P.; Dorigo, T.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Lujan, P.; Meneguzzo, A. T.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Simonetto, F.; Torassa, E.; Ventura, S.; Zanetti, M.; Zotto, P.; Zumerle, G.; Braghieri, A.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Lariccia, P.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Martini, L.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Daci, N.; Del Re, D.; Di Marco, E.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Ravera, F.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Choi, M.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Md Ali, M. A. B.; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Reyes-Almanza, R.; Ramirez-Sanchez, G.; Duran-Osuna, M. C.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Rabadan-Trejo, R. I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Di Francesco, A.; Faccioli, P.; Galinhas, B.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Strong, G.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chistov, R.; Danilov, M.; Parygin, P.; Philippov, D.; Polikarpov, S.; Tarkovskii, E.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Bunichev, V.; Dubinin, M.; Dudko, L.; Ershov, A.; Klyukhin, V.; Kodolova, O.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Perfilov, M.; Savrin, V.; Snigirev, A.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Escalante Del Valle, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Garcia-Abia, P.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Moran, D.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; Albajar, C.; de Trocóniz, J. F.; Missiroli, M.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Duarte Campderros, J.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Dobson, M.; Dorney, B.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Fallavollita, F.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gill, K.; Glege, F.; Gulhan, D.; Harris, P.; Hegeman, J.; Innocente, V.; Janot, P.; Karacheban, O.; Kieseler, J.; Kirschenmann, H.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Krammer, M.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Ngadiuba, J.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Stakia, A.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Verweij, M.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Bachmair, F.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Reichmann, M.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Del Burgo, R.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Seitz, C.; Takahashi, Y.; Zucchetta, A.; Candelise, V.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Paganis, E.; Psallidas, A.; Steen, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Bakirci, M. N.; Boran, F.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Eskut, E.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Ozturk, S.; Polatoz, A.; Tali, B.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Bilin, B.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Grynyov, B.; Levchuk, L.; Aggleton, R.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Grimes, M.; Heath, G. P.; Heath, H. F.; Jacob, J.; Kreczko, L.; Lucas, C.; Newbold, D. M.; Paramesvaran, S.; Poll, A.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Bell, K. W.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Auzinger, G.; Bainbridge, R.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Wardle, N.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Symonds, P.; Teodorescu, L.; Turner, M.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Mao, Z.; Narain, M.; Pazzini, J.; Piperov, S.; Sagir, S.; Syarif, R.; Yu, D.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Gardner, M.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Regnard, S.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Jandir, P.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Shrinivas, A.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Gerosa, R.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Macneill, I.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Simon, S.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; George, C.; Golf, F.; Gouskos, L.; Gran, J.; Heller, R.; Incandela, J.; Mullin, S. D.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bendavid, J.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Maruyama, S.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Field, R. D.; Furic, I. K.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Rank, D.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Sharma, V.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Royon, C.; Sanders, S.; Schmitz, E.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Toda, S.; Rebassoo, F.; Wright, D.; Anelli, C.; Baden, A.; Baron, O.; Belloni, A.; Calvert, B.; Eno, S. C.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lai, Y. S.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Alyari, M.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Nash, D.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Pollack, B.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Smith, G.; Taroni, S.; Wayne, M.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Puigh, D.; Winer, B. L.; Wulsin, H. W.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Das, S.; Folgueras, S.; Gutay, L.; Jha, M. K.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Schulte, J. F.; Sun, J.; Wang, F.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Adair, A.; Akgun, B.; Chen, Z.; Ecklund, K. M.; Geurts, F. J. M.; Guilbaud, M.; Li, W.; Michlin, B.; Northup, M.; Padley, B. P.; Roberts, J.; Rorie, J.; Tu, Z.; Zabel, J.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Foerster, M.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Padeken, K.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Joyce, M.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Sturdy, J.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Pierro, G. A.; Polese, G.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.; CMS Collaboration

    2018-04-01

    A search is presented for the production of vector-like quark pairs, T T ‾ or Y Y ‾, with electric charge of 2/3 (T) or - 4 / 3 (Y), in proton-proton collisions at √{ s } = 13TeV. The data were collected by the CMS experiment at the LHC in 2016 and correspond to an integrated luminosity of 35.8fb-1. The T and Y quarks are assumed to decay exclusively to a W boson and a b quark. The search is based on events with a single isolated electron or muon, large missing transverse momentum, and at least four jets with large transverse momenta. In the search, a kinematic reconstruction of the final state observables is performed, which would permit a signal to be detected as a narrow mass peak (≈7% resolution). The observed number of events is consistent with the standard model prediction. Assuming strong pair production of the vector-like quarks and a 100% branching fraction to bW, a lower limit of 1295 GeV at 95% confidence level is set on the T and Y quark masses.

  1. Coatings synthesised by the pulsed laser ablation of a B{sub 4}C/W{sub 2}B{sub 5} ceramic composite

    Energy Technology Data Exchange (ETDEWEB)

    Tadadjeu Sokeng, I., E-mail: ifriky@tlabs.ac.za [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa); Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Ngom, B.D. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Laboratoire de Photonique et de Nanofrabrication, Groupes de physique du Solide et Sciences des Matriaux (GPSSM), Facult des sciences et Techniques Universit Cheikh Anta Diop de Dakar (UCAD), B.P. 25114 Dakar, Fann Dakar (Senegal); Msimanga, M. [iThemba LABS Gauten, Private Bag 11, WITS 2050 Johannesburg (South Africa); Nuru, Z.Y.; Kotsedi, L.; Maaza, M. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Van Zyl, R.R. [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa)

    2015-10-30

    A pellet of B{sub 4}C/W{sub 2}B{sub 5} ceramic composite was characterised and subjected to pulsed laser ablation for the deposition of coatings on corning glass substrates. We reports an attempt to produce coatings from B{sub 4}C/W{sub 2}B{sub 5} by pulsed laser deposition (PLD). The thermal, electric and mechanical properties of B{sub 4}C/W{sub 2}B{sub 5} suggest that coatings synthesised from this composite can be used for space applications. The samples were characterised using X-ray Diffraction, Atomic Force Microscopy and Heavy Ion Elastic Recoil Detection Analysis. The characterisation of the samples deposited on soda lime corning glass showed that the laser energy used in this PLD was enough to obtain non amorphous coatings formed by some alteration of the tungsten carbide crystal lattice at room temperature, and that there was no stoichiometry transfer as would be expected from PLD. The coating also showed space applicable features worth investigating. - Highlights: • B{sub 4}C/W{sub 2}B{sub 5} ceramic composite was ablated for deposition on corning glass subtrates. • Non-amorphous coating was obtained at room temperature. • There was no stoichiometry transfer as would be expected from Pulsed Laser Deposition.

  2. Higgs and top production in the reaction γe→νb anti bW at TeV linear collider energies

    International Nuclear Information System (INIS)

    Boos, E.; Pukhov, A.; Sachwitz, M.; Schreiber, H.J.

    1996-06-01

    For an electron-photon collider the complete tree-level cross sections of the reaction γe→νb anti bW are computed at center-of-mass energies between 0.5 and 2.0 TeV, for top masses of 160 to 200 GeV and Higgs masses between 80 and 140 GeV within the standard model. It is shown that most of the about 50% smaller. Multiperipheral background and interferences are small, respectively negligible, in the energy range studied. By convoluting the basic cross sections with an energy spectrum of the backscattered photon beam, and inserting linear collider luminosities as anticipated in present designs, realistic νb anti bW event rates are estimated. This results in large event rates for γe→νtb and γe→νHW. We estimate that the CKM matrix element vertical stroke V tb vertical stroke can be probed from the νtb final state to an accuracy of 1-3% at √ssub(e + e - )>or∼1 TeV. Assuming an effective Lagrangian based on dimension-6 operators we discuss the sensitivity for detecting deviations of the HWW coupling from the Standard Model in the reaction γe→νHW. (orig.)

  3. Feasibility study of application of Prompt Gamma Neutron Activation Analysis (PGNAA) method in TRIGA IPR-R1 reactor

    International Nuclear Information System (INIS)

    Guerra, Bruno Teixeira

    2016-01-01

    The TRIGA Mark I IPR-R1 research reactor is located at Nuclear Technology Development Centre (CDTN), Brazilian Commission for Nuclear Energy (CNEN), in Belo Horizonte, Brazil. The reactor operates at 100 kW but the core configuration allows the increasing of the power up to 250 kW. It has been applied research, training and radioisotopes production. The establishment of the Prompt Gamma Neutron Activation Analysis (PGNAA) method at the TRIGA IPR-R1 reactor will significantly increase the types of matrices analysed as well as the number of chemical elements. Additionally it will complement the neutron activation analysis. This work presents a proposed design of a PGNAA facility to be installed at the TRIGA IPR-R1. The proposed design is based on a tube as a neutron guide from the reactor core, inside the reactor pool, 6 m below the room’s level where shall be located the rack containing the set sample/detector/shielding. Thus, the aim of this study is to verify the feasibility to establish the PGNAA method in IPR-R1 through theoretical study applying the Monte Carlo code. The feasibility of establishing the PGAA method at the IPR-R1 installations was evaluated through of the calculations of neutron flux, radioactive capture reaction rates and detection limits for some isotopes. According to the obtained results, it can be concluded that is possible to establish the PGAA method at the IPR-R1 reactor, even with some restrictions in its theoretical design calculated by MCNP. (author)

  4. Rola otyłości w patogenezie chorób alergicznych

    Directory of Open Access Journals (Sweden)

    Anna Grad

    2009-09-01

    Full Text Available W ostatnich latach wzrosła zachorowalność na astmę i inne choroby alergiczne. Jednocześnie obserwuje się zwiększenie liczby pacjentów z nadmierną masą ciała i podwyższoną wartością wskaźnika wagowo-wzrostowego (BMI. Wydaje się, że mimo odmiennego patomechanizmu astmy i otyłości istnieje wspólne ogniwo patogenetyczne rozwoju tych chorób. Bierze się pod uwagę rolę czynników środowiskowych, dietetycznych, genetycznych i infekcyjnych. Wyniki większości badań epidemiologicznych potwierdzają związek nadwagi i otyłości z ryzykiem wystąpienia astmy zarówno u osób dorosłych, jak i u dzieci. Podkreśla się rolę wysokiej urodzeniowej masy ciała i większych przyrostów masy ciała w pierwszym roku życia. Natomiast występowanie alergicznego nieżytu nosa i alergicznego zapalenia spojówek koreluje ujemnie z masą ciała. Nie obserwowano związku otyłości z częstością występowania atopowego zapalenia skóry. Tkanka tłuszczowa jako narząd endokrynny produkuje dużo różnych cytokin, hormonów, czynników wzrostu. Jest źródłem czynników prozapalnych, między innymi IL-6, TNF-a, TGF-b, leptyny, rezystyny. Leptyna jest produkowana przez adipocyty, jej stężenie koreluje z masą tkanki tłuszczowej, może ona intensyfikować zapalenie oraz odgrywać ważną rolę w rozwoju płuc. Podwyższone stężenie leptyny w surowicy jest uważane za czynnik prognostyczny rozwoju astmy. Adiponektyna ma właściwości przeciwzapalne, jej stężenie maleje w otyłości i koreluje ujemnie ze wskaź- nikiem BMI. W rozwoju astmy u osób otyłych biorą również udział rezystyna, eotaksyna, białko aP2 oraz żeńskie hormony płciowe. Rola czynników genetycznych nie jest do końca poznana. Dotychczas wyodrębniono 4 regiony chromosomalne związane ze zwiększoną podatnością na zachorowanie na astmę i otyłość. Efekt ochronny mają czynniki dietetyczne, takie jak antyoksydanty i mikroelementy. Otyłość pogarsza

  5. Rola otyłości w patogenezie chorób alergicznych

    Directory of Open Access Journals (Sweden)

    Anna Grad

    2008-10-01

    Full Text Available W ostatnich latach wzrosła zachorowalność na astmę i inne choroby alergiczne. Jednocześnie obserwuje się zwiększenie liczby pacjentów z nadmierną masą ciała i podwyższoną wartością wskaźnika wagowo-wzrostowego (BMI. Wydaje się, że mimo odmiennego patomechanizmu astmy i otyłości istnieje wspólne ogniwo patogenetyczne rozwoju tych chorób. Bierze się pod uwagę rolę czynników środowiskowych, dietetycznych, genetycznych i infekcyjnych. Wyniki większości badań epidemiologicznych potwierdzają związek nadwagi i otyłości z ryzykiem wystąpienia astmy zarówno u osób dorosłych, jak i u dzieci. Podkreśla się rolę wysokiej urodzeniowej masy ciała i większych przyrostów masy ciała w pierwszym roku życia. Natomiast występowanie alergicznego nieżytu nosa i alergicznego zapalenia spojówek koreluje ujemnie z masą ciała. Nie obserwowano związku otyłości z częstością występowania atopowego zapalenia skóry. Tkanka tłuszczowa jako narząd endokrynny produkuje dużo różnych cytokin, hormonów, czynników wzrostu. Jest źródłem czynników prozapalnych, między innymi IL-6, TNF-a, TGF-b, leptyny, rezystyny. Leptyna jest produkowana przez adipocyty, jej stężenie koreluje z masą tkanki tłuszczowej, może ona intensyfikować zapalenie oraz odgrywać ważną rolę w rozwoju płuc. Podwyższone stężenie leptyny w surowicy jest uważane za czynnik prognostyczny rozwoju astmy. Adiponektyna ma właściwości przeciwzapalne, jej stężenie maleje w otyłości i koreluje ujemnie ze wskaź- nikiem BMI. W rozwoju astmy u osób otyłych biorą również udział rezystyna, eotaksyna, białko aP2 oraz żeń- skie hormony płciowe. Rola czynników genetycznych nie jest do końca poznana. Dotychczas wyodrębniono 4 regiony chromosomalne związane ze zwiększoną podatnością na zachorowanie na astmę i otyłość. Efekt ochronny mają czynniki dietetyczne, takie jak antyoksydanty i mikroelementy. Otyłość pogarsza

  6. Sim1 Neurons Are Sufficient for MC4R-Mediated Sexual Function in Male Mice.

    Science.gov (United States)

    Semple, Erin; Hill, Jennifer W

    2018-01-01

    Sexual dysfunction is a poorly understood condition that affects up to one-third of men around the world. Existing treatments that target the periphery do not work for all men. Previous studies have shown that central melanocortins, which are released by pro-opiomelanocortin neurons in the arcuate nucleus of the hypothalamus, can lead to male erection and increased libido. Several studies specifically implicate the melanocortin 4 receptor (MC4R) in the central control of sexual function, but the specific neural circuitry involved is unknown. We hypothesized that single-minded homolog 1 (Sim1) neurons play an important role in the melanocortin-mediated regulation of male sexual behavior. To test this hypothesis, we examined the sexual behavior of mice expressing MC4R only on Sim1-positive neurons (tbMC4Rsim1 mice) in comparison with tbMC4R null mice and wild-type controls. In tbMC4Rsim1 mice, MC4R reexpression was found in the medial amygdala and paraventricular nucleus of the hypothalamus. These mice were paired with sexually experienced females, and their sexual function and behavior was scored based on mounting, intromission, and ejaculation. tbMC4R null mice showed a longer latency to mount, a reduced intromission efficiency, and an inability to reach ejaculation. Expression of MC4R only on Sim1 neurons reversed the sexual deficits seen in tbMC4R null mice. This study implicates melanocortin signaling via the MC4R on Sim1 neurons in the central control of male sexual behavior. Copyright © 2018 Endocrine Society.

  7. Lifetime Neutron Fluence Analysis of the Ringhals Unit 1 Boiling Water Reactor

    Directory of Open Access Journals (Sweden)

    Kulesza Joel A.

    2016-01-01

    Full Text Available This paper describes a neutron fluence assessment considering the entire commercial operating history (35 cycles or ∼ 25 effective full power years of the Ringhals Unit 1 reactor pressure vessel beltline region. In this assessment, neutron (E >1.0 MeV fluence and iron atom displacement distributions were calculated on the moderator tank and reactor pressure vessel structures. To validate those calculations, five in-vessel surveillance chain dosimetry sets were evaluated as well as material samples taken from the upper core grid and wide range neutron monitor tubes to act as a form of retrospective dosimetry. During the analysis, it was recognized that delays in characterizing the retrospective dosimetry samples reduced the amount of reactions available to be counted and complicated the material composition determination. However, the comparisons between the surveillance chain dosimetry measurements (M and calculated (C results show similar and consistent results with the linear average M/C ratio of 1.13 which is in good agreement with the resultant least squares best estimate (BE/C ratios of 1.10 for both neutron (E >1.0 MeV flux and iron atom displacement rate.

  8. Poetic justice: A commentary on Joseph B. McCaffrey's "The brain’s heterogeneous landscape"

    Directory of Open Access Journals (Sweden)

    Witold Hensel

    2015-12-01

    Full Text Available The paper is a commentary on McCaffrey (2015. I begin by arguing that the two views on brain pluripotency that McCaffrey intends to reconcile, namely those of Price and Friston (2005 and Klein (2012, are not really in conflict. The alleged disagreement between them stems from two interpretative failures: first on the part of Klein, who has misrepresented the views of Price and Friston, and second on the part of McCaffrey, who has misconstrued Klein’s position. I then take issue with McCaffrey’s claim that each of the structurefunction mapping strategies he discusses allows researchers to discover a different kind of pluripotency: (1 where each subregion of a pluripotent brain area performs a specific function, (2 where a brain area performs a single function in multiple mechanisms (networks, and (3 where a brain area performs multiple functions in multiple mechanisms (networks.

  9. Search for Higgs Boson Production in Association with a W Boson in 1.96-TeV Proton - Antiproton Collisions

    Energy Technology Data Exchange (ETDEWEB)

    Masubuchi, Tatusya [Univ. of Tsukuba (Japan)

    2008-02-01

    We have searched for the Standard Model Higgs boson production in association with a W± boson. This search is based on the data collected between February 2002 and May 2007, corresponding to an integrated luminosity of 1.9 fb-1 collected by the Collider Detector at Fermilab (CDF) at the Tevatron which is a p$\\bar{p}$ collider at a center of mass energy 1.96 TeV. W+Higgs channel is one of the most promising channels for the Higgs search at Tevatron in the low Higgs mass region (mH < 135 GeV/c2), where Higgs boson decays into b$\\bar{b}$ dominantly. The detection of lepton from the W boson decay makes the W+Higgs events much cleaner than the direct Higgs production events which have the largest production cross section. Experimentally we select events with a high pT lepton, high missing transverse energy and two b-quark jets. This signature is same as for the W+jets background which has a huge cross section. To reduce the W+jets background, b-jet identification algorithms are applied to at least one jet. The expected signal events in 1.9fb-1 are 1.82 ± 0.15 and 1.68 ± 0.20 for one b-tagged events and two b-tagged events, respectively. The observed data is 805 for one b-tagged events and 173 for two b-tagged events. They are consistent with the Standard Model background expectation. After selecting the events, Neural Network (NN) discriminant technique is performed to distinguish the signal events from still residual backgrounds. We see no evidence for a Higgs signal in the dijet mass distribution and in the NN output distribution. We set a 95% confidence level upper limit on the W+Higgs production cross section times the branching ratio of the Higgs decaying into a b$\\bar{b}$ pair. We obtained σ(p$\\bar{p}$ → W±H) x BR(H → b$\\bar{b}$) < 1.4 to 0.9 pb for Higgs masses from 110 GeV/c2 to 150 GeV/c2 using the NN output distribution. The limits are about 10

  10. A Measurement of $R = (\\sigma \\cdot B (p\\bar{p} \\to W^\\pm \\to e^\\pm \

    Energy Technology Data Exchange (ETDEWEB)

    Wahl, John Edward [Univ. of Chicago, IL (United States)

    1999-01-01

    We describe the analysis of data from the 1994-1995 collider run (1B) at the Fermi National Laboratory. We measure the ratio R= (σ x B(p$\\bar{p}$ → W → ev)/σ x B(p$\\bar{p}$ → Z → e+e-, at a center of mass of √s = 1800 GeV.

  11. Structures of Ta22W4O67 and Ta74W6O203. Pt. 1. Refined structural models using synchrotron radiation

    International Nuclear Information System (INIS)

    Schmid, S.

    1995-01-01

    The crystal structures of Ta 22 W 4 O 67 [M r = 5788.19, a = 6.1485 (5), b = 47.6205 (12), c = 3.8559 (3) A, γ = 90.04 (1) , space group = C112/m (non-standard setting), Z = 1, D x = 8.513 g cm -3 , F(000) = 2438] and Ta 74 W 6 O 203 [M r = 17741.06, a = 6.1664 (5), b = 29.2717 (14), c = 3.8731 (2) A, space group = Pbam (no. 55), Z = 0.2, D x = 8.428 g cm -3 , F(000) 1494] were determined using synchrotron radiation at four different wavelengths below the Ta L III edge [λ = 1.2741 (-146 eV), λ = 1.2586 (-26 eV), λ = 1.2571 (-14 eV) and λ = 1.2563 A (-8 eV)]. The collection of data immediately below the Ta L III edge at -8 eV enabled resolution of Ta and W of up to eight electrons, which assisted in the refinement of Ta/W ordering for both structures. Bond valence arguments have been used to locate oxygen vacancies required by the formulae. From the largest data set for Ta 22 W 4 O 67 (λ = 1.2741 A), a final value of 0.0481 for R 1 = Σ parallel F obs (h)vertical stroke - vertical stroke F calc (h) parallel /Σvertical stroke F obs (h)vertical stroke was obtained for 3082 unmerged reflections with I(h) > 3σ[I(h)] and for Ta 74 W 6 O 203 (λ = 1.2563 A) a final value of 0.0571 for R 1 was obtained for 5675 unmerged reflections. The two structures are described from a conventional polyhedral perspective as 13- and 8-times superstructures occurring in the solid solution (1-x)Ta 2 O 5 xWO 3 , 0 ≤ x ≤ 0.267. (orig.)

  12. Forward-Weighted CADIS Method for Variance Reduction of Monte Carlo Reactor Analyses

    International Nuclear Information System (INIS)

    Wagner, John C.; Mosher, Scott W.

    2010-01-01

    Current state-of-the-art tools and methods used to perform 'real' commercial reactor analyses use high-fidelity transport codes to produce few-group parameters at the assembly level for use in low-order methods applied at the core level. Monte Carlo (MC) methods, which allow detailed and accurate modeling of the full geometry and energy details and are considered the 'gold standard' for radiation transport solutions, are playing an ever-increasing role in correcting and/or verifying the several-decade-old methodology used in current practice. However, the prohibitive computational requirements associated with obtaining fully converged system-wide solutions restrict the role of MC to benchmarking deterministic results at a limited number of state-points for a limited number of relevant quantities. A goal of current research at Oak Ridge National Laboratory (ORNL) is to change this paradigm by enabling the direct use of MC for full-core reactor analyses. The most significant of the many technical challenges that must be overcome is the slow non-uniform convergence of system-wide MC estimates and the memory requirements associated with detailed solutions throughout a reactor (problems involving hundreds of millions of different material and tally regions due to fuel irradiation, temperature distributions, and the needs associated with multi-physics code coupling). To address these challenges, research has focused on development in the following two areas: (1) a hybrid deterministic/MC method for determining high-precision fluxes throughout the problem space in k-eigenvalue problems and (2) an efficient MC domain-decomposition algorithm that partitions the problem phase space onto multiple processors for massively parallel systems, with statistical uncertainty estimation. The focus of this paper is limited to the first area mentioned above. It describes the FW-CADIS method applied to variance reduction of MC reactor analyses and provides initial results for calculating

  13. Neutron flux of 100kW in the irradiation terminals of the IPR-R1 Triga Reactor

    International Nuclear Information System (INIS)

    Zangirolami, Dante Marco

    2009-01-01

    In this work, it was carried out a study of the neutron flux in the IPR-R1 TRIGA reactor irradiation facilities: rotary specimen rack (RSR), pneumatic transfer tube two (PTT2) and the central thimble (CT). The objective was to obtain the neutron flux profile on the RSR, which has forty irradiation positions, and also values for the thermal and epithermal neutron fluxes of some RSR positions and also of the PTT2 and of the CT facility. It was applied the neutron activation analysis of a reference material, Al-Au (0.1%) alloy. Irradiations were performed on 16 different dates. It was concluded that for the RSR, the average value of thermal and epithermal neutron fluxes depends on the vertical position of the reactor control rods. Neutron flux variations along the RSR form a characteristic profile, whose values depend on the location of the irradiation position in the reactor core and on the control rods vertical position. In the RSR, the obtained values of thermal and epithermal neutron flux were (8.1 +- 0.3) x 10 11 n.cm -2 .s -1 , and (3.4 +- 0.2)x10 10 n.cm -2 .s -1 , respectively. For the PTT2 and the CT, the values for the epithermal neutron flux were respectively (3.3 +- 0.2) x 10 9 n.cm -2 .s -1 and (2.6 +- 0.1) x 10 11 n.cm -2 .s -1 . For these facilities, the thermal neutron flux was estimated, and the obtained values were (2.4 +- 0.2) x 10 11 n.cm -2 .s -1 and (2.8 +- 0.1)x10 12 n.cm -2 .s -1 for the PTT2 and the CT, respectively. (author)

  14. White Matter Fiber-based Analysis of T1w/T2w Ratio Map.

    Science.gov (United States)

    Chen, Haiwei; Budin, Francois; Noel, Jean; Prieto, Juan Carlos; Gilmore, John; Rasmussen, Jerod; Wadhwa, Pathik D; Entringer, Sonja; Buss, Claudia; Styner, Martin

    2017-02-01

    To develop, test, evaluate and apply a novel tool for the white matter fiber-based analysis of T1w/T2w ratio maps quantifying myelin content. The cerebral white matter in the human brain develops from a mostly non-myelinated state to a nearly fully mature white matter myelination within the first few years of life. High resolution T1w/T2w ratio maps are believed to be effective in quantitatively estimating myelin content on a voxel-wise basis. We propose the use of a fiber-tract-based analysis of such T1w/T2w ratio data, as it allows us to separate fiber bundles that a common regional analysis imprecisely groups together, and to associate effects to specific tracts rather than large, broad regions. We developed an intuitive, open source tool to facilitate such fiber-based studies of T1w/T2w ratio maps. Via its Graphical User Interface (GUI) the tool is accessible to non-technical users. The framework uses calibrated T1w/T2w ratio maps and a prior fiber atlas as an input to generate profiles of T1w/T2w values. The resulting fiber profiles are used in a statistical analysis that performs along-tract functional statistical analysis. We applied this approach to a preliminary study of early brain development in neonates. We developed an open-source tool for the fiber based analysis of T1w/T2w ratio maps and tested it in a study of brain development.

  15. White matter fiber-based analysis of T1w/T2w ratio map

    Science.gov (United States)

    Chen, Haiwei; Budin, Francois; Noel, Jean; Prieto, Juan Carlos; Gilmore, John; Rasmussen, Jerod; Wadhwa, Pathik D.; Entringer, Sonja; Buss, Claudia; Styner, Martin

    2017-02-01

    Purpose: To develop, test, evaluate and apply a novel tool for the white matter fiber-based analysis of T1w/T2w ratio maps quantifying myelin content. Background: The cerebral white matter in the human brain develops from a mostly non-myelinated state to a nearly fully mature white matter myelination within the first few years of life. High resolution T1w/T2w ratio maps are believed to be effective in quantitatively estimating myelin content on a voxel-wise basis. We propose the use of a fiber-tract-based analysis of such T1w/T2w ratio data, as it allows us to separate fiber bundles that a common regional analysis imprecisely groups together, and to associate effects to specific tracts rather than large, broad regions. Methods: We developed an intuitive, open source tool to facilitate such fiber-based studies of T1w/T2w ratio maps. Via its Graphical User Interface (GUI) the tool is accessible to non-technical users. The framework uses calibrated T1w/T2w ratio maps and a prior fiber atlas as an input to generate profiles of T1w/T2w values. The resulting fiber profiles are used in a statistical analysis that performs along-tract functional statistical analysis. We applied this approach to a preliminary study of early brain development in neonates. Results: We developed an open-source tool for the fiber based analysis of T1w/T2w ratio maps and tested it in a study of brain development.

  16. Ag@Ag_8W_4O_1_6 nanoroasted rice beads with photocatalytic, antibacterial and anticancer activity

    International Nuclear Information System (INIS)

    Selvamani, Muthamizh; Krishnamoorthy, Giribabu; Ramadoss, Manigandan; Sivakumar, Praveen Kumar; Settu, Munusamy; Ranganathan, Suresh; Vengidusamy, Narayanan

    2016-01-01

    Increasing resistance of pathogens and cancer cell line towards antibiotics and anticancer agents has caused serious health problems in the past decades. Due to these problems in recent years, researchers have tried to combine nanotechnology with material science to have intrinsic antimicrobial and anticancer activity. The metals and metal oxides were investigated with respect to their antimicrobial and anticancer effects towards bacteria and cancer cell line. In the present work metal@metal tungstate (Ag@Ag_8W_4O_1_6 nanoroasted rice beads) is investigated for antibacterial activity against Escherichia coli and Staphylococcus aureus using Mueller-Hinton broth and the anticancer activity against B16F10 cell line was studied. Silver decorated silver tungstate (Ag@Ag_8W_4O_1_6) was synthesized by the microwave irradiation method using Cetyl Trimethyl Ammonium Bromide (CTAB). Ag@Ag_8W_4O_1_6 was characterized by using various spectroscopic techniques. The phase and crystalline nature were analyzed by using XRD. The morphological analysis was carried out using Field Emission Scanning Electron Microscopy (FE-SEM), and High Resolution Transmission Electron Microscopy (HR-TEM). Further, Fourier Transform Infrared Spectroscopy (FT-IR) and Raman spectral analysis were carried out in order to ascertain the presence of functional groups in Ag@Ag_8W_4O_1_6. The optical property was investigated using Diffuse Reflectance Ultraviolet–Visible Spectroscopy (DRS-UV–Vis) and the band gap was found to be 3.08 eV. Surface area of the synthesized Ag@Ag_8W_4O_1_6 wasanalyzed by BET analysis and Ag@Ag_8W_4O_1_6 was utilized for the degradation of organic dyes methylene blue and rhodamine B. The morphology of the Ag@Ag_8W_4O_1_6 resembles roasted rice beads with breath and length in nm range. The oxidation state of tungsten (W) and silver (Ag) was investigated using X-ray photoelectron spectroscopy (XPS). - Highlights: • Synthesis of Ag@Ag_8W_4O_1_6 nanoroasted rice beads using

  17. The Synthesis and Characterization of W- 1wt.% TiC Alloy Using a Chemical Method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Taehee; Ryu, Ho Jin [KAIST, Daejeon (Korea, Republic of)

    2016-10-15

    The tungsten and its alloys have been used in many applications due to their excellent mechanical and thermal properties such as high melting point, high thermal conductivity, high strength at elevated temperatures, low sputtering yield in radiation environment and low tritium inventory. Moreover, many researchers consider tungsten alloys as the most promising candidate for plasma facing components for future nuclear fusion reactors. Three samples of W1.0 wt.% TiC composites with the different fabrication methods were successfully developed. The combined method of the wet chemical method and 3D mixing showed small amount of agglomeration of TiC particles, however, the TiC particle sizes were smaller than 3DM1 sample. Since the WCM1 showed the better mechanical property, microhardness, the main future plan is to achieve the same or improved mechanical property of W3D1.

  18. Thermal-Fatigue Analysis of W-joined Ferritic-Martensitic Steel Mockup for Fusion Reactor Components

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Dong Won; Jin, Hyung Gon; Lee, Eo Hwak; Yoon, Jae Sung; Kim, Suk Kwon; Park, Seong Dae [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Shin, Kyu In [Gentec Co., Daejeon (Korea, Republic of); Moon, Se Yeon; Hong, Bong Guen [Chonbuk National University, Chonbuk (Korea, Republic of)

    2015-10-15

    Through the ITER blanket first wall (BFW) development project in Korea, the joining methods were developed with a beryllium (Be) layer as a plasma-facing material, a copper alloy (CuCrZr) layer as a heat sink, and type 316L austenitic stainless steel (SS316L) as a structural material. And joining methods were developed such as Be as an armor and FMS as a structural material, or W as an armor and FMS as a structural material were developed through the test blanket module (TBM) program. As a candidate of PFC for DEMO, W/FMS joining methods have been developed and a new Ti interlayer was applied differently from the previous work. In the present study, the W/FMS PFC development was introduced with the following procedure to apply to the PFCs for a fusion reactor: (1) Three W/FMS mockups were fabricated using the developed HIP followed by a post-HIP heat treatment (PHHT). (2) Because the High Heat Flux (HHF) test should be performed over the thermal lifetime of the mockup under the proper test conditions to confirm the joint's integrity, the test conditions were determined through a preliminary analysis. In this study, commercial ANSYS-CFX for thermalhydraulic analysis and ANSYS-mechanical for the thermo-mechanical analysis are used to evaluate the thermal-lifetime of the mockup to determine the test conditions. Also, the Korea Heat Load Test facility with an Electron Beam (KoHLT-EB) will be used and its water cooling system is considered to perform the thermal-hydraulic analysis especially for considering the two-phase analysis with a higher heat flux conditions. From the analysis, the heating and the cooling conditions were determined for 0.5- and 1.0-MW/m{sup 2} heat fluxes, respectively. Elastic-plastic analysis is performed to determine the lifetime and finally, the 1.0 MW/m{sup 2} heat flux conditions are determined up to 4,306 cycles. The test will be done in the near future and the measured temperatures will be compared with the present simulation results.

  19. Determination of the lowest critical power levels of the Dalat Nuclear Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Huy, Ngo Quang [Centre for Nuclear Technique Application, Ho Chi Minh City (Viet Nam); Thong, Ha Van; Long, Vu Hai; Binh, Do Quang; Nghiem, Huynh Ton; Tuan, Nguyen Minh; Vien, Luong Ba; Vinh, Le Vinh [Nuclear Research Inst., Da Lat (Viet Nam)

    1994-10-01

    This paper presents the experimental methods for determining critical states of the Dalat Nuclear Research Reactor containing an extraneous neutron source induced by gamma ray reactions on beryllium in the reactor. The lowest critical power levels are measured at various moments after the reactor is shut down following 100 hours of its continuous operation. Th power levels vary from (0.5-1.2) x 10{sup -4} of P{sub n}, i.e. (25-60)W to (1.1-1.6) x 10{sup -5} of P{sub n}, i.e. (5.5-8)W at corresponding times of 4 days to 13 days after the reactor is shut down. However the critical power must be chosen greater than 500 W to sustain the steady criticality of the reactor for a long time. (author). 3 refs. 4 figs. 1 tab.

  20. W.E.B. DuBois's Challenge to Scientific Racism.

    Science.gov (United States)

    Taylor, Carol M.

    1981-01-01

    Proposes that a direct and authoritative challenge to the scientific racism of the late eighteenth and early twentieth centuries was urgently needed, and was one of the leading rhetorical contributions of W.E.B. DuBois. Specifically examines three issues: social Darwinism, the eugenics movement, and psychologists' measurement of intelligence.…

  1. Angiogeneza w reumatoidalnym zapaleniu stawów

    Directory of Open Access Journals (Sweden)

    Anna Kotulska

    2011-02-01

    Full Text Available Angiogeneza jest procesem powstawania nowych włosowatychnaczyń krwionośnych z uprzednio istniejących włośniczek. Angiogenezawystępuje w życiu pozapłodowym i jest regulowana przezzespół czynników proangiogennych i antyangiogennych (tab. I.Zwiększona angiogeneza towarzyszy kilku stanom chorobowym. Jestniezbędna dla wzrostu nowotworów złośliwych. Choroby nienowotworowe,w tym reumatoidalne zapalenie stawów, są także związanez nasiloną angiogenezą. Wykazano tworzenie nowych naczyńw zmienionej zapalnie błonie maziowej stawów, co jest najważniejszązmianą patologiczną u chorych na reumatoidalne zapalenie stawów.U chorych stwierdzono zaburzoną regulację czynników proangiogennychi hamujących ten proces. Leki hamujące zapalenie błonymaziowej bezpośrednio lub pośrednio ograniczają angiogenezę.Możliwe jest, że oddziaływanie na proces angiogenezy będzie stanowićjeden z mechanizmów terapeutycznych leków stosowanychu chorych na reumatoidalne zapalenie stawów.

  2. Dual-mode cultivation of Chlorella protothecoides applying inter-reactors gas transfer improves microalgae biodiesel production.

    Science.gov (United States)

    Santos, C A; Nobre, B; Lopes da Silva, T; Pinheiro, H M; Reis, A

    2014-08-20

    Chlorella protothecoides, a lipid-producing microalga, was grown heterotrophically and autotrophically in separate reactors, the off-gases exiting the former being used to aerate the latter. Autotrophic biomass productivity with the two-reactor association, 0.0249gL(-1)h(-1), was 2.2-fold the value obtained in a control autotrophic culture, aerated with ambient air. Fatty acid productivity was 1.7-fold the control value. C. protothecoides heterotrophic biomass productivity was 0.229gL(-1)h(-1). This biomass' fatty acid content was 34.5% (w/w) with a profile suitable for biodiesel production, according to European Standards. The carbon dioxide fixed by the autotrophic biomass was 45mgCO2L(-1)h(-1) in the symbiotic arrangement, 2.1 times the control reactor value. The avoided CO2 atmospheric emission represented 30% of the CO2 produced in the heterotrophic stage, while the released O2 represented 49% of the oxygen demand in that stage. Thus, an increased efficiency in the glucose carbon source use and a higher environmental sustainability were achieved in microalgal biodiesel production using the proposed assembly. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Spent fuel management - two alternatives at the FiR 1 reactor

    International Nuclear Information System (INIS)

    Salmenhaara, S.E.J.

    2001-01-01

    The FiR 1 -reactor, a 250 kW Triga reactor, has been in operation since 1962. The reactor with its subsystems has experienced a large renovation work in 1996-97. The main purpose of the upgrading was to install the new Boron Neutron Capture Therapy (BNCT) irradiation facility. The BNCT work dominates the current utilization of the reactor: four days per week for BNCT purposes and only one day per week for neutron activation analysis and isotope production. The Council of State (government) granted for the reactor a new operating license for twelve years starting from the beginning of the year 2000. There is however a special condition in the new license. We have to achieve a binding agreement between our Research Centre and the domestic Nuclear Power Plant Companies about the possibility to use the final disposal facility of the Nuclear Power Plants for our spent fuel, if we want to continue the reactor operation beyond the year 2006. In addition to the choosing of one of the spent fuel management alternatives the future of the reactor will also depend strongly on the development of the BNCT irradiations. If the number of patients per year increases fast enough and the irradiations of the patients will be economically justified, the operation of the reactor will continue independently of the closing of the USDOE alternative in 2006. Otherwise, if the number of patients will be low, the funding of the reactor will be probably stopped and the reactor will be shut down. (author)

  4. EphB1 as a Novel Drug Target to Combat Pain and Addiction

    Science.gov (United States)

    2016-09-01

    Award Number: W81XWH-14-1-0220 Project Title: EphB1 as a Novel Drug Target to Combat Pain and Addiction Principal Investigator Name: Mark...Pain and Addiction 5a. CONTRACT NUMBER EphB1 as a Novel Drug Target to Combat Pain and Addiction 5b. GRANT NUMBER W81XWH-14-1-0220 5c. PROGRAM...SUBJECT TERMS Chronic neuropathic pain, opioid addiction , synaptic plasticity, EphB1 receptor, ephrin-B2, NMDA receptor, drug discovery 16. SECURITY

  5. HBV X Protein induces overexpression of HERV-W env through NF-κB in HepG2 cells.

    Science.gov (United States)

    Liu, Cong; Liu, Lijuan; Wang, Xiuling; Liu, Youyi; Wang, Miao; Zhu, Fan

    2017-12-01

    Human endogenous retrovirus W family (HERV-W) envelope (env) at chromosome 7 is highly expressed in the placenta and possesses fusogenic activity in trophoblast development. HERV-W env has been found to be overexpressed in some cancers and immune diseases. Viral transactivators can induce the overexpression of HERV-W env in human cell lines. Hepatitis B virus X protein (HBx) is believed to be a multifunctional oncogenic protein. Here, we reported that HBx could increase the promoter activity of HERV-W env and upregulate the mRNA levels of non-spliced and spliced HERV-W env and also its protein in human hepatoma HepG2 cells. Interestingly, we found that the inhibition of nuclear factor κB (NF-κB) using shRNA targeting NF-κB/p65 or PDTC (an inhibitor of NF-κB) could attenuate the upregulation of HERV-W env induced by HBx. These suggested that HBx might upregulate the expression of HERV-W env through NF-κB in HepG2 cells. This study might provide a new insight in HBV-associated liver diseases including HCC.

  6. Genomes of Candidatus Wolbachia bourtzisii wDacA and Candidatus Wolbachia pipientis wDacB from the Cochineal Insect Dactylopius coccus (Hemiptera: Dactylopiidae

    Directory of Open Access Journals (Sweden)

    Shamayim T. Ramírez-Puebla

    2016-10-01

    Full Text Available Dactylopius species, known as cochineal insects, are the source of the carminic acid dye used worldwide. The presence of two Wolbachia strains in Dactylopius coccus from Mexico was revealed by PCR amplification of wsp and sequencing of 16S rRNA genes. A metagenome analysis recovered the genome sequences of Candidatus Wolbachia bourtzisii wDacA (supergroup A and Candidatus Wolbachia pipientis wDacB (supergroup B. Genome read coverage, as well as 16S rRNA clone sequencing, revealed that wDacB was more abundant than wDacA. The strains shared similar predicted metabolic capabilities that are common to Wolbachia, including riboflavin, ubiquinone, and heme biosynthesis, but lacked other vitamin and cofactor biosynthesis as well as glycolysis, the oxidative pentose phosphate pathway, and sugar uptake systems. A complete tricarboxylic acid cycle and gluconeogenesis were predicted as well as limited amino acid biosynthesis. Uptake and catabolism of proline were evidenced in Dactylopius Wolbachia strains. Both strains possessed WO-like phage regions and type I and type IV secretion systems. Several efflux systems found suggested the existence of metal toxicity within their host. Besides already described putative virulence factors like ankyrin domain proteins, VlrC homologs, and patatin-like proteins, putative novel virulence factors related to those found in intracellular pathogens like Legionella and Mycobacterium are highlighted for the first time in Wolbachia. Candidate genes identified in other Wolbachia that are likely involved in cytoplasmic incompatibility were found in wDacB but not in wDacA.

  7. Linarin isolated from Buddleja officinalis prevents hydrogen peroxide-induced dysfunction in osteoblastic MC3T3-E1 cells.

    Science.gov (United States)

    Kim, Young Ho; Lee, Young Soon; Choi, Eun Mi

    2011-01-01

    The flowers and leaves buds of Buddleja officinalis MAXIM (Buddlejaceae) are used to treat eye troubles, hernia, gonorrhea and liver troubles in Asia. To elucidate the protective effects of linarin isolated from B. officinalis on the response of osteoblast to oxidative stress, osteoblastic MC3T3-E1 cells were pre-incubated with linarin for 1h before treatment with 0.3mM H(2)O(2) for 48h, and markers of osteoblast function and oxidative damage were examined. Linarin significantly (P<0.05) increased cell survival, alkaline phosphatase (ALP) activity, collagen content, calcium deposition, and osteocalcin secretion and decreased the production of receptor activator of nuclear factor-kB ligand (RANKL), protein carbonyl (PCO), and malondialdehyde (MDA) of osteoblastic MC3T3-E1 cells in the presence of hydrogen peroxide. These results demonstrate that linarin can protect osteoblasts against hydrogen peroxide-induced osteoblastic dysfunction and may exert anti-resorptive actions, at least in part, via the reduction of RANKL and oxidative damage. 2011 Elsevier Inc. All rights reserved.

  8. Przezskórna elektrostymulacja nerwów (TENS w leczeniu zespołów bólowych kręgosłupa lędźwiowo-krzyżowego = Transcutaneous electrical nerve stimulation (TENS in the treatment of low back pain

    Directory of Open Access Journals (Sweden)

    Magdalena Weber-Rajek

    2016-03-01

        Streszczenie Wstęp Bóle kręgosłupa lędźwiowo-krzyżowego są poważnym problemem medycznym i społecznym. Fizjoterapia jest nieodzownym elementem leczenia zespołów bólowych kręgosłupa. Metodą, która zdobywa coraz większe uznanie wśród fizjoterapeutów, a także wśród pacjentów jest stymulacja TENS (transcutaneus electrical nerve stimulation. Cel badań Celem niniejszej pracy była ocena skuteczności terapii TENS w terapii zespołów bólowych kręgosłupa lędźwiowo-krzyżowego. Materiał i Metody Badania przeprowadzono w grupie czterdziestu pacjentów w wieku 30 - 60 lat (średnia wieku 45 lat. Bezpośrednio przed oraz po zakończeniu terapii u wszystkich pacjentów wykonano: ocenę dolegliwości bólowych przy użyciu skali VAS, ocenę natężenia i częstotliwości bólu, ilości stosowanych leków przeciwbólowych, ograniczenia aktywności ruchowej przy użyciu kwestionariusza Laitinena, test Schobera oceniający zakres zgięcia kręgosłupa lędźwiowo-krzyżowego. Analizę statystyczną przeprowadzono wykorzystując pakiet PQStat wersja 1.4.8. Normalność rozkładu zmiennych sprawdzano testem Shapiro-Wilka. W celu porównania wyników otrzymanych w testach przed terapią z wynikami otrzymanymi po terapii  przeprowadzono test Wilcoxona na poziomie istotności α = 0,05. Wyniki Uzyskano istotne statystycznie zmniejszenie intensywności i częstotliwości bólu, zmniejszenie ilości stosowanych leków przeciwbólowych, zmniejszenie ograniczenia aktywności ruchowej oraz zwiększenie zakresu zgięcia kręgosłupa lędźwiowo-krzyżowego. Wnioski Stymulacja TENS jest skutecznym zabiegiem w leczeniu zespołów bólowych kręgosłupa lędźwiowo-krzyżowego.   Słowa kluczowe: przezskórna stymulacja nerwów (TENS, zespoły bólowe kręgosłupa lędźwiowo-krzyżowego.   Summary Introduction Low back pain is a serious medical and social problem. Physiotherapy is the indispensable component of treatment of back pains. A method that is

  9. Diatom evidence for the onset of Pliocene cooling from AND-1B, McMurdo Sound, Antarctica

    Science.gov (United States)

    Riesselman, Christina; Dunbar, R. B.

    2013-01-01

    The late Pliocene, ~ 3.3–3.0 Ma, is the most recent interval of sustained global warmth in the geologic past. This window is the focus of climate reconstruction efforts by the U.S. Geological Survey's Pliocene Research, Interpretation, and Synoptic Mapping (PRISM) Data/Model Cooperative, and may provide a useful climate analog for the coming century. Reconstructions of past surface ocean conditions proximal to the Antarctic continent are essential to understanding the sensitivity of the cryosphere to this key interval in Earth's climate evolution. An exceptional marine sediment core collected from the southwestern Ross Sea (78° S), Antarctica, during ANDRILL's McMurdo Ice Shelf Project preserves evidence of dramatic fluctuations between grounded ice and productive, open ocean conditions during the late Pliocene, reflecting orbitally-paced glacial/interglacial cycling. In this near-shore record, diatom-rich sediments are recovered from interglacial intervals; two of these diatomites, from ~ 3.2 Ma and 3.03 Ma, are within the PRISM chronologic window. The diatom assemblages identified in PRISM-age late Pliocene diatom-rich sediments are distinct from those in mid-Pliocene and later Pliocene/Pleistocene intervals recovered from AND-1B, and comprise both extant taxa with well-constrained ecological preferences and a diverse extinct flora, some members of which are previously undescribed from Antarctic sediments. Both units are dominated by Chaetoceros resting spores, an indicator of high productivity and stratification that is present at much lower abundance in materials both older and younger than the PRISM-age sediments. Newly described species of the genus Fragilariopsis, which first appear in the AND-1B record at 3.2 Ma, are the most abundant extinct members of the PRISM-age assemblages. Other extant species with established environmental affinities, such as Fragilariopsis sublinearis, F. curta, Stellarima microtrias, and Thalassiothrix antarctica, are

  10. Testing ENDF/B-V data for thermal reactors

    International Nuclear Information System (INIS)

    Craig, D.S.

    1982-10-01

    Lattice parameters have been calculated for some thermal reactor benchmark lattices using ENDF/B-V data. These lattices were TRX-1, -2; BAPL-UO 2 -1,-2,-3; BNL-ThO 2 - 233 UO 2 -H 2 0-1,-2,-3; MIT-4,-5,-6; and PNL-31,-33,-35 (infinite lattices). In addition, parameters were calculated for 3 ZEEP lattices, 3 High-Conversion U0 2 -H 2 0 lattices, and 7 BNL-Th0 2 - 233 U0 2 -D 2 0 lattices. These calculations were made using the integral transport cell code RAHAB with the resonance reaction rates obtained using the OZMA code operating in the discrete ordinate mode. This code calculates the resonance rates allowing for the interaction of all resonances. Four group reaction rates for use in method comparisons are given for several lattices. The author discusses the use of the OZMA code for these calculations, including the choice of options and the orders of the angular quadratures, and compares results obtained using the CRNL thermal scattering data with those obtained using ENDF/B data

  11. Application of a new cross section library based on ENDF/B-IV to reactor core analysis

    International Nuclear Information System (INIS)

    Lima Bezerra, J. de.

    1991-04-01

    The use of the ENDF/B-IV library in the LEOPARD code for the Angra-1 reactor simulation is presented. The results are compared to those obtained using the ENDF/B-II library and show better values for the power distribution but an underestimated global reactivity as compared to experimental results. (F.E.). 1 ref, 55 figs, 1 tab

  12. Fast-reactor-data testing of ENDF/B-V at ORNL

    International Nuclear Information System (INIS)

    Wright, R.Q.; Ford, W.E. III; Lucius, J.L.; Webster, C.C.; Marable, J.H.

    1982-01-01

    The Cross Section Evaluation Working Group (CSEWG) is coordinating a program to assess the adequacy of ENDF/B-V cross sections for both fast- and thermal-reactor design applications. A secondary goal is to evaluate cross-section processing codes, cross-section libraries, and radiation-transport codes. Fast reactor data testing (FRDT) goals are accomplished, in part, by comparison of calculated results with documented performance parameters of CSEWG fast reactor benchmarks and with results obtained by other data testers. The purpose of this paper is to describe the results of FRDT at Oak Ridge National Laboratory

  13. Assessment of a RELAP5 model for the IPR-R1 TRIGA research reactor

    International Nuclear Information System (INIS)

    Reis, Patricia A.L.; Costa, Antonella L.; Pereira, Claubia; Veloso, Maria A.F.; Mesquita, Amir Z.; Soares, Humberto V.

    2010-01-01

    RELAP5 code was developed at the Idaho National Environmental and Engineering Laboratory and it is widely used for thermal hydraulic studies of commercial nuclear power plants and, currently, it has been also applied for thermal hydraulic analysis of nuclear research systems with good predictions. This work is a contribution to the assessment of RELAP5/3.3 code for research reactors analysis. It presents steady-state and transient calculation results performed using a RELAP5 model to simulate the IPR-R1 TRIGA research reactor conditions operating at 50 and 100 kW. The reactor is located at the Nuclear Technology Development Centre (CDTN), Brazil. The development and the assessment of a RELAP5 model for the IPR-R1 TRIGA are presented. Experimental data were considered in the process of code-to-data validation. The RELAP5 results were also compared with calculation performed using the STHIRP-1 (Research Reactors Thermal Hydraulic Simulation) code. The use of a cross flow model has been essential to improve results in the transient condition respect to preceding investigations.

  14. Highly hard yet toughened bcc-W coating by doping unexpectedly low B content

    KAUST Repository

    Yang, Lina

    2017-08-18

    Either hardness or toughness has been the core interest in scientific exploration and technological pursuit for a long time. However, it is still a big challenge to enhance the hardness and toughness at the same time, since the improvement of one side is always at the expense of the other one. Here, we have succeeded in dealing with this pair of conflict based on tungsten (W) coating by doping boron (B) via magnetron co-sputtering. The results reveal that the introduction of low concentrations of B (6.3 at. %), in the doping regime, leads to the formation of W(B) supersaturated solid solution with refined grains. Meanwhile, the doping-induced higher compressive stress, higher H/E* and denser microstructure result in a surprising combination of improved hardness (2 × larger than pure W) and superior toughness (higher crack formation threshold compared to pure W). We believe this is an innovative sight to design new generation of transition-metal-based multifunctional coatings. Besides, our results are applicable for industrial application because it can be realized by simple manufacturing approaches, e.g. magnetron sputtering technology.

  15. Dolegliwości bólowe pleców u kobiet w ciąży – doniesienie wstępne = The back pain in pregnant women – a preliminary report

    Directory of Open Access Journals (Sweden)

    Anna Bogusława Pilewska-Kozak

    2017-02-01

    Pilewska–Kozak Anna Bogusława1, Stadnicka Grażyna2, Łepecka–Klusek Celina1, Dobrowolska Beata3, Pałucka Klaudia1, Pawłowska-Muc Agnieszka Konstancja4, Kozak Łukasz Adam5       1 Katedra i Klinika Ginekologii i Endokrynologii Ginekologicznej Wydział Nauk o Zdrowiu Uniwersytet Medyczny w Lublinie 2 Zakład Podstaw Położnictwa Wydział Nauk o Zdrowiu Uniwersytet Medyczny w Lublinie 3 Katedra Rozwoju Pielęgniarstwa Wydział Nauk o Zdrowiu Uniwersytet Medyczny w Lublinie 4  Powiatowe Centrum Medyczne w Grójcu Sp. z o. o 5 Oddział Urazowo – Ortopedyczny z Chirurgią Kręgosłupa Samodzielnego Publicznego Szpitala Wojewódzkiego w Chełmie       Adres do korespondencji: Dr n. med. Anna B. Pilewska-Kozak ul. Aleje Racławickie 23, 20-049 Lublin e-mail: apilewska@poczta.wp.pl tel. 26 118 32 86       Streszczenie   Badaniami objęto 80 kobiet między25. a36. tygodniem ciąży, uczestniczących w zajęciach szkół rodzenia. Wiek kobiet wahał się w granicach od 19 do 42 lat (średnia wieku wynosiła 27,8 ± 4 lata. Wykorzystano kwestionariusz ankiety, własnej konstrukcji oraz wizualną analogową skalę VAS (0 – brak bólu do 10- ból nie do wytrzymania do oceny bólu kręgosłupa. Celem pracy było sprawdzenie czy u kobiet w ciąży występuje ból kręgosłupa oraz w jakich sytuacjach się nasila. Na podstawie przeprowadzonych badań stwierdzono, że większości kobiet odczuwała ból kręgosłupa w odcinku lędźwiowym. Wśród sytuacji nasilających dolegliwość najwięcej wymieniało pozycję stojącą, co trzecia siedzącą, a co piąta chodzenie.   Słowa kluczowe: ból kręgosłupa, ciąża     Summary             The study involved 80 women between the 25th and 36th week of pregnancy attending antenatal classes. The age of women ranged from 19 to 42 years old (the age median was 27,8 ± 4 years. The questionnaire of our own design and the Visual Analogue Scale VAS (0 – no pain to 10 - unbearable pain were used to

  16. Measurement of the cross-section for W boson production in association with b-jets in pp collisions at $\\sqrt{s}$ = 7 TeV with the ATLAS detector

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdelalim, Ahmed Ali; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Ochoa, Ines; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adragna, Paolo; Adye, Tim; Aefsky, Scott; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahles, Florian; Ahmad, Ashfaq; Ahsan, Mahsana; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Andrieux, Marie-Laure; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aoun, Sahar; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Artamonov, Andrei; Artoni, Giacomo; Arutinov, David; Asai, Shoji; Ask, Stefan; Åsman, Barbro; Asner, David; Asquith, Lily; Assamagan, Ketevi; Astbury, Alan; Atkinson, Markus; Aubert, Bernard; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, David; Azuelos, Georges; Azuma, Yuya; Baak, Max; Baccaglioni, Giuseppe; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Piyali; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Bardin, Dmitri; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartsch, Valeria; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battaglia, Andreas; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beale, Steven; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Becks, Karl-Heinz; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Begel, Michael; Behar Harpaz, Silvia; Behera, Prafulla; Beimforde, Michael; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Benoit, Mathieu; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Berry, Tracey; Bertella, Claudia; Bertin, Antonio; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biscarat, Catherine; Bittner, Bernhard; Black, Curtis; Black, James; Black, Kevin; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blocki, Jacek; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boek, Thorsten Tobias; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Bolnet, Nayanka Myriam; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borjanovic, Iris; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Branchini, Paolo; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Bremer, Johan; Brendlinger, Kurt; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brown, Gareth; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchanan, James; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Büscher, Volker; Bugge, Lars; Bulekov, Oleg; Bundock, Aaron Colin; Bunse, Moritz; Buran, Torleiv; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burke, Stephen; Busato, Emmanuel; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Byszewski, Marcin; Cabrera Urbán, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Cantrill, Robert; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capriotti, Daniele; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Cascella, Michele; Caso, Carlo; Castaneda-Miranda, Elizabeth; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Cataldi, Gabriella; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cavaliere, Viviana; Cavalleri, Pietro; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chan, Kevin; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Chapman, John Wehrley; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Shenjian; Chen, Xin; Chen, Yujiao; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Cheung, Sing-Leung; Chevalier, Laurent; Chiefari, Giovanni; Chikovani, Leila; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Choudalakis, Georgios; Chouridou, Sofia; Christidi, Ilektra-Athanasia; Christov, Asen; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirilli, Manuela; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Colas, Jacques; Cole, Stephen; Colijn, Auke-Pieter; Collins, Neil; Collins-Tooth, Christopher; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Courneyea, Lorraine; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Crescioli, Francesco; Cristinziani, Markus; Crosetti, Giovanni; Crépé-Renaudin, Sabine; Cuciuc, Constantin-Mihai; Cuenca Almenar, Cristóbal; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Curtis, Chris; Cuthbert, Cameron; Cwetanski, Peter; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Damiani, Daniel; Danielsson, Hans Olof; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Dassoulas, James; Davey, Will; Davidek, Tomas; Davidson, Nadia; Davidson, Ruth; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; De Zorzi, Guido; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Degenhardt, James; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demirkoz, Bilge; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Devetak, Erik; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Luise, Silvestro; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dinut, Florin; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Barros do Vale, Maria Aline; Do Valle Wemans, André; Doan, Thi Kieu Oanh; Dobbs, Matt; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Doi, Yoshikuni; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Dohmae, Takeshi; Donadelli, Marisilvia; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dotti, Andrea; Dova, Maria-Teresa; Doxiadis, Alexander; Doyle, Tony; Dressnandt, Nandor; Dris, Manolis; Dubbert, Jörg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Dührssen, Michael; Duerdoth, Ian; Duflot, Laurent; Dufour, Marc-Andre; Duguid, Liam; Dunford, Monica; Duran Yildiz, Hatice; Duxfield, Robert; Dwuznik, Michal; Düren, Michael; Ebenstein, William; Ebke, Johannes; Eckweiler, Sebastian; Edson, William; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Engelmann, Roderich; Engl, Albert; Epp, Brigitte; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Fabre, Caroline; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farley, Jason; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Fenyuk, Alexander; Ferencei, Jozef; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filthaut, Frank; Fincke-Keeler, Margret; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Gordon; Fisher, Matthew; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleckner, Johanna; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Fonseca Martin, Teresa; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fowler, Andrew; Fox, Harald; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Frank, Tal; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gadatsch, Stefan; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Gan, KK; Gao, Yongsheng; Gaponenko, Andrei; Garberson, Ford; Garcia-Sciveres, Maurice; García, Carmen; García Navarro, José Enrique; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gerlach, Peter; Gershon, Avi; Geweniger, Christoph; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Adam; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Ginzburg, Jonatan; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giunta, Michele; Gjelsten, Børge Kile; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glonti, George; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goebel, Martin; Göpfert, Thomas; Goeringer, Christian; Gössling, Claus; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gosselink, Martijn; Gostkin, Mikhail Ivanovitch; Gough Eschrich, Ivo; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramstad, Eirik; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenshaw, Timothy; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Groth-Jensen, Jacob; Grybel, Kai; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gunther, Jaroslav; Guo, Bin; Guo, Jun; Gutierrez, Phillip; Guttman, Nir; Gutzwiller, Olivier; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haas, Stefan; Haber, Carl; Hadavand, Haleh Khani; Hadley, David; Haefner, Petra; Hajduk, Zbigniew; Hakobyan, Hrachya; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Handel, Carsten; Hanke, Paul; Hansen, John Renner; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Hartert, Jochen; Hartjes, Fred; Haruyama, Tomiyoshi; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayakawa, Takashi; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, Robert; Henke, Michael; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Hensel, Carsten; Medina Hernandez, Carlos; Hernández Jiménez, Yesenia; Herrberg, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirsch, Florian; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hohlfeld, Marc; Holmgren, Sven-Olof; Holy, Tomas; Holzbauer, Jenny; Hong, Tae Min; Hooft van Huysduynen, Loek; Horner, Stephan; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibbotson, Michael; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Idarraga, John; Iengo, Paolo; Igonkina, Olga; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Jantsch, Andreas; Janus, Michel; Jared, Richard; Jarlskog, Göran; Jeanty, Laura; Jen-La Plante, Imai; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Loevschall-Jensen, Ask Emil; Jež, Pavel; Jézéquel, Stéphane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansen, Marianne; Johansson, Erik; Johansson, Per; Johnert, Sebastian; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Joram, Christian; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Jovin, Tatjana; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Juranek, Vojtech; Jussel, Patrick; Juste Rozas, Aurelio; Kabana, Sonja; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kalinin, Sergey; Kalinovskaya, Lidia; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karagounis, Michael; Karakostas, Konstantinos; Karnevskiy, Mikhail; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Keener, Paul; Kehoe, Robert; Keil, Markus; Kekelidze, George; Keller, John; Kenyon, Mike; Keoshkerian, Houry; Kepka, Oldrich; Kerschen, Nicolas; Kerševan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kitamura, Takumi; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klemetti, Miika; Klier, Amit; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Klous, Sander; Kluge, Eike-Erik; Kluge, Thomas; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Ko, Byeong Rok; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Köneke, Karsten; König, Adriaan; Koenig, Sebastian; Köpke, Lutz; Koetsveld, Folkert; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohn, Fabian; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolachev, Guennady; Kolanoski, Hermann; Kolesnikov, Vladimir; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kono, Takanori; Kononov, Anatoly; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Krejci, Frantisek; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Mark; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laisne, Emmanuel; Lambourne, Luke; Lampen, Caleb; Lampl, Walter; Lancon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larner, Aimee; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Michel; Legendre, Marie; Legger, Federica; Leggett, Charles; Lehmacher, Marc; Lehmann Miotto, Giovanna; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatiana; Lenzen, Georg; Lenzi, Bruno; Leonhardt, Kathrin; Leontsinis, Stefanos; Lepold, Florian; Leroy, Claude; Lessard, Jean-Raphael; Lester, Christopher; Lester, Christopher Michael; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Dong; Liu, Jianbei; Liu, Lulu; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lo Sterzo, Francesco; Losty, Michael; Lou, XinChou; Lounis, Abdenour; Loureiro, Karina; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Dörthe; Ludwig, Inga; Ludwig, Jens; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lund, Esben; Lund-Jensen, Bengt; Lundberg, Björn; Lundberg, Johan; Lundberg, Olof; Lundquist, Johan; Lungwitz, Matthias; Lynn, David; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Maček, Boštjan; Machado Miguens, Joana; Macina, Daniela; Mackeprang, Rasmus; Madar, Romain; Madaras, Ronald; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander Kondrup; Maeno, Mayuko; Maeno, Tadashi; Mättig, Peter; Mättig, Stefan; Magnoni, Luca; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Malecki, Piotr; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Manabe, Atsushi; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Alessandro; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marroquim, Fernando; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian Thomas; Martin, Jean-Pierre; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martin-Haugh, Stewart; Martinez, Homero; Martinez, Mario; Martinez Outschoorn, Verena; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Matsunaga, Hiroyuki; Matsushita, Takashi; Mattravers, Carly; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazur, Michael; Mazzaferro, Luca; Mazzanti, Marcello; Mc Donald, Jeffrey; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meehan, Samuel; Meera-Lebbai, Razzak; Meguro, Tatsuma; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mendoza Navas, Luis; Meng, Zhaoxia; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Michal, Sebastien; Micu, Liliana; Middleton, Robin; Migas, Sylwia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Miller, David; Miller, Robert; Mills, Bill; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Milutinovic-Dumbelovic, Gordana; Minaenko, Andrey; Miñano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Moeller, Victoria; Mönig, Klaus; Möser, Nicolas; Mohapatra, Soumya; Mohr, Wolfgang; Moles-Valls, Regina; Molfetas, Angelos; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Moorhead, Gareth; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Morello, Gianfranco; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mueller, Felix; Mueller, James; Mueller, Klemens; Müller, Thomas; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newcomer, Mitchel; Newman, Paul; Nguyen, Duong Hai; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Niedercorn, Francois; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsen, Henrik; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Oda, Susumu; Odaka, Shigeru; Odier, Jerome; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Osuna, Carlos; Otero y Garzon, Gustavo; Ottersbach, John; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Paleari, Chiara; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Papadelis, Aras; Papadopoulou, Theodora; Paramonov, Alexander; Paredes Hernandez, Daniela; Park, Woochun; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pashapour, Shabnaz; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedraza Lopez, Sebastian; Pedraza Morales, Maria Isabel; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penson, Alexander; Penwell, John; Perantoni, Marcelo; Perez, Kerstin; Perez Cavalcanti, Tiago; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Perrodo, Pascal; Peshekhonov, Vladimir; Peters, Krisztian; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petschull, Dennis; Petteni, Michele; Pezoa, Raquel; Phan, Anna; Phillips, Peter William; Piacquadio, Giacinto; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pizio, Caterina; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poblaguev, Andrei; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Poll, James; Polychronakos, Venetios; Pomeroy, Daniel; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospelov, Guennady; Pospisil, Stanislav; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Pretzl, Klaus Peter; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Puldon, David; Purdham, John; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Quadt, Arnulf; Quarrie, David; Quayle, William; Raas, Marcel; Radeka, Veljko; Radescu, Voica; Radloff, Peter; Ragusa, Francesco; Rahal, Ghita; Rahimi, Amir; Rahm, David; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Randrianarivony, Koloina; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reinsch, Andreas; Reisinger, Ingo; Relich, Matthew; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter-Was, Elzbieta; Ridel, Melissa; Rieck, Patrick; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Rios, Ryan Randy; Ritsch, Elmar; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Roe, Adam; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romeo, Gaston; Romero Adam, Elena; Rompotis, Nikolaos; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosenbaum, Gabriel; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rosselet, Laurent; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Ruckstuhl, Nicole; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rumyantsev, Leonid; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ruzicka, Pavel; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvachua Ferrando, Belén; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Samset, Björn Hallvard; Sanchez, Arturo; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santamarina Rios, Cibran; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Saraiva, João; Sarangi, Tapas; Sarkisyan-Grinbaum, Edward; Sarrazin, Bjorn; Sarri, Francesca; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schäfer, Uli; Schaelicke, Andreas; Schaepe, Steffen; Schaetzel, Sebastian; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R. Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Christopher; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schroeder, Christian; Schroer, Nicolai; Schultens, Martin Johannes; Schultes, Joachim; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellden, Bjoern; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Sherman, Daniel; Sherwood, Peter; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, José; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Ben Campbell; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snow, Steve; Snow, Joel; Snyder, Scott; Sobie, Randall; Sodomka, Jaromir; Soffer, Abner; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Solovyev, Victor; Soni, Nitesh; Sood, Alexander; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Spanò, Francesco; Spighi, Roberto; Spigo, Giancarlo; Spiwoks, Ralf; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Staude, Arnold; Stavina, Pavel; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Strachota, Pavel; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strang, Michael; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Strong, John; Stroynowski, Ryszard; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Soh, Dart-yin; Su, Dong; Subramania, Halasya Siva; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Suzuki, Yuta; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Sánchez, Javier; Ta, Duc; Tackmann, Kerstin; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tamsett, Matthew; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tapprogge, Stefan; Tardif, Dominique; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tassi, Enrico; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teinturier, Marthe; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tomáš; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tonoyan, Arshak; Topfel, Cyril; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alesandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Triplett, Nathan; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiakiris, Menelaos; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuggle, Joseph; Turala, Michal; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Tzanakos, George; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Vahsen, Sven; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Berg, Richard; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Poel, Egge; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; Vanadia, Marco; Vandelli, Wainer; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinek, Elisabeth; Vinogradov, Vladimir; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorwerk, Volker; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Wagner, Wolfgang; Wagner, Peter; Wahlen, Helmut; Wahrmund, Sebastian; Wakabayashi, Jun; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Rui; Wang, Song-Ming; Wang, Tan; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watanabe, Ippei; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Weber, Michele; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Werth, Michael; Wessels, Martin; Wetter, Jeffrey; Weydert, Carole; Whalen, Kathleen; White, Andrew; White, Martin; White, Sebastian; Whitehead, Samuel Robert; Whiteson, Daniel; Whittington, Denver; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilhelm, Ivan; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Eric; Williams, Hugh; Williams, Sarah; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Michael Galante; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wooden, Gemma; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Michael; Wrona, Bozydar; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xie, Song; Xu, Chao; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Takayuki; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yang, Zhaoyu; Yanush, Serguei; Yao, Liwen; Yasu, Yoshiji; Yatsenko, Elena; Ye, Jingbo; Ye, Shuwei; Yen, Andy L; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, Dantong; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zanello, Lucia; Zanzi, Daniele; Zaytsev, Alexander; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zenin, Oleg; Ženiš, Tibor; Zinonos, Zinonas; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Long; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Ning; Zhou, Yue; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhuravlov, Vadym; Zibell, Andre; Zieminska, Daria; Zimin, Nikolai; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Ziolkowski, Michael; Zitoun, Robert; Živković, Lidija; Zmouchko, Viatcheslav; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zutshi, Vishnu; Zwalinski, Lukasz

    2013-06-20

    This paper reports a measurement of the W+b-jets (W+b+X and W+$b\\bar{b}$ +X) production cross-section in proton-proton collisions at a centre-of-mass energy of 7 TeV at the LHC. These results are based on data corresponding to an integrated luminosity of 4.6 fb$^{-1}$, collected with the ATLAS detector. Cross-sections are presented as a function of jet multiplicity and of the transverse momentum of the leading b-jet for both the muon and electron decay modes of the W boson. The W+b-jets cross-section, corrected for all known detector eects, is quoted in a limited kinematic range. Combining the muon and electron channels, the ducial cross-section for W+b-jets is measured to be 7.1 $\\pm$ 0.5 (stat) $\\pm$ 1.4 (syst) pb, consistent with the next-to-leading order QCD prediction, corrected for non-perturbative and double-parton interactions (DPI) contributions, of 4.7 $\\pm$ 0.09 (stat) $^{+0.60}_{-0.49}$ (scale) $\\pm$ 0.06 (PDF) $\\pm$ 0.16 (non-pert) $^{+0.52}_{-0.38}$ (DPI) pb.

  17. McDonald 2.1-m and CRTS Photometry of Eclipsing Polars

    Science.gov (United States)

    Wells, Natalie; Mason, Paul

    2018-01-01

    We present broadband optical photometry of five polars made using the 2.1-m telescope of McDonald Observatory. Four of the polars are eclipsing (EP Dra, FL Cet, V2301 Oph, and a Catalina Sky Survey (CSS) polar candidate). In addition, a pre-polar (MQ Dra) was observed. Typical integration times were 1-3 seconds with no dead time. At this time resolution, eclipse structure can be seen in both one- and two-pole accretors. McDonald 2.1-m data over several years is phased together with CSS photometry covering up to 7 years, in search of indications of period variation. Combining the high-resolution, high-speed photometry obtained using the ProEm camera on the McDonald 2.1-m with the sparse, but high-quality multi-year baseline photometry of the CSS places strong constraints on the time variability of the eclipse periods in these binary systems. In most cases, eclipse variations do not perfectly fit a linear ephemeris. We investigate the source of variations using standard O-C diagram techniques and period search algorithms.

  18. Evaluation of power behavior during startup and shutdown procedures of the IPR-R1 Triga Reactor

    International Nuclear Information System (INIS)

    Zangirolami, Dante M.; Mesquita, Amir Z.; Ferreira, Andrea V.

    2009-01-01

    The IPR-R1 nuclear reactor of Centro de Desenvolvimento da Tecnologia Nuclear - CDTN/CNEN is a TRIGA Mark I pool type reactor cooled by natural circulation of light water. In the IPR-R1, the power is measured by four nuclear channels, neutron-sensitive chambers, which are mounted around the reactor core: the Startup Channel for power indication during reactor startup; the Logarithmic Wide Range Power Monitoring Channel; the Linear Multi-Range Power Monitoring Channel and the Percent Power Safety Channel. A data acquisition system automatically does the monitoring and storage of all the reactor operational parameters including the reactor power. The startup procedure is manual and the time to reach the desired reactor power level is different on each irradiation which may introduces differences in induced activity of samples irradiated in different irradiations. In this work, the power evolution during startup and shutdown periods of IPR-R1 operation was evaluated and the mean values of reactor energy production in these operational phases were obtained. The analyses were performed on basis of the Linear Multi-Range Channel data. The results show that the sum of startup and shutdown periods corresponds to 1% of released energy for irradiations during 1h at 100kW. This value may be useful to correct experimental data in neutron activation experiments. (author)

  19. ECCS evaluation of B and W's 205-FA NSS

    International Nuclear Information System (INIS)

    Lowe, R.J.; Anderson, G.E. Jr.; Dunn, B.M.

    1975-06-01

    The effectiveness of the ECCS for B and W's 205-fuel assembly plants is evaluated and shown to meet all the requirements of 10 CFR 50.46. The results of various sensitivity studies, a spectrum of breaks, and an analysis to determine allowable linear heat rates under 10 CFR 50.46 are presented. (14 references) (U.S.)

  20. The effect of aging upon CE and B and W control rod drives

    International Nuclear Information System (INIS)

    Grove, E.; Gunther, W.

    1991-01-01

    Though mechanically different, the control rod drive (CRD) systems used at both Combustion Engineering (CE) and Babcock and Wilcox (B and W) plants position the control rod assemblies (CRA) in the core in response to automatic or manual reactivity control signals. Both systems are also designed to provide a rapid insertion of the CRAs upon a loss of AC power. The CRD system consists of the actual drive mechanisms, power and control, rod position indication, and cooling system components. This aging evaluation included the individual absorber rods, and the fuel assembly and upper internal guide tubes, since failure of these components could preclude the insertion of the control assemblies. Aging and environmental degradation have resulted in system and component failures. Many of these failures caused dropped or slipped rods which adversely affected plant operations by resulting in power reductions, scrams, and safety system actuation. No CRD system failure has ever resulted in the inability to shut down a reactor. However, unplanned, automatic trips challenge the operation of the plants safety systems. Consequently, their occurrence represents a potentially significant increase in plant risk. System and component failures have resulted in four Information Notices during the past decade

  1. THE O- AND B-TYPE STELLAR POPULATION IN W3: BEYOND THE HIGH-DENSITY LAYER

    Energy Technology Data Exchange (ETDEWEB)

    Kiminki, Megan M.; Kim, Jinyoung Serena; Bagley, Micaela B.; Rieke, George H. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Sherry, William H., E-mail: mbagley@email.arizona.edu [National Optical Astronomy Observatories, 950 North Cherry Avenue, Tucson, AZ 85719 (United States)

    2015-11-01

    We present the first results from our survey of the star-forming complex W3, combining VRI photometry with multiobject spectroscopy to identify and characterize the high-mass stellar population across the region. With 79 new spectral classifications, we bring the total number of spectroscopically confirmed O- and B-type stars in W3 to 105. We find that the high-mass slope of the mass function in W3 is consistent with a Salpeter IMF, and that the extinction toward the region is best characterized by an R{sub V} of approximately 3.6. B-type stars are found to be more widely dispersed across the W3 giant molecular cloud (GMC) than previously realized: they are not confined to the high-density layer (HDL) created by the expansion of the neighboring W4 H ii region into the GMC. This broader B-type population suggests that star formation in W3 began spontaneously up to 8–10 Myr ago, although at a lower level than the more recent star formation episodes in the HDL. In addition, we describe a method of optimizing sky subtraction for fiber spectra in regions of strong and spatially variable nebular emission.

  2. THE O- AND B-TYPE STELLAR POPULATION IN W3: BEYOND THE HIGH-DENSITY LAYER

    International Nuclear Information System (INIS)

    Kiminki, Megan M.; Kim, Jinyoung Serena; Bagley, Micaela B.; Rieke, George H.; Sherry, William H.

    2015-01-01

    We present the first results from our survey of the star-forming complex W3, combining VRI photometry with multiobject spectroscopy to identify and characterize the high-mass stellar population across the region. With 79 new spectral classifications, we bring the total number of spectroscopically confirmed O- and B-type stars in W3 to 105. We find that the high-mass slope of the mass function in W3 is consistent with a Salpeter IMF, and that the extinction toward the region is best characterized by an R V of approximately 3.6. B-type stars are found to be more widely dispersed across the W3 giant molecular cloud (GMC) than previously realized: they are not confined to the high-density layer (HDL) created by the expansion of the neighboring W4 H ii region into the GMC. This broader B-type population suggests that star formation in W3 began spontaneously up to 8–10 Myr ago, although at a lower level than the more recent star formation episodes in the HDL. In addition, we describe a method of optimizing sky subtraction for fiber spectra in regions of strong and spatially variable nebular emission

  3. Use of multiple on-campus reactors in education and training programs

    International Nuclear Information System (INIS)

    Schlapper, G.A.

    1989-01-01

    In its undergraduate and graduate programs in nuclear engineering and health physics, Texas A ampersand M University utilizes two reactors for the training and education of students. The 5-W AGN-201 nuclear training reactor has been in use since the late 1950s, while the 1-MW TRIGA Nuclear Science Center Reactor (NSCR) was first utilized in late 1961. Both facilities have been upgraded since initial criticality, the AGN power level being increased from the original 200-mW limit to its 5-W current level and the NSCR undergoing conversion from a 100-kW materials test reactor fueled deign to a 1-MW TRIGA-fueled facility. The AGN reactor is operated by the Department of Nuclear Engineering of the College of Engineering and is almost solely utilized in training and education programs. The NSCR facility is administered by the Texas Engineering Experiment Station and support research efforts of faculty and students of departments within and outside the university in addition to contributing to the education and training programs of the nuclear engineering department

  4. Operational parameters study of IPR-R1 TRIGA research reactor using virtual instruments

    International Nuclear Information System (INIS)

    Pinto, Antonio Juscelino; Mesquita, Amir Zacarias; Lameiras, Fernando Soares

    2013-01-01

    The instrumentation of nuclear reactors is designed with the principle of reliability, redundancy and diversification of control systems. Reliable monitoring of the parameters involved in the chain reaction is of great importance regarding efficiency and operational safety of the installation. The main goal of the simulation system in this proposed paper is to provide the study and improvement in understanding how these operational variables are interrelated and their behavior especially those related to neutronic and thermohydraulics. The work will be developed using the software LabVIEW ® (Laboratory Virtual Instruments Engineering Workbench). The program will enable the study of the variables involved in the operation of the installation throughout its operating range, for instance, a few mW up to 250 kW. The IPR-R1 TRIGA is a research nuclear reactor placed in open pool and cooled by light water with natural circulation. It is located at the Nuclear Technology Development Center (CDTN), in Belo Horizonte Brazil. The developing system employs the modern concept of virtual instruments (VIs), using microprocessors and visual interface on video monitors. LabVIEW ® breaks the paradigm of text-based programming language, for programming based on icons. The system will enable the use of this reactor in training and personnel training in the nuclear field. The work follows the recommendations of the International Atomic Energy Agency (IAEA), which has encouraged its members to develop strategic plans in order to use their research reactors. (author)

  5. Operational parameters study of IPR-R1 TRIGA research reactor using virtual instruments

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Antonio Juscelino; Mesquita, Amir Zacarias; Lameiras, Fernando Soares, E-mail: ajp@cdtn.br, E-mail: amir@cdtn.br, E-mail: fsl@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    The instrumentation of nuclear reactors is designed with the principle of reliability, redundancy and diversification of control systems. Reliable monitoring of the parameters involved in the chain reaction is of great importance regarding efficiency and operational safety of the installation. The main goal of the simulation system in this proposed paper is to provide the study and improvement in understanding how these operational variables are interrelated and their behavior especially those related to neutronic and thermohydraulics. The work will be developed using the software LabVIEW ® (Laboratory Virtual Instruments Engineering Workbench). The program will enable the study of the variables involved in the operation of the installation throughout its operating range, for instance, a few mW up to 250 kW. The IPR-R1 TRIGA is a research nuclear reactor placed in open pool and cooled by light water with natural circulation. It is located at the Nuclear Technology Development Center (CDTN), in Belo Horizonte Brazil. The developing system employs the modern concept of virtual instruments (VIs), using microprocessors and visual interface on video monitors. LabVIEW ® breaks the paradigm of text-based programming language, for programming based on icons. The system will enable the use of this reactor in training and personnel training in the nuclear field. The work follows the recommendations of the International Atomic Energy Agency (IAEA), which has encouraged its members to develop strategic plans in order to use their research reactors. (author)

  6. INCINERATION TREATMENT OF ARSENIC-CONTAMINATED SOIL

    Science.gov (United States)

    An incineration test program was conducted at the U.S. Environmental Protection Agency's Incineration Research Facility to evaluate the potential of incineration as a treatment option for contaminated soils at the Baird and McGuire Superfund site in Holbrook, Massachusetts. The p...

  7. Mission First, People Always Managing the Millennial Generation

    Science.gov (United States)

    2016-02-13

    Force Demographics,” United States Air Force, 30 Sep 2015, accessed 23 Nov 15, http://www.Afpc.Af.mil/ library /airforcepersonneldemographics.asp 3...Internet chat School violence TV Talk shows Multiculturalism Girls’ movement McGuire and Sosa (Zemke, 2001) Characteristics Optimism Teamwork

  8. Reclamation and reuse of LEU silicide fuel from manufacturing scrap

    International Nuclear Information System (INIS)

    Gale, G.R.; Pace, B.W.; Evans, R.S.

    2004-01-01

    In order to provide an understanding of the organization which is the sole supplier of United States plate type research and test reactor fuel and LEU core conversions, a brief description of the structure and history is presented. Babcock and Wilcox (B and W) is a part of McDermott International, Inc. which is a large diversified corporation employing over 20,000 people primarily in engineering and construction for the off-shore oil and power generation industries throughout the world. B and W provides many energy related products requiring precision machining and high quality systems. This is accomplished by using state-of-the-art equipment, technology and highly skilled people. The RTRFE group within B and W has the ability to produce various complexly shaped fuel elements with a wide variety of fuels and enrichments. B and W RTRFE has fabricated over 200,000 plates since 1981 and gained the diversified experience necessary to satisfy many customer requirements. This accomplishment was possible with the support of McDermott International and all of its resources. B and W has always had a commitment to high quality and integrity. This is apparent by the success and longevity (125 years) of the company. A lower cost to convert cores to LEU provides direct support to RERTR and demonstrates Babcock and Wilcox's commitment to the program. As a supporter of RERTR reactor conversion from HEU to LEU, B and W has contributed a significant amount of R and D money to improve the silicide fuel process which ultimately lowers the LEU core costs. In the most recent R and D project, B and W is constructing a LEU silicide reclamation facility to re-use the unirradiated fuel scrap generated from the production process. Remanufacturing use of this fuel completes the fuel cycle and provides a contribution to LEU cores by reducing scrap inventory and handling costs, lowering initial purchase of fuel due to increasing the process yields, and lowering the replacement costs. This

  9. Nuclear factor κB inhibitor BAY 11-7082 suppresses oxidative stress induced by endothelin-1 (ET-1) in rat kidney.

    Science.gov (United States)

    Kowalczyk, Agata; Kołodziejczyk, Michał; Gorąca, Anna

    2015-12-31

    The aim of the study was to evaluate the effect of BAY 11-7082, an NF-κB inhibitor, on basal and ET-1-induced production of reactive oxygen species (ROS), TNF-α and p65 protein in rat kidney. The experimental animals were divided into five groups (n=7) receiving: 1) saline (control); 2 and 3) ET-1 in a dose of 3 μg/kg body weight (b.w.) or 12.5 μg/kg b.w.; 4) BAY 11-7082 (10 mg/kg b.w.); 5) BAY 11-7082 (10 mg/kg b.w.) and ET-1 (12.5 μg/kg b.w.), respectively. In kidney homogenates the concentration of thiobarbituric acid reactive substances (TBARS), H2O2, TNF-α, p65 protein and GSH/GSSG ratio were determined. ET-1 resulted in a dose-dependent increase in TBARS and hydrogen peroxide (H2O2) levels, and a decrease in GSH/GSSG ratio when compared to the controls. BAY 11-7082 administered 1 h before ET-1 administration at a dose of 12.5 μg/kg resulted in a decrease (PET-1 groups. The level of TNF-α was increased (PET-1, while BAY 11-7082 reduced the TNF-α level (PET-1 induced oxidative stress in kidney tissue. These actions of BAY 11-7082 may result from reduced activity of NF-κB signaling pathways. Inhibition of the NF-κB pathway may be a promising strategy for preventing the progression of kidney damage.

  10. Null fields realizations of W3 from W (sl(4), sl(3)) and W (sl(3/1), sl(3)) algebras

    International Nuclear Information System (INIS)

    Bellucci, S.; Krivonos, S.; Sorin, A.

    1995-09-01

    It is considered the nonlinear algebras W(sl(4), sl(3)) and W(sl(3/1), sl(3)) and it is found their realizations in terms of currents spanning conformal linearizing algebras. The specific structure of these algebras, allows to construct realizations modulo null fields of the W 3 algebra that lies in the cosets W(sl(4), sl(3))/u(1) and W(sl(3/1), sl(3))/u(1). Such realizations exist for the following values of the W 3 algebra central charge: cw=-30, -40/7, -98/5, -2. The first two values are listed for the first time, whereas for the remaining values the new realizations get in terms of an arbitrary stress tensor and u(1) x sl(2) affine currents

  11. Qualification of McCARD/MASTER Code System for Yonggwang Unit 4

    International Nuclear Information System (INIS)

    Park, Ho Jin; Shim, Hyung Jin; Joo, Han Gyu; Kim, Chang Hyo

    2011-01-01

    Recently, we have developed the new two-step procedure based on the Monte Carlo (MC) methods. In this procedure, one can generate the few group constants including the few-group diffusion constants by the MC method augmented by the critical spectrum, which is provided by the solution to the homogeneous 0-dimensional B1 equation. In order to examine the qualification of the few-group constants generated by MC method, we combine MASTER with McCARD to form McCARD/MASTER code system for two-step core neutronics calculations. In the fictitious PWR system problems, the core design parameters calculated by the two-step McCARD/MASTER analysis agree well with those from the direct MC calculations. In this paper, a neutronic design analysis for the initial core of Yonggwang Nuclear Unit 4 (YGN4) is conducted using McCARD/MASTER two-step procedure to examine the qualification of two group constants from McCARD in terms of a real PWR core problem. To compare with the results, the nuclear design report and measured data are chosen as the reference solutions

  12. Characteristics of UV-MicroO3 Reactor and Its Application to Microcystins Degradation during Surface Water Treatment

    Directory of Open Access Journals (Sweden)

    Guangcan Zhu

    2015-01-01

    Full Text Available The UV-ozone (UV-O3 process is not widely applied in wastewater and potable water treatment partly for the relatively high cost since complicated UV radiation and ozone generating systems are utilized. The UV-microozone (UV-microO3, a new advanced process that can solve the abovementioned problems, was introduced in this study. The effects of air flux, air pressure, and air humidity on generation and concentration of O3 in UV-microO3 reactor were investigated. The utilization of this UV-microO3 reactor in microcystins (MCs degradation was also carried out. Experimental results indicated that the optimum air flux in the reactor equipped with 37 mm diameter quartz tube was determined to be 18∼25 L/h for efficient O3 generation. The air pressure and humidity in UV-microO3 reactor should be low enough in order to get optimum O3 output. Moreover, microcystin-RR, YR, and LR (MC-RR, MC-YR, and MC-LR could be degraded effectively by UV-microO3 process. The degradation of different MCs was characterized by first-order reaction kinetics. The pseudofirst-order kinetic constants for MC-RR, MC-YR, and MC-LR degradation were 0.0093, 0.0215, and 0.0286 min−1, respectively. Glucose had no influence on MC degradation through UV-microO3. The UV-microO3 process is hence recommended as a suitable advanced treatment method for dissolved MCs degradation.

  13. Characterization of the TRIGA Mark II reactor full-power steady state

    Energy Technology Data Exchange (ETDEWEB)

    Cammi, Antonio, E-mail: antonio.cammi@polimi.it [Politecnico di Milano – Department of Energy, CeSNEF (Enrico Fermi Center for Nuclear Studies), via La Masa 34, 20156 Milano (Italy); Zanetti, Matteo [Politecnico di Milano – Department of Energy, CeSNEF (Enrico Fermi Center for Nuclear Studies), via La Masa 34, 20156 Milano (Italy); Chiesa, Davide; Clemenza, Massimiliano; Pozzi, Stefano; Previtali, Ezio; Sisti, Monica [University of Milano-Bicocca, Physics Department “G. Occhialini” and INFN Section, Piazza dell’Ateneo Nuovo, 20126 Milan (Italy); Magrotti, Giovanni; Prata, Michele; Salvini, Andrea [University of Pavia, Applied Nuclear Energy Laboratory (L.E.N.A.), Via Gaspare Aselli 41, 27100 Pavia (Italy)

    2016-04-15

    Highlights: • Full-power steady state characterization of the TRIGA Mark II reactor. • Monte Carlo and Multiphysics simulation of the TRIGA Mark II reactor. • Sub-cooled boiling effects in the TRIGA Mark II reactor. • Thermal feedback effects in the TRIGA Mark II reactor. • Experimental data based validation. - Abstract: In this paper, the characterization of the full-power steady state of the TRIGA Mark II nuclear reactor at the University of Pavia is achieved by coupling the Monte Carlo (MC) simulation for neutronics with the “Multiphysics” model for thermal-hydraulics. Neutronic analyses have been carried out with a MCNP5 based MC model of the entire reactor system, already validated in fresh fuel and zero-power configurations (in which thermal effects are negligible) and using all available experimental data as a benchmark. In order to describe the full-power reactor configuration, the temperature distribution in the core must be established. To evaluate this, a thermal-hydraulic model has been developed, using the power distribution results from the MC simulation as input. The thermal-hydraulic model is focused on the core active region and takes into account sub-cooled boiling effects present at full reactor power. The obtained temperature distribution is then entered into the MC model and a benchmark analysis is carried out to validate the model in fresh fuel and full-power configurations. An acceptable correspondence between experimental data and simulation results concerning full-power reactor criticality proves the reliability of the adopted methodology of analysis, both from the perspective of neutronics and thermal-hydraulics.

  14. α-Skew π-McCoy Rings

    Directory of Open Access Journals (Sweden)

    Areej M. Abduldaim

    2013-01-01

    Full Text Available As a generalization of α-skew McCoy rings, we introduce the concept of α-skew π-McCoy rings, and we study the relationships with another two new generalizations, α-skew π1-McCoy rings and α-skew π2-McCoy rings, observing the relations with α-skew McCoy rings, π-McCoy rings, α-skew Armendariz rings, π-regular rings, and other kinds of rings. Also, we investigate conditions such that α-skew π1-McCoy rings imply α-skew π-McCoy rings and α-skew π2-McCoy rings. We show that in the case where R is a nonreduced ring, if R is 2-primal, then R is an α-skew π-McCoy ring. And, let R be a weak (α,δ-compatible ring; if R is an α-skew π1-McCoy ring, then R is α-skew π2-McCoy.

  15. Reactor protection system

    International Nuclear Information System (INIS)

    Fairbrother, D.B.; Lesniak, L.M.; Orgera, E.G.

    1977-10-01

    The report describes the reactor protection system (RPS-II) designed for use on Babcock and Wilcox 145-, later 177-, and 205-fuel assembly pressurized water reactors. In this system, relays in the trip logic have been replaced by solid state devices. A calculating module for the low DNBR, pump status, and offset trip functions has replaced the overpower trip (based on flow and imbalance), the power/RC pump trip, and the variable low-pressure trip. Included is a description of the changes from the present Oconee-type reactor protection system (RPS-I), a functional and hardware description of the calculating module, a description of the software programmed in the calculating module, and a discussion of the qualification program conducted to ensure that the degree of protection provided by RPS-II is not less than that provided by previously licensed systems supplied by B and W

  16. Chooz-B1, the new Electricite de France PWR: calculation scheme of neutron leakages from the reactor cavity

    International Nuclear Information System (INIS)

    Champion, G.; Thiriet, A.; Vergnaud, T.; Bourdet, L.; Nimal, J.C.; Brandicourt, G.

    1987-04-01

    A new calculation scheme has been set up to assess the neutron field characteristics inside French PWR. In order to take into account multiple neutron scattering and the complexity of the reactor geometry, the use of Monte-Carlo methods have been heavily increased. They are coupled with classical SN.-methods. The main goal aimed at was to find out the neutron field characteristics at the level of the reactor pit openings. These radiation reference sources will be used to check the neutron shielding efficiencies. The new calculation scheme has been applied to CHOOZ-B1, the first unit of the new N4 program. The former results have been compared with the measurement results related to PALUEL-I and II PWR, two units of the previous P4 program. Although the core and the geometry are not entirely similar, it is possible to check with confidence the calculation results along the vessel and at the core midplane level with the measurement results at the same locations. It appears that they are in good agreement. Consequently, the new calculation scheme appears reliable

  17. D-Zero results on W boson properties

    International Nuclear Information System (INIS)

    Abbott, B.

    1997-10-01

    The D0 experiment collected ∼ 15 pb -1 in run 1A (1992- 1993) and ∼ 89 pb -1 in run 1B (1994-1995) of the Fermilab Tevatron Collider using p anti p collisions at √s = 1.8 TeV. Results from analyses of events with W and Z bosons are presented for the run 1B data samples. From W → eν, μν and Z → ee, μμ decays, the W and Z production cross sections and the W width are determined. Events with W → τν decays are used to determine the ratio of the electroweak gauge coupling constants as a measure of lepton universality. Using W → eν and Z → ee decays, the W boson mass is measured

  18. A computational study on the energetics and mechanisms for the dissociative adsorption of SiH{sub x}(x = 1–4) on W(1 1 1) surface

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Y.H.; Raghunath, P.; Lin, M.C., E-mail: chemmcl@emory.edu

    2016-01-30

    Graphical abstract: - Highlights: • Behavior of the SiH{sub x} species on the W surface under cat-CVD conditions. • The adsorption and dissociation mechanisms of SiH{sub x}(x = 1–4) species on W(1 1 1) surface. • H-migration to its neighboring W atoms is more favorable compared to H{sub 2} elimination. - Abstract: The adsorption and dissociation mechanisms of SiH{sub x}(x = 1–4) species on W(1 1 1) surface have been investigated by using the periodic density functional theory with the projector-augmented wave approach. The adsorption of all the species on four surface sites: top (T), bridge (B), shallow (S), and deep (D) sites have been analyzed. For SiH{sub 4} on a top site, T-SiH{sub 4(a)}, it is more stable with an adsorption energy of 2.6 kcal/mol. For SiH{sub 3}, the 3-fold shallow site is most favorable with adsorption energy of 46.0 kcal/mol. For SiH{sub 2}, its adsorption on a bridge site is most stable with 73.0 kcal/mol binding energy, whereas for SiH and Si the most stable adsorption configurations are on 3-fold deep sites with very high adsorption energies, 111.8 and 134.7 kcal/mol, respectively. The potential energy surfaces for the dissociative adsorption of all SiH{sub x} species on the W(1 1 1) surface have been constructed using the CINEB method. The barriers for H-atom migration from SiH{sub x(a)} to its neighboring W atoms, preferentially on B-sites, were predicted to be 0.4, 1.0, 4.5 and, 8.0 kcal/mol, respectively, for x = 4, 3, 2, and 1, respectively. The adsorption energy of the H atom on a bridge site on the clean W(1 1 1) surface was predicted to be 65.9 kcal/mol, which was found to be slightly affected by the co-adsorption of SiH{sub x−1} within ± 1 kcal/mol.

  19. MC21/CTF and VERA multiphysics solutions to VERA core physics benchmark progression problems 6 and 7

    Directory of Open Access Journals (Sweden)

    Daniel J. Kelly, III

    2017-09-01

    Full Text Available The continuous energy Monte Carlo neutron transport code, MC21, was coupled to the CTF subchannel thermal-hydraulics code using a combination of Consortium for Advanced Simulation of Light Water Reactors (CASL tools and in-house Python scripts. An MC21/CTF solution for VERA Core Physics Benchmark Progression Problem 6 demonstrated good agreement with MC21/COBRA-IE and VERA solutions. The MC21/CTF solution for VERA Core Physics Benchmark Progression Problem 7, Watts Bar Unit 1 at beginning of cycle hot full power equilibrium xenon conditions, is the first published coupled Monte Carlo neutronics/subchannel T-H solution for this problem. MC21/CTF predicted a critical boron concentration of 854.5 ppm, yielding a critical eigenvalue of 0.99994 ± 6.8E-6 (95% confidence interval. Excellent agreement with a VERA solution of Problem 7 was also demonstrated for integral and local power and temperature parameters.

  20. Geology of pre-Dakota uranium geochemical cell, sec. 13, T. 16 N., R. 17 W., Church Rock area, McKinley County

    International Nuclear Information System (INIS)

    Peterson, R.J.

    1980-01-01

    Exploration drilling on sec. 13, T. 16 N., R. 17 W., McKinley County, New Mexico, has defined uranium deposits within the Westwater Canyon Member of the Morrison Formation (Jurassic). Elongate, tabular, redistributed deposits were formed peripherally along the zones of highest transmissivity of the northeast-trending Westwater Canyon fluvial system by a Jurassic-Cretaceous geochemical cell. Strongly reducing conditions, which existed locally in the channel-margin areas owing to the presence of organic materials, were the primary ore control. Evidence that this major redistribution process took place in pre-Dakota time is the bleaching of the Westwater Canyon Sandstone by Dakota swamps is superimposed on older oxidation, and the primary mineralization above the Jurassic-Cretaceous water table was not affected by the geochemical-cell redistribution process

  1. 3.1 W narrowband blue external cavity diode laser

    Science.gov (United States)

    Peng, Jue; Ren, Huaijin; Zhou, Kun; Li, Yi; Du, Weichuan; Gao, Songxin; Li, Ruijun; Liu, Jianping; Li, Deyao; Yang, Hui

    2018-03-01

    We reported a high-power narrowband blue diode laser which is suitable for subsequent nonlinear frequency conversion into the deep ultraviolet (DUV) spectral range. The laser is based on an external cavity diode laser (ECDL) system using a commercially available GaN-based high-power blue laser diode emitting at 448 nm. Longitudinal mode selection is realized by using a surface diffraction grating in Littrow configuration. The diffraction efficiency of the grating was optimized by controlling the polarization state of the laser beam incident on the grating. A maximum optical output power of 3.1 W in continuous-wave operation with a spectral width of 60 pm and a side-mode suppression ratio (SMSR) larger than 10 dB at 448.4 nm is achieved. Based on the experimental spectra and output powers, the theoretical efficiency and output power of the subsequent nonlinear frequency conversion were calculated according to the Boyd- Kleinman theory. The single-pass conversion efficiency and output power is expected to be 1.9×10-4 and 0.57 mW, respectively, at the 3.1 W output power of the ECDL. The high-power narrowband blue diode laser is very promising as pump source in the subsequent nonlinear frequency conversion.

  2. Zespoły bólowe kręgosłupa w grupie fizjoterapeutów = Spine pain syndromes in a group of physiotherapists

    Directory of Open Access Journals (Sweden)

    Agnieszka Radzimińska

    2016-06-01

    • Uniwersytet Kazimierza Wielkiego w Bydgoszczy     Słowa kluczowe: zespół bólowy kręgosłupa, fizjoterapeuta. Keywords: spinal pain syndrome, physical therapist.           Streszczenie Zgodnie z wynikami badań z 2005 roku przeprowadzonymi przez European Fundation for the Improvement of Living and Working Conditions (Europejską Fundację na Rzecz Poprawy Warunków Życia i Pracy w krajach Unii Europejskiej najbardziej powszechnym problemem zdrowotnym związanym z pracą są dolegliwości mięśniowo-szkieletowe. Celem pracy była ocena stopnia niepełnosprawności będącej wynikiem bólu kręgosłupa w grupie zawodowej fizjoterapeutów. Narzędziem badawczym były: NDI (NECK DISABILITY INDEX oraz ODI (OSWESTRY DISABILITY INDEX. Ocena stopnia niepełnosprawności   mierzonej za pomocą kwestionariuszy ODI i NDI pozwoliła zakwalifikować fizjoterapeutów do przedziału wskazującego na łagodną niepełnosprawność. W badanej grupie dolegliwości bólowe kręgosłupa w odcinku szyjnym i lędźwiowym zwiększają się wraz z wiekiem oraz stażem pracy.   Summary According to research conducted in 2005 by the European Foundation for the Improvement of Living and Working Conditions in the European Union the most common health problem is work-related musculoskeletal disorders. The aim of the study is to assess the degree of disability in the occupational group of physiotherapists, measured by questionnaires NDI (NECK DISABILITY INDEX  and ODI (OSWESTRY DISABILITY INDEX. Assessment of the degree of disability as measured by questionnaires ODI and NDI helped qualify physiotherapists compartment indicating a mild disability. Back pain in the cervical and lumbar increases with age and seniority.

  3. RMB. The new Brazilian multipurpose research reactor

    International Nuclear Information System (INIS)

    Perrotta, Jose Augusto; Soares, Adalberto Jose

    2015-01-01

    Brazil has four research reactors (RR) in operation: IEA-R1, a 5 MW pool type RR; IPR-R1, a 100 kW TRIGA type RR; ARGONAUTA, a 500 W Argonaut type RR, and IPEN/MB-01, a 100 W critical facility. The first three were constructed in the 50's and 60's, for teaching, training, and nuclear research, and for many years they were the basic infrastructure for the Brazilian nuclear developing program. The last, IPEN/MB-01, is the result of a national project developed specifically for qualification of reactor physics codes. Considering the relative low power of Brazilian research reactors, with exception of IEAR1, none of the other reactors are feasible for radioisotope production, and even IEA-R1 has a limited capacity. As a consequence, since long ago, 100% of the Mo-99 needed to attend Brazilian nuclear medicine services has been imported. Because of the high dependence on external supply, the international Moly-99 supply crisis that occurred in 2008/2009 affected significantly Brazilian nuclear medicine services, and as presented in previous IAEA events, in 2010 Brazilian government formalized the decision to build a new research reactor. The new reactor named RMB (Brazilian Multipurpose Reactor) will be a 30 MW open pool type reactor, using low enriched uranium fuel. The facility will be part of a new nuclear research centre, to be built about 100 kilometres from Sao Paulo city, in the southern part of Brazil. The new nuclear research centre will have several facilities, to use thermal and cold neutron beams; to produce radioisotopes; to perform neutron activation analysis; and to perform irradiations tests of materials and fuels of interest for the Brazilian nuclear program. An additional facility will be used to store, for at least 100 years, all the fuel used in the reactor. The paper describes the main characteristics of the new centre, emphasising the research reactor and giving a brief description of the laboratories that will be constructed, It also presents the

  4. RMB. The new Brazilian multipurpose research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Perrotta, Jose Augusto; Soares, Adalberto Jose [Comissao Nacional de Energia Nuclear (CNEN) (Brazil)

    2015-01-15

    Brazil has four research reactors (RR) in operation: IEA-R1, a 5 MW pool type RR; IPR-R1, a 100 kW TRIGA type RR; ARGONAUTA, a 500 W Argonaut type RR, and IPEN/MB-01, a 100 W critical facility. The first three were constructed in the 50's and 60's, for teaching, training, and nuclear research, and for many years they were the basic infrastructure for the Brazilian nuclear developing program. The last, IPEN/MB-01, is the result of a national project developed specifically for qualification of reactor physics codes. Considering the relative low power of Brazilian research reactors, with exception of IEAR1, none of the other reactors are feasible for radioisotope production, and even IEA-R1 has a limited capacity. As a consequence, since long ago, 100% of the Mo-99 needed to attend Brazilian nuclear medicine services has been imported. Because of the high dependence on external supply, the international Moly-99 supply crisis that occurred in 2008/2009 affected significantly Brazilian nuclear medicine services, and as presented in previous IAEA events, in 2010 Brazilian government formalized the decision to build a new research reactor. The new reactor named RMB (Brazilian Multipurpose Reactor) will be a 30 MW open pool type reactor, using low enriched uranium fuel. The facility will be part of a new nuclear research centre, to be built about 100 kilometres from Sao Paulo city, in the southern part of Brazil. The new nuclear research centre will have several facilities, to use thermal and cold neutron beams; to produce radioisotopes; to perform neutron activation analysis; and to perform irradiations tests of materials and fuels of interest for the Brazilian nuclear program. An additional facility will be used to store, for at least 100 years, all the fuel used in the reactor. The paper describes the main characteristics of the new centre, emphasising the research reactor and giving a brief description of the laboratories that will be constructed, It also

  5. A computational study on the energetics and mechanisms for the dissociative adsorption of SiHx(x = 1-4) on W(1 1 1) surface

    Science.gov (United States)

    Lin, Y. H.; Raghunath, P.; Lin, M. C.

    2016-01-01

    The adsorption and dissociation mechanisms of SiHx(x = 1-4) species on W(1 1 1) surface have been investigated by using the periodic density functional theory with the projector-augmented wave approach. The adsorption of all the species on four surface sites: top (T), bridge (B), shallow (S), and deep (D) sites have been analyzed. For SiH4 on a top site, T-SiH4(a), it is more stable with an adsorption energy of 2.6 kcal/mol. For SiH3, the 3-fold shallow site is most favorable with adsorption energy of 46.0 kcal/mol. For SiH2, its adsorption on a bridge site is most stable with 73.0 kcal/mol binding energy, whereas for SiH and Si the most stable adsorption configurations are on 3-fold deep sites with very high adsorption energies, 111.8 and 134.7 kcal/mol, respectively. The potential energy surfaces for the dissociative adsorption of all SiHx species on the W(1 1 1) surface have been constructed using the CINEB method. The barriers for H-atom migration from SiHx(a) to its neighboring W atoms, preferentially on B-sites, were predicted to be 0.4, 1.0, 4.5 and, 8.0 kcal/mol, respectively, for x = 4, 3, 2, and 1, respectively. The adsorption energy of the H atom on a bridge site on the clean W(1 1 1) surface was predicted to be 65.9 kcal/mol, which was found to be slightly affected by the co-adsorption of SiHx-1 within ± 1 kcal/mol.

  6. Fabrication and integrity test preparation of HIP-joined W and ferritic-martensitic steel mockups for fusion reactor development

    International Nuclear Information System (INIS)

    Lee, Dong Won; Shin, Kyu In; Kim, Suk Kwon; Jin, Hyung Gon; Lee, Eo Hwak; Yoon, Jae Sung; Choi, Bo Guen; Moon, Se Youn; Hong, Bong Guen

    2014-01-01

    Tungsten (W) and ferritic-martensitic steel (FMS) as armor and structural materials, respectively, are the major candidates for plasma-facing components (PFCs) such as the blanket first wall (BFW) and the divertor, in a fusion reactor. In the present study, three W/FMS mockups were successfully fabricated using a hot isostatic pressing (HIP, 900 .deg. C, 100 MPa, 1.5 hrs) with a following post-HIP heat treatment (PHHT, tempering, 750 .deg. C, 70 MPa, 2 hrs), and the W/FMS joining method was developed based on the ITER BFW and the test blanket module (TBM) development project from 2004 to the present. Using a 10-MHz-frequency flat-type probe to ultrasonically test of the joint, we found no defects in the fabricated mockups. For confirmation of the joint integrity, a high heat flux test will be performed up to the thermal lifetime of the mockup under the proper test conditions. These conditions were determined through a preliminary analysis with conventional codes such as ANSYS-CFX for thermal-hydraulic conditions considering the test facility, the Korea heat load test facility with an electron beam (KoHLT-EB), and its water coolant system at the Korea Atomic Energy Research Institute (KAERI)

  7. Fabrication and integrity test preparation of HIP-joined W and ferritic-martensitic steel mockups for fusion reactor development

    Science.gov (United States)

    Lee, Dong Won; Shin, Kyu In; Kim, Suk Kwon; Jin, Hyung Gon; Lee, Eo Hwak; Yoon, Jae Sung; Choi, Bo Guen; Moon, Se Youn; Hong, Bong Guen

    2014-10-01

    Tungsten (W) and ferritic-martensitic steel (FMS) as armor and structural materials, respectively, are the major candidates for plasma-facing components (PFCs) such as the blanket first wall (BFW) and the divertor, in a fusion reactor. In the present study, three W/FMS mockups were successfully fabricated using a hot isostatic pressing (HIP, 900 °C, 100 MPa, 1.5 hrs) with a following post-HIP heat treatment (PHHT, tempering, 750 °C, 70 MPa, 2 hrs), and the W/FMS joining method was developed based on the ITER BFW and the test blanket module (TBM) development project from 2004 to the present. Using a 10-MHz-frequency flat-type probe to ultrasonically test of the joint, we found no defects in the fabricated mockups. For confirmation of the joint integrity, a high heat flux test will be performed up to the thermal lifetime of the mockup under the proper test conditions. These conditions were determined through a preliminary analysis with conventional codes such as ANSYS-CFX for thermal-hydraulic conditions considering the test facility, the Korea heat load test facility with an electron beam (KoHLT-EB), and its water coolant system at the Korea Atomic Energy Research Institute (KAERI).

  8. Fabrication and integrity test preparation of HIP-joined W and ferritic-martensitic steel mockups for fusion reactor development

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Dong Won; Shin, Kyu In; Kim, Suk Kwon; Jin, Hyung Gon; Lee, Eo Hwak; Yoon, Jae Sung; Choi, Bo Guen [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Moon, Se Youn; Hong, Bong Guen [Chonbuk National University, Jeonju (Korea, Republic of)

    2014-10-15

    Tungsten (W) and ferritic-martensitic steel (FMS) as armor and structural materials, respectively, are the major candidates for plasma-facing components (PFCs) such as the blanket first wall (BFW) and the divertor, in a fusion reactor. In the present study, three W/FMS mockups were successfully fabricated using a hot isostatic pressing (HIP, 900 .deg. C, 100 MPa, 1.5 hrs) with a following post-HIP heat treatment (PHHT, tempering, 750 .deg. C, 70 MPa, 2 hrs), and the W/FMS joining method was developed based on the ITER BFW and the test blanket module (TBM) development project from 2004 to the present. Using a 10-MHz-frequency flat-type probe to ultrasonically test of the joint, we found no defects in the fabricated mockups. For confirmation of the joint integrity, a high heat flux test will be performed up to the thermal lifetime of the mockup under the proper test conditions. These conditions were determined through a preliminary analysis with conventional codes such as ANSYS-CFX for thermal-hydraulic conditions considering the test facility, the Korea heat load test facility with an electron beam (KoHLT-EB), and its water coolant system at the Korea Atomic Energy Research Institute (KAERI)

  9. The influence of temperature on the work function of W, LaB 6 and pseudo-alloys

    Science.gov (United States)

    Bulyga, A. V.; Solonovich, V. K.

    1989-12-01

    The experimental temperature dependences α f = d F/d T of the work function F = F( T) for W(111), LaB 6(100) and W-Ni-LaB 6 pseudo-alloy surfaces emitting thermoelectrons are compared with α f predicted by the Hohenberg-Lang-Kohn theory.

  10. Experience with the RE fuel transition at the Studsvik R2 reactor

    International Nuclear Information System (INIS)

    Pazsit, I.; Saltvedt, K.

    1991-01-01

    Irradiation of 7 LEU fuel elements is underway in the Studsvik R2 reactor. Four of these have 490 g U-235, and three 320 g U-235 loading, and the enrichment is 19.7% for all of them. The irradiation of LEU fuel started in 1987. The heavier elements have burnup figures 67% (CERCA), 50% (B and W), 47% (NUKEM) and 19% (B and W). One of the lighter elements has reached a burnup of 65%. To support the whole-core conversion process, reactor physical calculations were performed to see if a one-step conversion is possible with a suitable fuel management strategy such that all HEU fuel is burned up. The calculations show that it is possible to perform such a conversion with fuel elements containing 400 g U-235. (orig.)

  11. Precipitation sensitivity to alloy composition in Fe-Cr-Mn austenitic steels developed for reduced activation for fusion application

    International Nuclear Information System (INIS)

    Maziasz, P.J.; Klueh, R.L.

    1988-01-01

    Special austenitic steels are being designed in which alloying elements like Mo, Nb, and Ni are replaced with Mn, W, V, Ti, and/or Ta to reduce the long-term radioactivity induced by fusion reactor irradiation. However, the new steels still need to have properties otherwise similar to commercial steels like type 316. Precipitation strongly affects strength and radiation-resistance in austenitic steels during irradiation at 400--600/degree/C, and precipitation is also usually quite sensitive to alloy composition. The initial stage of development was to define a base Fe-Cr-Mn-C composition that formed stable austenite after annealing and cold-working, and resisted recovery or excessive formation of coarse carbide and intermetallic phases during elevated temperature annealing. These studies produced a Fe-12Cr-20Mn-0.25C base alloy. The next stage was to add the minor alloying elements W, Ti, V, P, and B for more strength and radiation-resistance. One of the goals was to produce fine MC precipitation behavior similar to the Ti-modified Fe-Cr-Ni prime candidate alloy (PCA). Additions of Ti+V+P+B produced fine MC precipitation along network dislocations and recovery/recrystallization resistance in 20% cold worked material aged at 800/degree/C for 166h, whereas W, Ti, W+Ti, or Ti+P+B additions did not. Addition of W+Ti+V+P+B also produced fine MC, but caused some σ phase formation and more recrystallization as well. 29 refs., 14 figs., 9 tabs

  12. Australian research reactor studies

    International Nuclear Information System (INIS)

    McCulloch, D.B.

    1978-01-01

    The Australian AEC has two research reactors at the Lucas Heights Research Establishment, a 10 HW DIDO class materials testing reactor, HIFAR, and a smaller 100kW reactor MOATA, which was recently upgraded from 10kW power level. Because of the HIFAR being some 20 years old, major renewal and repair programmes are necessary to keep it operational. To enable meeting projected increases in demand for radioisotopes, plans for a new reactor to replace the HIFAR have been made and the design criteria are described in the paper. (author)

  13. OpenMC: a state-of-the-Art Monte Carlo code for research and development

    International Nuclear Information System (INIS)

    Romano, P.K.; Horelik, N.E.; Herman, B.R.; Forget, B.; Smith, K.; Nelson, A.G.

    2013-01-01

    This paper gives an overview of OpenMC, an open source Monte Carlo particle transport code recently developed at the Massachusetts Institute of Technology. OpenMC uses continuous-energy cross sections and a constructive solid geometry representation, enabling high-fidelity modeling of nuclear reactors and other systems. Modern, portable input/output file formats are used in OpenMC: XML for input, and HDF5 for output. High performance parallel algorithms in OpenMC have demonstrated near-linear scaling to over 100,000 processors on modern supercomputers. Other topics discussed in this paper include plotting, CMFD acceleration, variance reduction, eigenvalue calculations, and software development processes. (authors)

  14. Spent fuel management plans for the FiR 1 Reactor

    International Nuclear Information System (INIS)

    Salmenhaara, S. E. J.

    2002-01-01

    The FiR 1-reactor, a 250 kW TRIGA reactor, has been in operation since 1962. The main purpose to run the reactor is now the Boron Neutron Capture Therapy (BNCT). The BNCT work dominates the current utilization of the reactor: three days per week for BNCT purposes and only two days per week for other purposes such as the neutron activation analysis and isotope production. The final disposal site is situated in Olkiluoto, on the western coast of Finland. Olkiluoto is also one of the two nuclear power plant sites in Finland. In the new operating license of our reactor there is a special condition. We have to achieve a binding agreement between our Research Centre and either the domestic Nuclear Power Companies about the possibility to use the Olkiluoto final disposal facility for our spent fuel or US DOE about the return of our spent fuel back to USA. If we want to continue the reactor operation beyond the year 2006. the domestic final disposal is the only possibility. At the moment it seems to be reasonable to prepare to both possibilities: the domestic final disposal and the return to the USA offered by US DOE. Because the cost estimates of the both possibilities are on the same order of magnitude, the future of the reactor itself will decide, which of the spent fuel policies will be obeyed. In a couple of years' time it will be seen, if the funding of the reactor and the incomes from the BNCT treatments will cover the costs. If the BNCT and other irradiations develop satisfactorily, the reactor can be kept in operation beyond the year 2006 and the domestic final disposal will be implemented. If, however, there is still lack of money, there is no reason to continue the operation of the reactor and the choice of US DOE alternative is natural. (author)

  15. Gigawatt peak power generation in a relativistic klystron amplifier driven by 1 kW seed-power

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Y. [Institute of Applied Electronics, China Academy of Engineering Physics, Mianyang 621900 (China); Science and Technology on High Power Microwave Laboratory, Mianyang 621900 (China); Xie, H. Q. [College of Science, Southwestern University of Science and Technology, Mianyang 621010 (China); Li, Z. H.; Zhang, Y. J.; Ma, Q. S. [Institute of Applied Electronics, China Academy of Engineering Physics, Mianyang 621900 (China)

    2013-11-15

    An S-band high gain relativistic klystron amplifier driven by kW-level RF power is proposed and studied experimentally. In the device, the RF lossy material is introduced to suppress higher mode excitation. An output power of 1.95 GW with a gain of 62.8 dB is obtained in the simulation. Under conditions of an input RF power of 1.38 kW, a microwave pulse with power of 1.9 GW, frequency of 2.86 GHz, and duration of 105 ns is generated in the experiment, and the corresponding gain is 61.4 dB.

  16. Gigawatt peak power generation in a relativistic klystron amplifier driven by 1 kW seed-power

    Science.gov (United States)

    Wu, Y.; Xie, H. Q.; Li, Z. H.; Zhang, Y. J.; Ma, Q. S.

    2013-11-01

    An S-band high gain relativistic klystron amplifier driven by kW-level RF power is proposed and studied experimentally. In the device, the RF lossy material is introduced to suppress higher mode excitation. An output power of 1.95 GW with a gain of 62.8 dB is obtained in the simulation. Under conditions of an input RF power of 1.38 kW, a microwave pulse with power of 1.9 GW, frequency of 2.86 GHz, and duration of 105 ns is generated in the experiment, and the corresponding gain is 61.4 dB.

  17. THYDE-B1/MOD2: a computer code for analysis of small-break loss-of-coolant accidents of boiling water reactors

    International Nuclear Information System (INIS)

    Nakamura, Hideo; Muramatsu, Ken; Kukita, Yutaka; Tasaka, Kanji

    1988-04-01

    THYDE-B1/MOD2 is a fast-running best estimate (BE) computer code to analyze thermal-hydraulic behaviors of the reactor cooling system of a boiling water reactor (BWR), mainly, during a small-break loss-of-coolant accident (SBLOCA) with a special emphasis on the behavior of pressure and mixture level in the pressure vessel. The coolant behavior is simulated with a volume-and-junction method based on assumptions of thermal equilibrium and homogeneous conditions for two-phase flow. A characteristic feature of this code is a three-region representation of the state of the coolant in a control volume, in which three regions consist of subcooled liquid, saturated mixture and saturated steam regions from the volume bottom. The regions are separated by two horizontal moving boundaries which are tracked by mass and energy balances for each region. With this three region node model, the interior of the pressure vessel can be represented by only two volumes: one for inside of the shroud and the other for outside, while other portions of the system are treated with homogeneous node model. This method, although it seems to be very simple, has been verified to be adequate for cases of BWR SBLOCAs in which the thermal-hydraulic behavior is relatively slow and gravity controlled. The code has been improved and modified from the last version of the code, THYDE-B1/MOD1, especially in the phase separation model which is used in the mixture level calculation in the three region node model. Then, a good predictability of the code has been indicated through the comparison of calculated results with various SBLOCA test data including ROSA-III of JAERI and FIST of the General Electric Co. This report presents the code modifications and input data requirements of the THYDE-B1/MOD2 code. (author)

  18. Psychophysics of the McGurk and Other Audiovisual Speech Integration Effects

    Science.gov (United States)

    Jiang, Jintao; Bernstein, Lynne E.

    2011-01-01

    When the auditory and visual components of spoken audiovisual nonsense syllables are mismatched, perceivers produce four different types of perceptual responses, auditory correct, visual correct, fusion (the so-called McGurk effect), and combination (i.e., two consonants are reported). Here, quantitative measures were developed to account for the distribution of types of perceptual responses to 384 different stimuli from four talkers. The measures included mutual information, the presented acoustic signal versus the acoustic signal recorded with the presented video, and the correlation between the presented acoustic and video stimuli. In Experiment 1, open-set perceptual responses were obtained for acoustic /bA/ or /lA/ dubbed to video /bA, dA, gA, vA, zA, lA, wA, ΔA/. The talker, the video syllable, and the acoustic syllable significantly influenced the type of response. In Experiment 2, the best predictors of response category proportions were a subset of the physical stimulus measures, with the variance accounted for in the perceptual response category proportions between 17% and 52%. That audiovisual stimulus relationships can account for response distributions supports the possibility that internal representations are based on modality-specific stimulus relationships. PMID:21574741

  19. Is the standard dose rate for de-contamination, 0.23 mc-Sv/hr, truly 1 mSv/year?

    International Nuclear Information System (INIS)

    Furuta, Sadaaki

    2014-01-01

    Examined is the validity of the standard dose rates in the title, which have been additionally defined by Ministry of the Environment (ME) to the measures of Fukushima Nuclear Power Plant Accident. The standard 0.23 mc-Sv/hr is the sum of natural ambient dose rate 0.04 mc-Sv/hr in average of Japan as measured with NaI scintillation surveymeter, plus additional accidental exposure dose 1 mSv/y, which is defined equivalent to 0.19 mc-Sv/hr. Here, the equation of addition 0.04+0.19 mc-Sv/hr is not exactly correct because the unit of each dose value has different means as follows. The natural dose is derived from the value 5.8 mc-R/hr (0.038 mc-Sv/hr, effective dose) of the average national natural dose data (2011) of Ministry of Education, Culture, Sports, Science and Technology. However, if the measurement is done with the surveymeter which practically gives 1 cm dose equivalent, the rate is calculated to be 0.06 mc-Sv/hr. When the Fukushima prefectural natural dose rate 6.4 mc-R/hr is employed, the calculation gives 0.07 mc-Sv/hr. ME defines the additional doses to be 0.19 mc-Sv/hr and 1 mSv/y, which are derived from the calculation: (0.19 mc-Sv/hr x 8 hr outdoor + 0.19 mc-Sv/hr x 0.4 indoor, shielded) x 365 d/y= 1 mSv/y. The dose is assumed to be measurable with the surveymeter (1 cm dose equivalent) and thereby calculation, if the source is mainly "1"3"4Cs and "1"3"7Cs, gives the effective dose of 0.32 mc-Sv/hr to be managed by the meter. As this, the effective dose unit and 1 cm equivalent dose unit are used for calculation of the administrative standard dose rate of 1 mSv/y, which should be recognized by both radiological experts and administration for the explanation to general public. (T.T.)

  20. Liquid metal reactor deactivation as applied to the experimental breeder reactor - II

    International Nuclear Information System (INIS)

    Earle, O. K.; Michelbacher, J. A.; Pfannenstiel, D. F.; Wells, P. B.

    1999-01-01

    The Experimental Breeder Reactor-II (EBR-II) at Argonne National Laboratory-West (ANL-W) was shutdown in September, 1994. This sodium cooled reactor had been in service since 1964, and by the US Department of Energy (DOE) mandate, was to be placed in an industrially and radiologically safe condition for ultimate decommissioning. The deactivation of a liquid metal reactor presents unique concerns. The first major task associated with the project was the removal of all fueled assemblies. In addition, sodium must be drained from systems and processed for ultimate disposal. Residual quantities of sodium remaining in systems must be deactivated or inerted to preclude future hazards associated with pyrophoricity and generation of potentially explosive hydrogen gas. A Sodium Process Facility (SPF) was designed and constructed to react the elemental sodium from the EBR-II primary and secondary systems to sodium hydroxide for disposal. This facility has a design capacity to allow the reaction of the complete inventory of sodium at ANL-W in less than two years. Additional quantities of sodium from the Fermi-1 reactor are also being treated at the SPF

  1. Preliminary Hazard Classification for the 105-B Reactor

    International Nuclear Information System (INIS)

    Kerr, N.R.

    1997-08-01

    This document summarizes the inventories of radioactive and hazardous materials present within the 105-B Reactor and uses the inventory information to determine the preliminary hazard classification for the surveillance and maintenance activities of the facility. The result of this effort was the preliminary hazard classification for the 105-B Building surveillance and maintenance activities. The preliminary hazard classification was determined to be Nuclear Category 3. Additional hazard and accident analysis will be documented in a separate report to define the hazard controls and final hazard classification

  2. Plutonium disposition study phase 1b final report

    International Nuclear Information System (INIS)

    1993-01-01

    This report provides the results of the Westinghouse activities performed as part of the Plutonium Disposition Study Phase 1b. These activities, which took place from May 16, 1993 to September 15, 1993, build upon the work completed in Phase 1a, which concluded on May 15, 1993. In Phase 1a, three Plutonium Disposal Reactor (PDR) options were developed for the disposal of excess weapons grade plutonium from returned and dismantled nuclear weapons. This report documents the results of several tasks that were performed to further knowledge in specific areas leading up to Phase 2 of the PDR Study. The Westinghouse activities for Phase 1b are summarized as follows: (1) resolved technical issues concerning reactor physics including equilibrium cycle calculations, use of gadolinium, moderator temperature coefficient, and others as documented in Section 2.0; (2) analyzed large Westinghouse commercial plants for plutonium disposal; (3) reactor safety issues including the steam line break were resolved, and are included in Section 2.0; (4) several tasks related to the PDR Fuel Cycle were examined; (5) cost and deployment options were examined to determine optimal configuration for both plutonium disposal and tritium production; (6) response to questions from DOE and National Academy of Scientists (NAS) reviewers concerning the PDR Phase 1a report are included in Appendix A

  3. How power is generated in a nuclear reactor

    International Nuclear Information System (INIS)

    Swaminathan, V.

    1978-01-01

    Power generation by nuclear fission as a result of chain reaction caused by neutrons interacting with fissile material such as 235 U, 233 U and 239 Pu is explained. Electric power production by reactor is schematically illustrated. Materials used in thermal reactor and breeder reactor are compared. Fuel reprocessing and disposal of radioactive waste coming from reprocessing plant is briefly described. Nuclear activities in India are reviewed. Four heavy water plants and two power reactors are under construction and will be operative in the near future. Two power reactors are already in operation. Nuclear Fuel Complex at Hyderabad supplies fuel element to the reactors. Fuel reprocessing and waste management facility has been set up at Tarapur. Bhabha Atomic Research Centre at Bombay and Reactor Research Centre at Kalpakkam near Madras are engaged in applied and basic research in nuclear science and engineering. (B.G.W.)

  4. Temperature dependence of liquid lithium film formation and deuterium retention on hot W samples studied by LID-QMS. Implications for future fusion reactors

    Science.gov (United States)

    de Castro, A.; Sepetys, A.; González, M.; Tabarés, F. L.

    2018-04-01

    Liquid metal (LM) divertor concepts explore an alternative solution to the challenging power/particle exhaust issues in future magnetic fusion reactors. Among them, lithium (Li) is the most promising material. Its use has shown important advantages in terms of improved H-mode plasma confinement and heat handling capabilities. In such scenario, a possible combination of tungsten (W) on the first wall and liquid Li on the divertor could be an acceptable solution, but several issues related to material compatibility remain open. In particular, the co-deposition of Li and hydrogen isotopes on W components could increase the associated tritium retention and represent a safety risk, especially if these co-deposits can uncontrollably grow in remote/plasma shadowed zones of the first wall. In this work, the retention of Li and deuterium (D) on tungsten at different surface temperature (200 °C-400 °C) has been studied by exposing W samples to Li evaporation under several D2 gaseous environments. Deuterium retention in the W-Li films has been quantified by using laser induced desorption-mass spectrometry (LID-QMS). Additional techniques as thermal desorption spectroscopy, secondary ion mass spectrometry, profilemetry and flame atomic emission spectroscopy were implemented to corroborate the retention results and for the qualitative and quantitative characterization of the films. The results showed a negligible (below LID sensibility) D uptake at T surface  =  225 °C, when the W-Li layer is exposed to simultaneous Li evaporation and D2 gas exposition (0.67 Pa). Pre-lithiated samples were also exposed to higher D2 pressures (133.3 Pa) at different temperatures (200 °C-400 °C). A non-linear drastic reduction in the D retention with increasing temperatures was found on the W-Li films, presenting a D/Li atomic ratio at 400 °C lower than 0.1 at.% on a thin film of  ≈100 nm thick. These results bode well (in terms of tritium inventory) for the potential

  5. Utilization of a typical 250 kW TRIGA Mark II reactor at a University

    International Nuclear Information System (INIS)

    Villa, M.; Boeck, H.; Musilek, A.

    2007-01-01

    The 250 kW TRIGA Mark-II reactor operates since March 1962 at the Atominstitut Vienna/Austria. Its main tasks are nuclear education and training in the fields of neutron- and solid state physics, nuclear technology, reactor safety, radiochemistry, radiation protection and dosimetry, and low temperature physics and fusion research. Academic research is carried out by students in the above mentioned fields coordinated and supervised by about 70 staff members with the aim of a masters- or PhD degree in one of the above mentioned areas. During the past 15 years about 580 students graduated through the Atominstitut. In addition, the Atominstitut co-operates closely with the nearby located IAEA in research projects, coordinated research programs (CRP) and supplying expert services. Regular training courses are carried out for the IAEA for Safeguard Trainees, fellowship places are offered for scientists from developing countries and staff members carry out expert missions to research centres in Africa, Asia and South America. Special Nuclear Material (SNM) is stored for calibration purposes at the Atominstitut belonging to the IAEA. (author)

  6. The IPR-R1 TRIGA Mark I Reactor in 39 years: Operations and general improvements

    International Nuclear Information System (INIS)

    Maretti Junior, Fausto; Prado Fernandes, Marcio; Oliveira, Paulo Fernando; Alves de Amorim, Valter

    1999-01-01

    The nuclear IPR-R1 TRIGA Mark I Reactor operating in the Nuclear Technology Development Center, originally Institute for Radioactive Research in Minas Gerais, Brazil, was dedicated in November 11, 1960. Initially operating for the production of radioisotopes for different uses, it started later to be used in large scale for neutron activation analysis and training of operators for nuclear power plants. Many improvements have been made throughout these years to provide a better performance in its operation and safety conditions. A new cooling system to operate until 300 kW, a new control rod mechanism, an aluminum tank for the reactor pool, an optimization in the pneumatic system, a new reactor control console and a general remodeling of the reactor laboratory were some of the improvements added. To prevent and mitigate the ageing effects, the reactor operation personnel is starting a program to minimize future operation problems. This paper describes the improvements made, the results obtained during the past 39 years, and the precautions taken to ensure future safe operation of the reactor to give operators better conditions of safe work. (author)

  7. [Effects of sintered bone modified with surface mineralization/P24 peptide composite biomaterial on the adhesion, proliferation and osteodifferentiation of MC3T3-E1 cells].

    Science.gov (United States)

    Li, Jingfeng; Zheng, Qixin; Guo, Xiaodong; Chen, Liaobin

    2014-10-01

    In the present research, the effects of sintered bone modified with surface mineralization/P24 peptide composite biomaterials on the adhesion, proliferation and osteodifferentiation of MC3T3-E1 cells were investigated. The experiments were divided into three groups due to biomaterials used: Group A (composite materials of sintered bone modified with surface mineralization and P24, a peptide of bone morphogenetic protein-2); Group B (sintered bone modified with surface mineralization) and Group C (sintered bone only). The three groups were observed by scanning electron microscopy (SEM) before the experiments, respectively. Then MC3T3-E1 cells were cultured on the surfaces of the three kinds of material, respectively. The cell adhesion rate was assessed by precipitation method. The proliferative ability of MC3T3-E1 cells were measured with MTT assay. And the ALP staining and measurement of alkaline phosphatase (ALP) activity were performed to assess the differentiation of cells into osteoblasts. The SEM results showed that the materials in the three groups retained the natural pore structure and the pore sizes were in the range between 200-850 μm. The adhesive ratio measurements and MTT assay suggested that adhesion and proliferation of MC3T3-E1 cells in Group A were much higher than those in Group B and Group C (P bone modified with surface mineralization/P24 composite material was confirmed to improve the adhesion rate and proliferation and osteodifferentiation of MC3T3-E1 cells, and maintained their morphology.

  8. Disposition and pharmacokinetics in rats of McN-5707, a potential antidepressant drug

    International Nuclear Information System (INIS)

    Ng, K.T.; Holland, M.L.; Hills, J.F.; Uetz, J.A.

    1986-01-01

    A single 80 mg/kg oral solution dose of McN-5707- 14 C x HBr [trans-6-(2-chlorophenyl)-1,2,3,5,6,10b-hexahydropyrrolo[2,1-a]isoquinoline hydrobromide (1:1)] was administered orally to 40 Wistar rats. Total 14 C concentrations in plasma were high (> 4.5 μg x equiv/mL) for at least 24 hours after dosing. Unchanged McN-5707 represented 14 C concs in plasma at 45 min and < 1% at 24 hours after dosing. In the 8 days following dose administration, 23% of the dose was excreted in urine and 70% of the dose was excreted in feces. Analysis (HPLC and TLC) of glusulase treated urine, plasma and fecal samples revealed the presence of multiple metabolites of McN-5707. Unchanged McN-5707 was found only in fecal extracts (2-7% of dose). Single solution doses of McN-5707 x HBr were administered p.o. (20 mg/kg) and i.v. (4 mg/kg) to 39 Wistar rats. Plasma samples were analyzed for McN-5707 using a capillary GC assay. These studies indicated that McN-5707 was well absorbed and extensively metabolized in rats following oral doses

  9. Experimental study of biotin-avidin pretargeting technique for anti-CEA McAb radioimmunoimaging

    International Nuclear Information System (INIS)

    Sun Jianzhong; Zhu Chengmo; Guan Liang; Li Biao; Zhang Jixian; Shi Ailan; Zhang Suyin

    1996-01-01

    Biotin-avidin pretargeting technique was used in promoting the diagnostic efficacy of anti-CEA McAb radioimmunoimaging. CEA McAb was conjugated with biotin McAb (B-McAb), streptavidin (SA) was labeled with 131 I ( 131 I-SA) and DTPA-biotin with 111 In( 111 In-DTPA-B). Experimental human colonic tumor bearing nude mice were used. Two step method: B-McAb was preinjected, followed by 131 I SA 48h later, 24, 48, 96 and 120 h postinjection, γ-imaging and biodistribution were studied. Three step method: B-McAb was preinjected, followed by cold SA 24h later and 111 In-DTPA-B another 24h later. 2,6,24 and 48h postinjection, γ-imaging and biodistribution were also studied. Two step method: T/NT of all organs in experimental group was significantly increased compared with controls. The blood T/NT in experimental group and control group at 24 and 120h was 1.11:0.42 and 8.58:3.51, respectively. Tumor % ID/g in all organs slightly decreased compared with direct group. In γ-imaging radioactivity has been accumulated in tumor site as early as 24h, while only slightly visualized or non-visualized in controls. Three step method: in experimental group the blood T/NT reached 4.19 at 2 h, whereas all was < 1.37 at each phase of controls, the T/NT of all organs was also higher in experimental grouped than in controls. The tumor % ID/g in experimental group was 9.72% at 2h and 3.65% at 48h whereas % ID/g in controls in all phases was <3.07. The tumor clearly visualized at 2h and clearer at 48h in γ-imaging. In controls, the tumor was slightly visualized also to early stage, but faded away later on. Biotin-avidin pretargeting technique can elevate the T/NT ratio and decrease the blood background. Early imaging was obtained with better imaging quality

  10. Education

    Science.gov (United States)

    2003-01-01

    Frank Sosa, Dept. of the Air Force Col Juan Urbano , Peruvian Army Dr. Francis A’Hearn, Faculty Prof. William Mayall, Faculty COL Mark McGuire...insufficient time to meet job requirements such as planning lessons to grading papers, to participating in mandatory training to phoning parents to...

  11. Melanocortin MC(4) receptor-mediated feeding and grooming in rodents.

    Science.gov (United States)

    Mul, Joram D; Spruijt, Berry M; Brakkee, Jan H; Adan, Roger A H

    2013-11-05

    Decades ago it was recognized that the pharmacological profile of melanocortin ligands that stimulated grooming behavior in rats was strikingly similar to that of Xenopus laevis melanophore pigment dispersion. After cloning of the melanocortin MC1 receptor, expressed in melanocytes, and the melanocortin MC4 receptor, expressed mainly in brain, the pharmacological profiles of these receptors appeared to be very similar and it was demonstrated that these receptors mediate melanocortin-induced pigmentation and grooming respectively. Grooming is a low priority behavior that is concerned with care of body surface. Activation of central melanocortin MC4 receptors is also associated with meal termination, and continued postprandial stimulation of melanocortin MC4 receptors may stimulate natural postprandial grooming behavior as part of the behavioral satiety sequence. Indeed, melanocortins fail to suppress food intake or induce grooming behavior in melanocortin MC4 receptor-deficient rats. This review will focus on how melanocortins affect grooming behavior through the melanocortin MC4 receptor, and how melanocortin MC4 receptors mediate feeding behavior. This review also illustrates how melanocortins were the most likely candidates to mediate grooming and feeding based on the natural behaviors they induced. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. The 4th surveillance test and evaluation of the reactor pressure vessel material (capsule W) of Yonggwang nuclear power plant unit 2

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Kee Ok; Kim, Byoung Chul; Lee, Sam Lai; Choi, Kwon Jae; Gong, Un Sik; Chang, Jong Hwa; Joo, Yong Sun; Ahn, Sang Bok; Hong, Joon Hwa [Korea Atomic Energy Research Institute, Taejeon (Korea)

    2001-02-01

    Surveillance testing for reactor vessel materials is performed in order to evaluate the irradiation embrittlement due to neutrons during operation and set the condition of safe operation of nuclear reactor. The 4th surveillance testing was performed completely by Korea Atomic Energy Research Institute at Taejeon after the capsule was transported from Kori site including its removal from reactor. Fast neutron fluences for capsules were calculated and various testing including mechanical and chemistry analysis were performed in order to evaluate the integrity of Yonggwang unit 2 reactor vessel during the operation until life time. The evaluation results are as follows; Fast neutron fluences for capsules U, V, X and W are 5.762E+18, 1.5391E+19, 3.5119E+19, and 4.2610E+19 n/cm{sup 2}, respectively. The bias factor, the ratio of measurement versus calculation, was 0.899 for the 1st through 4th testing and the calculational uncertainty, 12.3% satisfied the requirement of USNRC Reg.Guide DG-1053, 20%. The best estimated neutron fluence for reactor vessel inside surface was 1.357E+19 n/cm{sup 2} based on the end of 11th fuel cycle and it was predicted that the fluences of vessel inside surface at 32, 40, 48 and 56EFPY would reach 3.525E+19, 4.337E+19, 5.148E+19 and 5.960E+19 n/cm{sup 2} based on the current calculation. The result through this analysis for Yonggwang unit 2 showed that there would be no problem for the pressurized thermal shock(PTS) during the operation until design life. 48 refs., 35 figs., 42 tabs. (Author)

  13. Transepithelial resistance and claudin expression in trout RTgill-W1 cell line

    DEFF Research Database (Denmark)

    T. Trubitt, Rebecca; Rabeneck, D. Brett; Bujak, Joanna

    2015-01-01

    In the present study, we examined the trout gill cell line RTgill-W1 as a possible tool for in vitro investigation of epithelial gill function in fish. After seeding in transwells, transepithelial resistance (TER) increased until reaching a plateau after 1–2 days (20–80 Ω⋅cm2), which was then mai......In the present study, we examined the trout gill cell line RTgill-W1 as a possible tool for in vitro investigation of epithelial gill function in fish. After seeding in transwells, transepithelial resistance (TER) increased until reaching a plateau after 1–2 days (20–80 Ω⋅cm2), which...... was then maintained for more than 6 days. Tetrabromocinnamic acid, a known stimulator of TER via casein kinase II inhibition, elevated TER in the cell line to 125% of control values after 2 and 6 h. Treatment with ethylenediaminetetraacetic acid induced a decrease in TER to b15% of pre-treatment level. Cortisol...... detected Cldn-10e and Cldn-30 immunoreactive proteins of expected molecular weight in samples from rainbow trout gills but not from RTgill-W1 cultures, possibly due to low expression levels. Collectively, these results show that the RTgill-W1 cell layers have tight junctions between cells, are sensitive...

  14. Calculation and Analysis of B/T (Burning and/or Transmutation Rate of Minor Actinides and Plutonium Performed by Fast B/T Reactor

    Directory of Open Access Journals (Sweden)

    Marsodi

    2006-01-01

    Full Text Available Calculation and analysis of B/T (Burning and/or Transmutation rate of MA (minor actinides and Pu (Plutonium has been performed in fast B/T reactor. The study was based on the assumption that the spectrum shift of neutron flux to higher side of neutron energy had a potential significance for designing the fast B/T reactor and a remarkable effect for increasing the B/T rate of MA and/or Pu. The spectrum shifts of neutron have been performed by change MOX to metallic fuel. Blending fraction of MA and or Pu in B/T fuel and the volume ratio of fuel to coolant in the reactor core were also considered. Here, the performance of fast B/T reactor was evaluated theoretically based on the calculation results of the neutronics and burn-up analysis. In this study, the B/T rate of MA and/or Pu increased by increasing the blending fraction of MA and or Pu and by changing the F/C ratio. According to the results, the total B/T rate, i.e. [B/T rate]MA + [B/T rate]Pu, could be kept nearly constant under the critical condition, if the sum of the MA and Pu inventory in the core is nearly constant. The effect of loading structure was examined for inner or outer loading of concentric geometry and for homogeneous loading. Homogeneous loading of B/T fuel was the good structure for obtaining the higher B/T rate, rather than inner or outer loading

  15. Evaluation of uranium anomalies in the McCaslin Syncline, northeastern Wisconsin

    International Nuclear Information System (INIS)

    Blackburn, W.H.; Mathews, G.W.

    1982-01-01

    On the basis of this investigation, the McCaslin area does not demonstrate sufficient recognition criteria to be considered favorable for the occurrence of uranium deposits that are analogous to quartz-pebble conglomerate deposits or unconformity-related deposits. Neither model is applicable because: (1) More often than not the conglomeratic lenses of the McCaslin Quartzite are polymictic. (2) Pyrite and chlorite are essentially lacking; (3) Pervasive chloritic and hematitic alteration are not present in the McCaslin district; (4) The maximum estimated age of the McCaslin is 1.9 b.y.; (5) The notable absence of anomalous uranium values in the basal McCaslin Quartzite, and especially where known faulting intersects the McCaslin, suggests that a process for concentrating uranium has not been effective in the area; (6) The Waupee Volcanics are not known to contain any extensive graphitic or chloritic schists, nor do they have more than normal amounts of uranium; (7) Uranium anomalies in stream-water, stream-sediment, and aerial surveys may be explained by uranium derived from the relatively uraniferous Hager Rhyolite, or other granitic intrusives related to the Wolf River batholith. The McCaslin area warrants no further investigation; it will not contribute any significant new potential the the NURE resource base. 3 figures, 3 tables

  16. The MC21 Monte Carlo Transport Code

    International Nuclear Information System (INIS)

    Sutton TM; Donovan TJ; Trumbull TH; Dobreff PS; Caro E; Griesheimer DP; Tyburski LJ; Carpenter DC; Joo H

    2007-01-01

    MC21 is a new Monte Carlo neutron and photon transport code currently under joint development at the Knolls Atomic Power Laboratory and the Bettis Atomic Power Laboratory. MC21 is the Monte Carlo transport kernel of the broader Common Monte Carlo Design Tool (CMCDT), which is also currently under development. The vision for CMCDT is to provide an automated, computer-aided modeling and post-processing environment integrated with a Monte Carlo solver that is optimized for reactor analysis. CMCDT represents a strategy to push the Monte Carlo method beyond its traditional role as a benchmarking tool or ''tool of last resort'' and into a dominant design role. This paper describes various aspects of the code, including the neutron physics and nuclear data treatments, the geometry representation, and the tally and depletion capabilities

  17. Status of data testing of ENDF/B-V reactor dosimetry file

    International Nuclear Information System (INIS)

    Magurno, B.A.

    1979-01-01

    The ENDF/B-V Reactor Dosimetry File was released August 1979, and Phase II data testing started. The results presented here are from Brookhaven National Laboratory only, and are considered preliminary. The tests include calculated spectrum-averaged cross sections using 235 U fission spectrum (Watt), 252 Cf spontaneous fission spectrum (Watt and Maxwellian), and the Coupled Fast Reactor Measurement Facility (CFRMF) spectrum. 6 tables

  18. The Relationship between MC1R Mutation and Plumage Color Variation in Pigeons

    Directory of Open Access Journals (Sweden)

    Jin-Shan Ran

    2016-01-01

    Full Text Available The polymorphisms of MC1R gene play a crucial role in coat color variation in mammals; however, the relationship is still unclear in pigeons. In this study, we sequenced 741 bp fragment of the MC1R for 39 individuals with five plumage color patterns (gray plumage, n=12; black plumage, n=9; white plumage, n=3; spotted plumage, n=12; red plumage, n=3. A total of three single nucleotide polymorphisms (SNPs were detected, including G199A, G225A, and A466G, which subsequently determined four haplotypes (H1–H4. Among them, H1 is the predominant haplotype. Association analysis revealed that H1 and H3 were significantly associated with the black plumage trait (P<0.05, while the H4 was significantly associated with gray plumage trait (P<0.05. Furthermore, only diplotype H1H1 was significantly associated with black and gray traits of pigeons. Collectively, our study suggested an association between genetic variation of MC1R and plumage color in pigeon.

  19. Somatyczna determinacja płciowa w nadwadze i otyłości

    Directory of Open Access Journals (Sweden)

    Michał Zych

    2015-12-01

    Full Text Available Wstęp: Somatyczne wielkości, takie jak masa (Mc i wysokość ciała (Wc, są używane do wyliczania wskaźników wagowo--wzrostowych i stanowią pomoc w diagnozowaniu nadwagi i otyłości. Cel pracy: Celem pracy jest ocena nadwagi i otyłości kobiet i mężczyzn w świetle prostych wskaźników somatycznych. Materiał i metody: W prezentowanej pracy porównano wskaźniki somatyczne 179 kobiet i 181 mężczyzn z nadwagą i otyłością. Do oceny somatycznej badanych użyto: Mc, Wc oraz wskaźników wagowo-wzrostowych: Queteleta, BMI, Rohrera i smukłości. Wyniki: W badanych grupach kobiety i mężczyźni byli w zbliżonym wieku, grupy te różniły się istotnie omawianymi wskaźnikami somatycznymi. Porównania podgrup kobiet i mężczyzn o podobnej wielkości BMI wykazały, że są oni w podobnym wieku i różnią się w zakresie Mc, Wc oraz wskaźników: Queteleta, Rohrera i smukłości. Natomiast między podgrupami kobiet, jak i między podgrupami mężczyzn, występowały istotne różnice wiekowe, Mc oraz wskaźników: BMI, Queteleta, Rohrera i smukłości. Wnioski: Powyższe dane wskazują, że pomimo braku różnic wieku między badanymi kobietami i mężczyznami z podobnym lub różnym BMI istnieje wyraźna somatyczna determinacja płciowa, natomiast w obrębie tej samej płci, różniącej się wskaźnikiem BMI, wiek badanych jest czynnikiem determinacji somatycznej. Wykazano też, że badane wskaźniki somatyczne mają różną moc predykcyjną w zakresie oceny nadwagi i stopnia otyłości badanych kobiet i mężczyzn.

  20. EphB1 as a Novel Drug Target to Combat Pain and Addiction

    Science.gov (United States)

    2017-09-01

    AWARD NUMBER: W81XWH-14-1-0220 TITLE: EphB1 as a Novel Drug Target to Combat Pain and Addiction PRINCIPAL INVESTIGATOR: Mark Henkemeyer...as a Novel Drug Target to Combat Pain and Ad 5a. CONTRACT NUMBER EphB1 as a Novel Drug Target to Combat Pain and Addiction 5b. GRANT NUMBER W81XWH...neuronal and has functions in vascular endothelial cells. 6. We have also carried out computational analysis of potantial docking/binding of chemical

  1. The crystal structure of the mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15

    Science.gov (United States)

    Tellier, J.; Boullay, Ph.; Créon, N.; Mercurio, D.

    2005-09-01

    The crystal structure of the 1+2 mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15 (SG I2cm n o 46: -cba, Z=4, a=5.4092(3) Å, b=5.3843(3) Å and c=41.529(3) Å) consisting of the ordered intergrowth of one and two octahedra thick perovskite-type blocks separated by [Bi 2O 2] 2+ slabs is reported. Supported by an electron diffraction investigation and, using the Rietveld analysis, it is shown that this compound should be described using a I-centering lattice in agreement with the generalised structural model of the Aurivillius type compounds recently presented by the authors. The structure of this Bi 5Ti 1.5W 1.5O 15 phase is analyzed in comparison with the related simple members (Bi 2WO 6 and Bi 3Ti 1.5W 0.5O 9). The crystal structure of Bi 3Ti 1.5W 0.5O 9 is also reported.

  2. On sibling and expectational W-strings

    International Nuclear Information System (INIS)

    Lu, H.; Pope, C.N.; Schrans, S.; Wang, X.J.

    1992-01-01

    We discuss the physical spectrum for W-strings based on the algebras B n , D n , E 6 , E 7 and E 8 . For a simply laced W-string, we find a connection with the (h, h+1) unitary Virasoro minimal model, where h is the dual Coxeter number of the underlying Lie algebra. For the W-string based on B n , we find a connection with the (2h, 2h+2) unitary N=1 super-Virasoro minimal model. (orig.)

  3. W. E. B. Du Bois: Reform, Will, and the Veil

    Science.gov (United States)

    England, Lynn; Warner, W. Keith

    2013-01-01

    While W. E. B. Du Bois is widely recognized for his contributions to the sociology of race, his contributions to the foundations of sociology are largely ignored. His sociology is based on African American reformism, a version of pragmatism, and a contingent historicism. The basic view of sociology is one that emphasizes the role of chance and…

  4. Homogeneous fast reactor benchmark testing of CENDL-2 and ENDF/B-6

    International Nuclear Information System (INIS)

    Liu Guisheng

    1995-01-01

    How to choose correct weighting spectrum has been studied to produce multigroup constants for fast reactor benchmark calculations. A correct weighting option makes us obtain satisfying results of K eff and central reaction rate ratios for nine fast reactor benchmark testings of CENDL-2 and ENDF/B-6. (4 tabs., 2 figs.)

  5. Measurement of thermal neutron flux spatial distribution in the IEA-R1 reactor core

    International Nuclear Information System (INIS)

    D'Utra Bitelli, U.

    1993-01-01

    This work presents the spatial thermal neutron flux in IEA-R1 reactor obtained by activation foils methods. These measurements were made in 27 fuel elements of the reactor core (165 B configuration). The results are important to compare with theoretical values, power calibration and safety analysis. (author)

  6. Scaffold Attachment Factor B1: A Novel Chromatin Regulator of Prostate Cancer Metabolism

    Science.gov (United States)

    2016-10-01

    AWARD NUMBER: W81XWH-14-1-0152 TITLE: Scaffold Attachment Factor B1: A Novel Chromatin Regulator of Prostate Cancer Metabolism PRINCIPAL...TITLE AND SUBTITLE 5a. CONTRACT NUMBER W81XWH-14-1-0152 Scaffold Attachment Factor B1: A Novel Chromatin Regulator of Prostate Cancer Metabolism... chromatin immunoprecipitation-next generation DNA sequencing (ChIP-seq) and integrative network modeling to identify the SAFB1 cistrome and the extent of

  7. A systematic catalogue of the Coleopterous family Helotidae in the Leiden Museum

    NARCIS (Netherlands)

    Ritsema, C.

    1915-01-01

    Gen. HELOTA Mc L.1) Mc Leay, Annulosa Javanica, 1825, p. 42; ed. Lequien, 1833, p. 151. INDOMALAYAN SPECIES. (Nos. 1—69). 1. Vigorsi Mc L. Annul. Javan. 1825, p. 43, tab. 1, fig. 9; ed. Lequien, 1833, p. 152, tab. 5, fig. 4. a. ♀. Java or.: Mt. Ardjoeno (W. E. J. Hekmeyer). b. ♀. Java (A. B. v.

  8. Delayed photoneutrons of the of the Dalat Nuclear Research Reactor

    International Nuclear Information System (INIS)

    Ngo Quang Huy; Ha Van Thong; Vu Hai Long; Ngo Phu Khang; Nguyen Nhi Dien; Pham Van Lam; Huynh Dong Phuong; Luong Ba Vien; Le Vinh Vinh

    1994-01-01

    Time spectrum of delayed neutrons of the Dalat nuclear research reactor is measured and analyzed. It corresponds to a shut-down neutron fluxes of about 10 5 /10 8 n/cm 2 /sec after 100 hours continuous reactor operation at steady power level of 500 kW. Data processing of experimental time neutron spectrum gives 16 exponents, of which 10, resulting from photoneutrons due to (γ,n) reactions on beryllium used inside the reactor core, are obtained by using successive exponential stripping fitting method. For the Dalat reactor, the effective delayed photoneutron fraction relative to the total effective delayed neutron fraction is β B e eff =0.49%β eff for a beryllium weight relative to U 235 fuel of m B e/m U = 8.5. This result is acceptable in comparison to those obtained for other Be-U 235 media. (author). 5 refs., 2 figs., 4 tabs

  9. Thermal neutron flux measurements in the rotary specimen rack of the IPR-R1 TRIGA reactor

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Rose Mary G. do Prado; Rodrigues, Rogério R.; Souza, Luiz Claudio A., E-mail: souzarm@cdtn.br, E-mail: rrr@cdtn.br, E-mail: lcas@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2017-07-01

    The thermal neutron flux in the rotary specimen rack of the IPR-R1 TRIGA reactor at the Nuclear Technology Development Center (CDTN), Belo Horizonte, Brazil, has been measured by the neutron activation method, using bare and cadmium covered gold foils. Those foils were irradiated in the rotary specimen rack with the reactor at 100 kW. The reactor core configuration has 63 fuel elements, composed of 59 original aluminum-clad elements and 4 stainless steel-clad fuel elements. The gamma activities of the foils were measured using Ge spectrometer. The perturbations of the thermal neutron flux caused by the introduction of an absorbing foil into the medium were considered in order to obtain accurate determination of the flux. The thermal neutron flux obtained was 7.4 x 10{sup 11} n.cm{sup -2}.s{sup -1}. (author)

  10. Process control program development

    International Nuclear Information System (INIS)

    Dameron, H.J.

    1985-01-01

    This paper details the development and implementation of a ''Process Control Program'' at Duke Power's three nuclear stations - Oconee, McGuire, and Catawba. Each station is required by Technical Specification to have a ''Process Control Program'' (PCP) to control all dewatering and/or solidification activities for radioactive wastes

  11. miR-195 inhibited abnormal activation of osteoblast differentiation in MC3T3-E1 cells via targeting RAF-1.

    Science.gov (United States)

    Chao, Chen; Li, Feng; Tan, Zhiping; Zhang, Weizhi; Yang, Yifeng; Luo, Cheng

    2018-01-15

    Recent reports have demonstrated that RAF-1 L613V (a mutant of RAF-1) mutant mice show bone deformities similar to Noonan syndrome. It has been suggested that RAF-1 L613V might abnormally activate osteoblast differentiation of MC3T3-E1 cells. To demonstrate that RAF-1 is associated with bone deformity and that RAF-1 L613V dependent bone deformity could be inhibited by microRNA-195 (miR-195), we first investigated the amplifying influence of wild-type RAF-1 (WT) or RAF-1 L613V (L613V) on the viability and differentiation of MC3T3-E1 cells induced by bone morphogenetic protein-2 (BMP-2) via 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay, alkaline phosphatase (ALP) and Alizarin Red S (ARS) staining, quantitative real-time polymerase chain reaction (qRT-PCR) and western blot analysis. Subsequently, we investigated the blocking effect and its mechanism of miR-195 for abnormal activation of osteoblast differentiation of MC3T3-E1 cells via targeting RAF-1. RAF-1, especially RAF-1 L613V , abnormally activates osteoblast differentiation of MC3T3-E1 cells induced by BMP-2. Meanwhile, miR-195 could inhibit the cell viability and differentiation of MC3T3-E1 cells. Transfection of miR-195 largely suppressed the L613V-induced viability and osteoblast differentiation of MC3T3-E1 cells and attenuated the accelerative effect of L613V on runt-related transcription factor-2 (Runx2), Osterix (OSX), alkaline phosphatase (ALP), osteocalcin (OCN), and distal-less homeobox 5 (DLX5) osteogenic gene expressions. In addition, miR-195 decreased the expression of RAF-1 mRNA and protein by directly targeting the 3'-untranslated regions (3'-UTR) of RAF-1 mRNA in MC3T3-E1 cells. Our findings indicated that miR-195 inhibited WT and L613V RAF-1 induced hyperactive osteoblast differentiation in MC3T3-E1 cells by targeting RAF-1. miR-195 might be a novel therapeutic agent for the treatment of L613V-induced bone deformity in Noonan syndrome. Copyright © 2017. Published by

  12. Homogeneous fast reactor benchmark testing of CENDL-2 and ENDF/B-6

    International Nuclear Information System (INIS)

    Liu Guisheng

    1995-11-01

    How to choose correct weighting spectrum has been studied to produce multigroup constants for fast reactor benchmark calculations. A correct weighting option makes us obtain satisfying results of K eff and central reaction rate ratios for nine fast reactor benchmark testing of CENDL-2 and ENDF/B-6. (author). 8 refs, 2 figs, 4 tabs

  13. Hybrid and Parallel Domain-Decomposition Methods Development to Enable Monte Carlo for Reactor Analyses

    International Nuclear Information System (INIS)

    Wagner, John C.; Mosher, Scott W.; Evans, Thomas M.; Peplow, Douglas E.; Turner, John A.

    2010-01-01

    This paper describes code and methods development at the Oak Ridge National Laboratory focused on enabling high-fidelity, large-scale reactor analyses with Monte Carlo (MC). Current state-of-the-art tools and methods used to perform real commercial reactor analyses have several undesirable features, the most significant of which is the non-rigorous spatial decomposition scheme. Monte Carlo methods, which allow detailed and accurate modeling of the full geometry and are considered the gold standard for radiation transport solutions, are playing an ever-increasing role in correcting and/or verifying the deterministic, multi-level spatial decomposition methodology in current practice. However, the prohibitive computational requirements associated with obtaining fully converged, system-wide solutions restrict the role of MC to benchmarking deterministic results at a limited number of state-points for a limited number of relevant quantities. The goal of this research is to change this paradigm by enabling direct use of MC for full-core reactor analyses. The most significant of the many technical challenges that must be overcome are the slow, non-uniform convergence of system-wide MC estimates and the memory requirements associated with detailed solutions throughout a reactor (problems involving hundreds of millions of different material and tally regions due to fuel irradiation, temperature distributions, and the needs associated with multi-physics code coupling). To address these challenges, our research has focused on the development and implementation of (1) a novel hybrid deterministic/MC method for determining high-precision fluxes throughout the problem space in k-eigenvalue problems and (2) an efficient MC domain-decomposition (DD) algorithm that partitions the problem phase space onto multiple processors for massively parallel systems, with statistical uncertainty estimation. The hybrid method development is based on an extension of the FW-CADIS method, which

  14. Hybrid and parallel domain-decomposition methods development to enable Monte Carlo for reactor analyses

    International Nuclear Information System (INIS)

    Wagner, J.C.; Mosher, S.W.; Evans, T.M.; Peplow, D.E.; Turner, J.A.

    2010-01-01

    This paper describes code and methods development at the Oak Ridge National Laboratory focused on enabling high-fidelity, large-scale reactor analyses with Monte Carlo (MC). Current state-of-the-art tools and methods used to perform 'real' commercial reactor analyses have several undesirable features, the most significant of which is the non-rigorous spatial decomposition scheme. Monte Carlo methods, which allow detailed and accurate modeling of the full geometry and are considered the 'gold standard' for radiation transport solutions, are playing an ever-increasing role in correcting and/or verifying the deterministic, multi-level spatial decomposition methodology in current practice. However, the prohibitive computational requirements associated with obtaining fully converged, system-wide solutions restrict the role of MC to benchmarking deterministic results at a limited number of state-points for a limited number of relevant quantities. The goal of this research is to change this paradigm by enabling direct use of MC for full-core reactor analyses. The most significant of the many technical challenges that must be overcome are the slow, non-uniform convergence of system-wide MC estimates and the memory requirements associated with detailed solutions throughout a reactor (problems involving hundreds of millions of different material and tally regions due to fuel irradiation, temperature distributions, and the needs associated with multi-physics code coupling). To address these challenges, our research has focused on the development and implementation of (1) a novel hybrid deterministic/MC method for determining high-precision fluxes throughout the problem space in k-eigenvalue problems and (2) an efficient MC domain-decomposition (DD) algorithm that partitions the problem phase space onto multiple processors for massively parallel systems, with statistical uncertainty estimation. The hybrid method development is based on an extension of the FW-CADIS method

  15. 26 CFR 1.414(w)-1 - Permissible withdrawals from eligible automatic contribution arrangements.

    Science.gov (United States)

    2010-04-01

    ... contribution arrangements. 1.414(w)-1 Section 1.414(w)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Plans, Etc. § 1.414(w)-1 Permissible withdrawals from eligible automatic contribution arrangements. (a) Overview. Section 414(w) provides rules under which certain employees are permitted to elect to make a...

  16. Proton-induced nanorod melting in a coating obtained from the pulsed laser ablation of W{sub 2}B{sub 5}/B{sub 4}C

    Energy Technology Data Exchange (ETDEWEB)

    Tadadjeu Sokeng, I., E-mail: ifriky@tlabs.ac.za [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville Campus, PO Box 1906, Bellville 7530 (South Africa); Electron Microscopy Unit, University of the Western Cape, Private bag x17, Bellville 7535 (South Africa); Ngom, B.D. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Laboratoire de Photonique et de Nanofrabrication, Groupes de physique du Solide et Sciences des Matriaux (GPSSM), Facult des sciences et Techniques, Universit Cheikh Anta Diop de Dakar (UCAD), B.P. 25114 Dakar-Fann, Dakar (Senegal); Cummings, F. [Electron Microscopy Unit, University of the Western Cape, Private bag x17, Bellville 7535 (South Africa); Kotsedi, L. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Msimanga, M. [iThemba LABS Gauten, Private Bag 11, WITS 2050, Johannesburg (South Africa); Maaza, M. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); and others

    2015-02-01

    Highlights: • Coatings from ablated B{sub 4}C/W{sub 2}B{sub 5} were irradiated with 900 keV protons. • Nanorod clusters were observed to melt and disperse. • Uniformly shaped nanorods were observed to grow. • Lateral diffusion of energy and lateral dispersion of matter were observed. - Abstract: Coatings obtained from pulsed laser ablated W{sub 2}B{sub 5}/B{sub 4}C were irradiated with 900keV protons at fluences ranging from about 1×10{sup 15}protons/cm{sup 2} to about 4×10{sup 15}protons/cm{sup 2}. Scanning Electron Microscopy (SEM) and Energy Dispersive Spectroscopy (EDS) were used to study the resulting structural effects. Clusters of nanorods were observed to disperse and reduce in number with increase in proton fluence. The atomic percentage of constituent elements were observed to vary with proton fluence, both within the nanorods and the film floor. Our results show that the structural effect of proton irradiation on the coating is lateral dispersion of matter.

  17. Reactor noise analysis of experimental fast reactor 'JOYO'

    International Nuclear Information System (INIS)

    Ohtani, Hideji; Yamamoto, Hisashi

    1980-01-01

    As a part of dynamics tests in experimental fast reactor ''JOYO'', reactor noise tests were carried out. The reactor noise analysis techniques are effective for study of plant characteristics by determining fluctuations of process signals (neutron signal, reactor inlet temperature signals, etc.), which are able to be measured without disturbances for reactor operations. The aims of reactor noise tests were to confirm that no unstable phenomenon exists in ''JOYO'' and to gain initial data of the plant for reference of the future data. Data for the reactor noise tests treated in this paper were obtained at 50 MW power level. Fluctuations of process signals were amplified and recorded on analogue tapes. The analysis was performed using noise code (NOISA) of digital computer, with which statistical values of ASPD (auto power spectral density), CPSD (cross power spectral density), and CF (coherence function) were calculated. The primary points of the results are as follows. 1. RMS value of neutron signal at 50 MW power level is about 0.03 MW. This neutron fluctuation is not disturbing reactor operations. 2. The fluctuations of A loop reactor inlet temperatures (T sub(AI)) are larger than the fluctuations of B loop reactor inlet temperature (T sub(BI)). For this reason, the major driving force of neutron fluctuations seems to be the fluctuations of T sub(AI). 3. Core and blanket subassemblies can be divided into two halves (A and B region), with respect to the spacial motion of temperature in the reactor core. A or B region means the region in which sodium temperature fluctuations in subassembly are significantly affected by T sub(AI) or T sub(BI), respectively. This phenomenon seems to be due to the lack of mixing of A and B loop sodium in lower plenum of reactor vessel. (author)

  18. A 1.1nW Energy Harvesting System with 544pW Quiescent Power for Next Generation Implants.

    Science.gov (United States)

    Bandyopadhyay, Saurav; Mercier, Patrick P; Lysaght, Andrew C; Stankovic, Konstantina M; Chandrakasan, Anantha P

    2014-12-01

    This paper presents a nW power management unit (PMU) for an autonomous wireless sensor that sustains itself by harvesting energy from the endocochlear potential (EP), the 70-100 mV electrochemical bio-potential inside the mammalian ear. Due to the anatomical constraints inside the inner ear, the total extractable power from the EP is limited to 1.1-6.25 nW. A nW boost converter is used to increase the input voltage (30-55 mV) to a higher voltage (0.8 to 1.1 V) usable by CMOS circuits in the sensor. A pW Charge Pump circuit is used to minimize the leakage in the boost converter. Further, ultra-low-power control circuits consisting of digital implementations of input impedance adjustment circuits and Zero Current Switching circuits along with Timer and Reference circuits keep the quiescent power of the PMU down to 544 pW. The designed boost converter achieves a peak power conversion efficiency of 56%. The PMU can sustain itself and a duty-cyled ultra-low power load while extracting power from the EP of a live guinea pig. The PMU circuits have been implemented on a 0.18µm CMOS process.

  19. Screening of TYR, OCA2, GPR143, and MC1R in patients with congenital nystagmus, macular hypoplasia, and fundus hypopigmentation indicating albinism

    Science.gov (United States)

    Preising, Markus N.; Gonser, Miriam; Lorenz, Birgit

    2011-01-01

    can be deduced from a frequent association of MC1R variants with p.R305W or p.R419Q in OCA2. PMID:21541274

  20. Assessment of structural materials inside the reactor pool of the Dalat research reactor

    International Nuclear Information System (INIS)

    Nguyen Nhi Dien; Luong Ba Vien; Nguyen Minh Tuan; Trang Cao Su

    2010-01-01

    Originally the Dalat Nuclear Research Reactor (DNRR) was a 250-kW TRIGA MARK II reactor, started building from early 1960s and achieved the first criticality on February 26, 1963. During the 1982-1984 period, the reactor was reconstructed and upgraded to 500kW, and restarted operation on March 20, 1984. From the original TRIGA reactor, only the pool liner, beam ports, thermal columns, and graphite reflector have been remained. The structural materials of pool liner and other components of TRIGA were made of aluminum alloy 6061 and aluminum cladding fuel assemblies. Some other parts, such as reactor core, irradiation rotary rack around the core, vertical irradiation facilities, etc. were replaced by the former Soviet Union's design with structural materials of aluminum alloy CAV-1. WWR-M2 fuel assemblies of U-Al alloy 36% and 19.75% 235 U enrichment and aluminum cladding have been used. In its original version, the reactor was setting upon an all-welded aluminum frame supported by four legs attached to the bottom of the pool. After the modification made, the new core is now suspended from the top of the pool liner by means of three aluminum concentric cylindrical shells. The upper one has a diameter of 1.9m, a length of 3.5m and a thickness of 10mm. This shell prevents from any visual access to the upper part of the pool liner, but is provided with some holes to facilitate water circulation in the 4cm gap between itself and the reactor pool liner. The lower cylindrical shells act as an extracting well for water circulation. As reactor has been operated at low power of 500 kW, it was no any problem with degradation of core structural materials due to neutron irradiation and thermal heat, but there are some ageing issues with aluminum liner and other structures (for example, corrosion of tightening-up steel bolt in the fourth beam port and flood of neutron detector housing) inside the reactor pool. In this report, the authors give an overview and assessment of

  1. Test pilots 1962 - Armstrong, Walker, Dana, Peterson, McKay, Thompson, Butchart

    Science.gov (United States)

    1962-01-01

    The research pilots at what in 1962 was called the Flight Research Center standing in front of the X-1E. They are (left to right) Neil Armstrong, Joe Walker, Bill Dana, Bruce Peterson, Jack McKay, Milt Thompson, and Stan Butchart. of the group, Armstrong, Walker, Dana, McKay and Thompson all flew the X-15. Bruce Peterson flew the M2-F2 and HL-10 lifting bodies, while Stan Butchart was the B-29 drop plane pilot for many of the D-558-II and X-1 series research aircraft.

  2. Improvement of Reactor Fuel Element Heat Transfer by Surface Roughness

    Energy Technology Data Exchange (ETDEWEB)

    Kjellstroem, B; Larsson, A E

    1967-04-15

    In heat exchangers with a limited surface temperature such as reactor fuel elements, rough heat transfer surfaces may give lower pumping power than smooth. To obtain data for choice of the most advantageous roughness for the superheater elements in the Marviken reactor, measurements were made of heat transfer and pressure drop in an annular channel with a smooth or rough test rod in a smooth adiabatic shroud. 24 different roughness geometries were tested. The results were transformed to rod cluster geometry by the method of W B Hall, and correlated by the friction and heat transfer similarity laws as suggested by D F Dipprey and R H Sabersky with RMS errors of 12.5 % in the friction factor and 8.1 % in the Stanton number. The relation between the Stanton number and the friction factor could be described by a relation of the type suggested by W Nunner, with a mean error of 3.1 % and an RMS error of 11.6 %. Application of the results to fuel element calculations is discussed, and the great gains in economy which can be obtained with rough surfaces are demonstrated by two examples.

  3. Improvement of Reactor Fuel Element Heat Transfer by Surface Roughness

    International Nuclear Information System (INIS)

    Kjellstroem, B.; Larsson, A.E.

    1967-04-01

    In heat exchangers with a limited surface temperature such as reactor fuel elements, rough heat transfer surfaces may give lower pumping power than smooth. To obtain data for choice of the most advantageous roughness for the superheater elements in the Marviken reactor, measurements were made of heat transfer and pressure drop in an annular channel with a smooth or rough test rod in a smooth adiabatic shroud. 24 different roughness geometries were tested. The results were transformed to rod cluster geometry by the method of W B Hall, and correlated by the friction and heat transfer similarity laws as suggested by D F Dipprey and R H Sabersky with RMS errors of 12.5 % in the friction factor and 8.1 % in the Stanton number. The relation between the Stanton number and the friction factor could be described by a relation of the type suggested by W Nunner, with a mean error of 3.1 % and an RMS error of 11.6 %. Application of the results to fuel element calculations is discussed, and the great gains in economy which can be obtained with rough surfaces are demonstrated by two examples

  4. McStas 1.1: A tool for building neutron Monte Carlo simulations

    DEFF Research Database (Denmark)

    Lefmann, K.; Nielsen, K.; Tennant, D.A.

    2000-01-01

    McStas is a project to develop general tools for the creation of simulations of neutron scattering experiments. In this paper, we briefly introduce McStas and describe a particular application of the program: the Monte Carlo calculation of the resolution function of a standard triple-axis neutron...

  5. FARMA MIEJSKA JAKO NOWY SPOSÓB KSZTAŁTOWANIA KAMERALNYCH PRZESTRZENI MIESZKANIOWYCH. ANALIZA SPOSOBÓW I BARIER WDROŻENIA

    Directory of Open Access Journals (Sweden)

    Justyna KLESZCZ

    Full Text Available Miejskie rolnictwo pojawiło się w Europie jako odpowiedź na potrzebę bliższego kontaktu z naturą wśród mieszkańców miast, nie tylko w sposób bierny, poprzez wykorzystywanie już istniejących zasobów, lecz również w sposób czynny - jako sposób na kreowanie najbliższego środowiska między innymi dzięki własnoręcznej produkcji żywności. Farmy miejskie stanowią w tym przypadku element łączący miasto z jego "produktywną" alternatywą, tworząc możliwość budowy przestrzeni mieszkalnych o nowej jakości. Wraz z rozwojem rolnictwa miejskiego pojawiły się również nowe formy kształtowania niewielkich osiedli mieszkaniowych opartych na zasadach współużytkowania przestrzeni przez wybraną grupę ludzi lub jako atrakcyjny "dodatek" do ekskluzywnych osiedli w ścisłych centrach miast. Tego typu rozwiązania stwarzają szerokie pole do rozwoju nowych form urbanistycznych, łączących w sobie przestrzenie mieszkaniowe i rekreacyjne miast, jako miejsca integracji międzygatunkowej. Przykład holenderskiego miasta Almere ukazuje sposób kształtowania przestrzeni mieszkalnej człowieka na zasadach współistnienia z naturą w skali makro - poprzez tworzenia całych dzielnic - farm, jak w wypadku nowopowstającej Almere Oosterword. Na tym tle sytuacja Polski nie wygląda dobrze. Analiza samych uwarunkowań prawnych wykazała istnienie barier, które praktycznie uniemożliwiają rozwój krajowych farm miejskich na skalę, jaką znamy z realizacji europejskich.

  6. Performance of self-powered neutron detectors in pressurized water reactors

    International Nuclear Information System (INIS)

    Warren, H.D.; Bozarch, D.P.

    1977-01-01

    A typical Babcock and Wilcox pressurized water reactor (PWR) contains 364 rhodium self-powered neutron detectors (SPNDs) and 52 background detectors. The detectors are inserted into the reactor core in 52 dry, multidetector assemblies. Each assembly contains seven SPNDs and one background detector. By mid-1977, eight B and W PWRs, each fitted with SPNDs, were in operation. Many of the SPNDs have operated successfully for more than four years. This paper describes the operational performance of the SPNDs and special tests conducted to improve that performance. Topics included are (1) insulation performance versus neutron dose to the SPND, (2) background signals in the leadwire region of the SPND, and (3) depletion of the SPND emitter versus absorbed neutron dose

  7. The McClean Lake uranium project

    International Nuclear Information System (INIS)

    Blaise, J.R.

    2001-01-01

    The McClean Lake Uranium Project, located in the northern part of Saskatchewan, consists of five uranium deposits, Jeb - Sue A - Sue B - Sue C - McClean, scattered in three different locations on the mineral lease. On 16 March 1995, COGEMA Resources Inc and its partners, Denison Mines Ltd and OURD (Canada) Co Ltd, made the formal decision to develop the McClean Lake Project. Construction of the mine and mill started during summer 1995 and should be finished by mid 1997. Mining of the first deposit, Jeb started in 1996, ore being currently mined. The start of the yellowcake production is scheduled to start this fall. (author)

  8. Analysis of Earthquake Source Spectra in Salton Trough

    Science.gov (United States)

    Chen, X.; Shearer, P. M.

    2009-12-01

    Previous studies of the source spectra of small earthquakes in southern California show that average Brune-type stress drops vary among different regions, with particularly low stress drops observed in the Salton Trough (Shearer et al., 2006). The Salton Trough marks the southern end of the San Andreas Fault and is prone to earthquake swarms, some of which are driven by aseismic creep events (Lohman and McGuire, 2007). In order to learn the stress state and understand the physical mechanisms of swarms and slow slip events, we analyze the source spectra of earthquakes in this region. We obtain Southern California Seismic Network (SCSN) waveforms for earthquakes from 1977 to 2009 archived at the Southern California Earthquake Center (SCEC) data center, which includes over 17,000 events. After resampling the data to a uniform 100 Hz sample rate, we compute spectra for both signal and noise windows for each seismogram, and select traces with a P-wave signal-to-noise ratio greater than 5 between 5 Hz and 15 Hz. Using selected displacement spectra, we isolate the source spectra from station terms and path effects using an empirical Green’s function approach. From the corrected source spectra, we compute corner frequencies and estimate moments and stress drops. Finally we analyze spatial and temporal variations in stress drop in the Salton Trough and compare them with studies of swarms and creep events to assess the evolution of faulting and stress in the region. References: Lohman, R. B., and J. J. McGuire (2007), Earthquake swarms driven by aseismic creep in the Salton Trough, California, J. Geophys. Res., 112, B04405, doi:10.1029/2006JB004596 Shearer, P. M., G. A. Prieto, and E. Hauksson (2006), Comprehensive analysis of earthquake source spectra in southern California, J. Geophys. Res., 111, B06303, doi:10.1029/2005JB003979.

  9. Model of a DNA-protein complex of the architectural monomeric protein MC1 from Euryarchaea.

    Directory of Open Access Journals (Sweden)

    Françoise Paquet

    Full Text Available In Archaea the two major modes of DNA packaging are wrapping by histone proteins or bending by architectural non-histone proteins. To supplement our knowledge about the binding mode of the different DNA-bending proteins observed across the three domains of life, we present here the first model of a complex in which the monomeric Methanogen Chromosomal protein 1 (MC1 from Euryarchaea binds to the concave side of a strongly bent DNA. In laboratory growth conditions MC1 is the most abundant architectural protein present in Methanosarcina thermophila CHTI55. Like most proteins that strongly bend DNA, MC1 is known to bind in the minor groove. Interaction areas for MC1 and DNA were mapped by Nuclear Magnetic Resonance (NMR data. The polarity of protein binding was determined using paramagnetic probes attached to the DNA. The first structural model of the DNA-MC1 complex we propose here was obtained by two complementary docking approaches and is in good agreement with the experimental data previously provided by electron microscopy and biochemistry. Residues essential to DNA-binding and -bending were highlighted and confirmed by site-directed mutagenesis. It was found that the Arg25 side-chain was essential to neutralize the negative charge of two phosphates that come very close in response to a dramatic curvature of the DNA.

  10. Measurement of the w boson mass and $w^{+} w^{-}$ production and decay properties in $e^{+}e^{-}$ collisions at s**(1/2) = 172-GeV

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Beeston, C.; Behnke, T.; Bell, A.N.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bloomer, J.E.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Bouwens, B.T.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davies, R.; De Jong, S.; del Pozo, L.A.; Desch, K.; Dienes, B.; Dixit, M.S.; do Couto e Silva, E.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Edwards, J.E.G.; Estabrooks, P.G.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ingram, M.R.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, G.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Morii, M.; Muller, U.; Mihara, S.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pearce, M.J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rees, D.L.; Rigby, D.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Ros, E.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Rylko, R.; Sachs, K.; Saeki, T.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schenk, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schultz-Coulon, H.C.; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Utzat, P.; Van Kooten, Rick J.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilkens, B.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1998-01-01

    This paper describes the measurement of the W boson mass, M_W, and decay width, Gamma_W, from the direct reconstruction of the invariant mass of its decay products in W pair events collected at a mean centre-of-mass energy of sqrt{s} = 172.12 GeV with the OPAL detector at LEP. Measurements of the W pair production cross-section, the W decay branching fractions and properties of the W decay final states are also described. A total of 120 candidate W^+W^- events has been selected for an integrated luminosity of 10.36 pb^-1. The W^+W^- production cross-section is measured to be sigma_WW = 12.3 +/- 1.3(stat.) +/- 0.3(syst.) pb, consistent with the Standard Model expectation. The W^+W^- -> qq(bar) l nu and W^+W^- -> qq(bar)qq(bar) final states are used to obtain a direct measurement of Gamma_W = 1.30^{+0.62}_{-0.55}(stat.) +/- 0.18(syst.) GeV. Assuming the Standard Model relation between M_W and Gamma_W, the W boson mass is measured to be M_W = 80.32 +/- 0.30(stat.) +/- 0.09(syst.) GeV. The event properties of the...

  11. Verification OFENDF/B-VII.0, ENDF/B-VII.1 and JENDL-4.0 nuclear data libraries for criticality calculations using NEA/NSC benchmarks

    International Nuclear Information System (INIS)

    Bouhaddane, A.; Farkas, G.; Hascik, J.; Slugen, V.

    2015-01-01

    The paper presents verification of selected nuclear data libraries with the aim to apply them to fast reactor calculations. More precise results were achieved for thermal neutrons calculations. This corresponds with the demand for more precise nuclear data for fast reactors. However, fast neutron calculations show some consistency, in particular between ENDF-B/VII.1 and JENDL-4.0 nuclear data libraries. The results support the idea to prefer using newer ENDF-B/VII.1 instead of the previous version ENDF-B/VII.0. Certainly, there are still some issues to be addressed and there is potential to gain more conclusive results. Although, application of ENDF-B/VII.1 and JENDL-4.0 is expected for further calculations. (authors)

  12. The WIMSE-E module W-LED

    International Nuclear Information System (INIS)

    Roth, M.J.

    1992-06-01

    This report describes the WIMS-E edit module W-LED. W-LED sets up a library of cross section and other nuclear data for a set of materials for subsequent use in a whole reactor program such as PANTHER. (author)

  13. 34 CFR 647.1 - What is the Ronald E. McNair Postbaccalaureate Achievement Program?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false What is the Ronald E. McNair Postbaccalaureate... (Continued) OFFICE OF POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION RONALD E. MCNAIR POSTBACCALAUREATE ACHIEVEMENT PROGRAM General § 647.1 What is the Ronald E. McNair Postbaccalaureate Achievement Program? The...

  14. Current Mode Neutron Noise Measurements in the Zero Power Reactor CROCUS

    Science.gov (United States)

    Pakari, O.; Lamirand, V.; Perret, G.; Braun, L.; Frajtag, P.; Pautz, A.

    2018-01-01

    The present article is an overview of developments and results regarding neutron noise measurements in current mode at the CROCUS zero power facility. Neutron noise measurements offer a non-invasive method to determine kinetic reactor parameters such as the prompt decay constant at criticality α = βeff / λ, the effective delayed neutron fraction βeff, and the mean generation time λ for code validation efforts. At higher detection rates, i.e. above 2×104 cps in the used configuration at 0.1 W, the previously employed pulse charge amplification electronics with BF3 detectors yielded erroneous results due to dead time effects. Future experimental needs call for higher sensitivity in detectors, higher detection rates or higher reactor powers, and thus a generally more versatile measurement system. We, therefore, explored detectors operated with current mode acquisition electronics to accommodate the need. We approached the matter in two ways: 1) By using the two compensated 10B-coated ionization chambers available in CROCUS as operational monitors. The compensated current signal of these chambers was extracted from coremonitoring output channels. 2) By developing a new current mode amplification station to be used with other available detectors in core. Characteristics and first noise measurements of the new current system are presented. We implemented post-processing of the current signals from 1)and 2) with the APSD/CPSD method to determine α. At two critical states (0.5 and 1.5 W), using the 10B ionization chambers and their CPSD estimate, the prompt decay constant was measured after 1.5 hours to be α=(156.9 ± 4.3) s-1 (1σ). This result is within 1σ of statistical uncertainties of previous experiments and MCNPv5-1.6 predictions using the ENDF/B-7.1 library. The newsystem connected to a CFUL01 fission chamber using the APSDestimate at 100 mW after 33 min yielded α = (160.8 ± 6.3) s-1, also within 1σ agreement. The improvements to previous neutron noise

  15. Grazing incidence Fe-line telescopes using W/B4C multilayers

    DEFF Research Database (Denmark)

    Joensen, K. D.; Gorenstein, P.; Christensen, Finn Erland

    1995-01-01

    The loss of throughput observed at higher energies for traditional grazing-incidence X-ray telescopes coated with high-Z elements can be partly countered by employing multilayers on the outermost reflectors. Using 8-keV reflectivity data from a periodic W/B4C multilayer, the expected performance...

  16. Significance of the Melanocortin 1 and Endothelin B Receptors in Melanocyte Homeostasis and Prevention of Sun-Induced Genotoxicity

    Directory of Open Access Journals (Sweden)

    Zalfa A. Abdel-Malek

    2016-08-01

    Full Text Available The membrane bound melanocortin 1 receptor (MC1R, and the endothelin B receptor (ENDBR are two G-protein coupled receptors that play important roles in constitutive regulation of melanocytes and their response to ultraviolet radiation (UVR, the main etiological factor for melanoma. The human MC1R is a Gs protein-coupled receptor, which is activated by its agonists α-melanocyte stimulating hormone (α-melanocortin; α-MSH and adrenocorticotropic hormone (ACTH. The ENDBR is a Gq coupled-receptor, which is activated by Endothelin (ET-3 during embryonic development, and ET-1 postnatally. Pigmentation and the DNA repair capacity are two major factors that determine the risk for melanoma. Activation of the MC1R by its agonists stimulates the synthesis of eumelanin, the dark brown photoprotective pigment. In vitro studies showed that α-MSH and ET-1 interact synergistically in the presence of basic fibroblast growth factor (bFGF to stimulate human melanocyte proliferation and melanogenesis, and to inhibit UVR-induced apoptosis. An important function of the MC1R is reduction of oxidative stress and activation of DNA repair pathways. The human MC1R is highly polymorphic, and MC1R variants, particularly those that cause loss of function of the expressed receptor, are associated with increased melanoma risk independently of pigmentation. These variants compromise the DNA repair and antioxidant capacities of human melanocytes. Recently, activation of ENDBR by ET-1 was reported to reduce the induction and enhance the repair of UVR-induced DNA photoproducts. We conclude that α-MSH and ET-1 and their cognate receptors MC1R and ENDBR reduce the risk for melanoma by maintaining genomic stability of melanocytes via modulating the DNA damage response to solar UVR. Elucidating the response of melanocytes to UVR should improve our understanding of the process of melanomagenesis, and lead to effective melanoma chemoprevention, as well as therapeutic strategies.

  17. High temperature tensile properties and their application to toughness enhancement in ultra-fine grained W-(0-1.5)wt% TiC

    Energy Technology Data Exchange (ETDEWEB)

    Kurishita, H. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan)], E-mail: kurishi@imr.tohoku.ac.jp; Matsuo, S.; Arakawa, H.; Narui, M.; Yamazaki, M. [International Research Center for Nuclear Materials Science, Institute for Materials Research (IMR), Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Sakamoto, T.; Kobayashi, S.; Nakai, K. [Department of Materials Science and Biotechnology, Ehime University, Matsuyama, Ehime 790-8577 (Japan); Takida, T.; Takebe, K. [A.L.M.T. Corp., 2 Iwase-koshi-machi, Toyama, Toyama 931-8543 (Japan); Kawai, M. [Institute of Material Structure Science, KEK, Tsukuba, Ibaraki 305-0801 (Japan); Yoshida, N. [Institute for Applied Mechanics, Kyushu University, Kasuga, Fukuoka 816-8580 (Japan)

    2009-04-30

    Ultra-fine grained (UFG) W-TiC consolidates are very promising for use as divertors in fusion reactors, however, the assurance of room-temperature ductility of UFG W-TiC remains unsettled. The assurance requires a sufficient degree of plastic working for the consolidates and thus overcoming of poor plastic workability in UFG W-TiC by applying superplasticity. Therefore, the magnitudes of elongation to fracture and flow stress which are important measures for plastic working were examined for UFG W-(0-1.5)%TiC (in wt%) at 1673-1973 K where superplasticity occurs without appreciable grain growth. It is shown that the elongation and flow stress are strongly dependent on TiC addition and atmosphere (Ar, H{sub 2}) during mechanical alloying (MA). As the TiC addition increases, the elongation significantly increases without appreciable increase in the flow stress level. W-TiC fabricated with MA in H{sub 2} exhibits larger elongation and larger strain rate sensitivity of flow stress than W-TiC with MA in Ar. These results were applied to perform plastic working and the room-temperature bend test results for plastic worked W-1.0%TiC are shown.

  18. High-energy behavior of the double photoionization of helium from 2 to 12 keV

    International Nuclear Information System (INIS)

    Levin, J.C.; Sellin, I.A.; Johnson, B.M.; Lindle, D.W.; Miller, R.D.; Berrah, N.; Azuma, Y.; Berry, H.G.; Lee, D.

    1993-01-01

    We report the ratio of double-to-single photoionization of He at several photon energies from 2 to 12 keV. By time-of-flight methods, we find a ratio consistent with an asymptote at 1.5%±0.2%, essentially reached by hν∼4 keV. Fair agreement is obtained with older shake calculations of Byron and Joachain [Phys. Rev. 164, 1 (1967)], of Aberg [Phys. Rev. A 2, 1726 (1970)], and with recent many-body perturbation theory (MBPT) of Ishihara, Hino, and McGuire [Phys. Rev. A 44, 6980 (1991)]. The result lies below earlier MPBT calculations by Amusia et al. [J. Phys. B 8, 1248 (1975)] (2.3%), and well above semiempirical predictions of Samson [Phys. Rev. Lett. 65, 2861 (1990)], who expects no asymptote and predicts σ(He 2+ )/σ(He + )=0.3% at 12 keV

  19. The Role of MC1R in Speciation & Phylogeny

    Science.gov (United States)

    Offner, Susan

    2013-01-01

    A point mutation in the MC1R gene, a G-protein-coupled receptor, has been found that could have led to the formation of two subspecies of Solomon Island flycatcher from a single ancestral population. I discuss the many roles that G-protein-coupled receptors play in vertebrate physiology and how one particular point mutation can have enormous…

  20. Neogene sea surface temperature reconstructions from the Southern McMurdo Sound and the McMurdo Ice Shelf (ANDRILL Program, Antarctica)

    Science.gov (United States)

    Sangiorgi, Francesca; Willmott, Veronica; Kim, Jung-Hyun; Schouten, Stefan; Brinkhuis, Henk; Sinninghe Damsté, Jaap S.; Florindo, Fabio; Harwood, David; Naish, Tim; Powell, Ross

    2010-05-01

    During the austral summers 2006 and 2007 the ANtarctic DRILLing Program (ANDRILL) drilled two cores, each recovering more than 1000m of sediment from below the McMurdo Ice-Shelf (MIS, AND-1B), and sea-ice in Southern McMurdo Sound (SMS, AND-2A), respectively, revealing new information about Neogene Antarctic cryosphere evolution. Core AND-1B was drilled in a more distal location than core AND-2A. With the aim of obtaining important information for the understanding of the history of Antarctic climate and environment during selected interval of the Neogene, we applied novel organic geochemistry proxies such as TEX86 (Tetra Ether IndeX of lipids with 86 carbon atoms) using a new calibration equation specifically developed for polar areas and based on 116 surface sediment samples collected from polar oceans (Kim et al., subm.), and BIT (Branched and Isoprenoid Tetraether), to derive absolute (sea surface) temperature values and to evaluate the relative contribution of soil organic matter versus marine organic matter, respectively. We will present the state-of-the-art of the methodology applied, discussing its advantages and limitations, and the results so far obtained from the analysis of 60 samples from core AND-2A covering the Miocene Climatic Optimum (and the Mid-late Miocene transition) and of 20 pilot samples from core AND-1B covering the late Pliocene.

  1. OpenMC: A state-of-the-art Monte Carlo code for research and development

    International Nuclear Information System (INIS)

    Romano, Paul K.; Horelik, Nicholas E.; Herman, Bryan R.; Nelson, Adam G.; Forget, Benoit; Smith, Kord

    2015-01-01

    Highlights: • OpenMC is an open source Monte Carlo particle transport code. • Solid geometry and continuous-energy physics allow high-fidelity simulations. • Development has focused on high performance and modern I/O techniques. • OpenMC is capable of scaling up to hundreds of thousands of processors. • Other features include plotting, CMFD acceleration, and variance reduction. - Abstract: This paper gives an overview of OpenMC, an open source Monte Carlo particle transport code recently developed at the Massachusetts Institute of Technology. OpenMC uses continuous-energy cross sections and a constructive solid geometry representation, enabling high-fidelity modeling of nuclear reactors and other systems. Modern, portable input/output file formats are used in OpenMC: XML for input, and HDF5 for output. High performance parallel algorithms in OpenMC have demonstrated near-linear scaling to over 100,000 processors on modern supercomputers. Other topics discussed in this paper include plotting, CMFD acceleration, variance reduction, eigenvalue calculations, and software development processes

  2. Continuous Fiber Wound Ceramic Composite (CFCC) for Commercial Water Reactor Fuel. Technical progress report for period ending April 1, 2000

    International Nuclear Information System (INIS)

    2000-01-01

    Our program began on August 1, 1999. As of April 1, 2000, the progress has been in materials selection and test planning. Three subcontracts are in place (McDermott Technologies Inc. for continuous fiber reinforced ceramic tubing fabrication, Swales Aerospace for LOCA testing of tubes, and Massachusetts Institute of Technology for In Reactor testing of tubes). With regard to materials selection we visited McDermott Technologies Inc. a number of times, including on February 23, 2000 to discuss the Draft Material Selection and Fabrication Report. The changes discussed at this meeting were implemented and the final version of this report is attached (attachment 1). McDermott Technologies Inc. will produce one type of tubing: Alumina oxide (Nextel 610) fiber, a carbon coating (left in place), and alumina-yttria matrix. A potentially desirable CFCC material of silicon carbide fiber with spinel matrix was discussed. That material selection was not adopted primarily due to material availability and cost. Gamma Engineering is exploring the available tube coatings at Northwestern University as a mechanism for reducing the permeability of the tubes, and thus, will use coating as a differentiating factor in the testing of tubing in the LOCA test as well as the In-Reactor Test. The conclusion of the Material Selection and Fabrication Report lists the possible coatings under evaluation. With regard to Test Planning, the MIT and Swales Aerospace have submitted draft Test Plans. MIT is attempting to accommodate an increased number of test specimens by evaluating alternative test configurations. Swales Aerospace held a design review at their facilities on February 24, 2000 and various engineering alternatives and safety issues were addressed. The final Test Plans are not expected until just before testing begins to allow for incorporation of changes during ''dry runs.''

  3. 78 FR 35058 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses and Combined Licenses...

    Science.gov (United States)

    2013-06-11

    ... submitted in a timely fashion based on the availability of the subsequent information. For further details...-cycle 23 refueling outage, currently scheduled for the fall of 2014, and shall be implemented for McGuire 2 within 30 days of the completion of the facility's end-of-cycle 22 refueling outage, currently...

  4. Calcification of MC3T3-E1 cells on titanium and zirconium.

    Science.gov (United States)

    Umezawa, Takayuki; Chen, Peng; Tsutsumi, Yusuke; Doi, Hisashi; Ashida, Maki; Suzuki, Shoichi; Moriyama, Keiji; Hanawa, Takao

    2015-01-01

    To confirm similarity of hard tissue compatibility between titanium and zirconium, calcification of MC3T3-E1 cells on titanium and zirconium was evaluated in this study. Mirror-polished titanium (Ti) and zirconium (Zr) disks and zirconium-sputter deposited titanium (Zr/Ti) were employed in this study. The surface of specimens were characterized using scanning electron microscopy and X-ray diffraction. Then, the cellular proliferation, differentiation and calcification of MC3T3-E1 cells on specimens were investigated. The surface of Zr/Ti was much smoother and cleaner than those of Ti and Zr. The proliferation of the cell was the same among three specimens, while the differentiation and calcification on Zr/Ti were faster than those on Ti and Zr. Therefore, Ti and Zr showed the identical hard tissue compatibility according to the evaluation with MC3T3-E1 cells. Sputter deposition may improve cytocompatibility.

  5. FAST TRACK COMMUNICATION: A Be-W interatomic potential

    Science.gov (United States)

    Björkas, C.; Henriksson, K. O. E.; Probst, M.; Nordlund, K.

    2010-09-01

    In this work, an interatomic potential for the beryllium-tungsten system is derived. It is the final piece of a potential puzzle, now containing all possible interactions between the fusion reactor materials beryllium, tungsten and carbon as well as the plasma hydrogen isotopes. The potential is suitable for plasma-wall interaction simulations and can describe the intermetallic Be2W and Be12W phases. The interaction energy between a Be surface and a W atom, and vice versa, agrees qualitatively with ab initio calculations. The potential can also reasonably describe BexWy molecules with x, y = 1, 2, 3, 4.

  6. Synthesis and superstructure of La sub(2/3) (Mg sub(1/2)W sub(1/2))O/sub 3/

    Energy Technology Data Exchange (ETDEWEB)

    Torii, Y [Government Industrial Research Inst., Nagoya (Japan)

    1979-10-01

    A new perovskite La sub(2/3)(Mg sub(1/2)W sub(1/2))O/sub 3/ having an orthorhombic multiple-cell was synthesized. The lattice constants were a = 7.8157(5) A, b = 7.8344(6) A and c = 2 x 7.9067(6) A. The superstructure was found to be due to a NaCl-type ordering of B ions as well as an ordering of A-site vacancies.

  7. Diamond as a solid state micro-fission chamber for thermal neutron detection at the VR-1 research reactor

    International Nuclear Information System (INIS)

    Pomorski, Michal; Mer-Calfati, Christine; Foulon, Francois; Sklenka, Lubomir; Rataj, Jan; Bily, Tomas

    2015-01-01

    Training Reactor VR-1 is a pool type (light water) reactor based on UO 2 low enriched uranium. It has a nominal power of 1 kW, and can be operated for a short period up to 5 kW. The arrangement of the reactor pool reactor facilitates access to the core, setting and removal of various experimental samples and detectors, and safe and easy handling of fuel assemblies. The reactor is equipped with two horizontal channels (radial and tangential) and 10 vertical channels, of varying diameters, which can be loaded into various core positions, and one pneumatic transfer system. It is also equipped with several specifically designed educational instrumentation systems that can be used to supply complementary measurements and characterization around the reactor. The reactor is operated by the Department of Nuclear Reactors of the Faculty of Nuclear Sciences and Physical Engineering of the Czech Technical University in Prague. The two detectors were placed in-core through one of the vertical insertion channel. They were coupled to remote placed (5 m BNC cable) classical nuclear charge sensitive electronics. Detection properties of both sensors, including: pulse height spectra of U-235 fission fragments (response linearity with neutron flux, count rate, gamma background, were evaluated varying the power of the reactor from 0.005 W to 500 W. The evolution of the counting rate of the thinned optical grade detector as a function of counting rate of a gas ionization chamber used currently for reactor monitoring shows the very good linearity of the detector over the 5 decades. Similar results were obtained with the PIM detector. Additionally fast transient current signals of the detectors were recorded on a digital storage oscilloscope (DSO) using broad-band amplifier and with a simple bias-T, showing potential use of such sensors for neutron counting with no need of an amplification stage, since non-amplified signals from fission fragments exceeded 4 mV in amplitude. Therefore, one can

  8. Effect of Si on the glass-forming ability, thermal stability and magnetic properties of Fe-Co-Zr-Mo-W-B alloys

    Energy Technology Data Exchange (ETDEWEB)

    Wang, W.-M. [Institute for Metallic Materials, IFW Dresden, P.O. 270016, Dresden D-01171 (Germany); Key Lab of Liquid Structure and Heredity of Materials, Shandong University, Jinan 250061 (China); Gebert, A. [Institute for Metallic Materials, IFW Dresden, P.O. 270016, Dresden D-01171 (Germany)], E-mail: a.gebert@ifw-dresden.de; Roth, S.; Kuehn, U.; Schultz, L. [Institute for Metallic Materials, IFW Dresden, P.O. 270016, Dresden D-01171 (Germany)

    2008-07-14

    This paper presents investigations on the effect of Si on the glass-forming ability, thermal stability and magnetic properties of the Fe-Co-Zr-Mo-W-B samples (group I: Fe{sub 60}Co{sub 8}Zr{sub 10}Mo{sub 5}W{sub 2}B{sub 15-x}Si{sub x}, 1 {<=} x {<=} 4; group II: Fe{sub 60}Co{sub 8}Zr{sub 10-x}Mo{sub 5}W{sub 2}B{sub 15}Si{sub x}, 0 {<=} x {<=} 4; group III: Fe{sub 60}Co{sub 8}Zr{sub 8}Mo{sub 5}W{sub 2}B{sub 17-x}Si{sub x}, 0 {<=} x {<=} 2) prepared by melt spinning, injection casting, and centrifugal casting methods. It is found that the glass-forming ability (GFA) of the alloys in group I is more deteriorated than that in group II, and that the alloys in group III can be cast into the rods of 1-3 mm diameter without crystalline reflections in their XRD patterns. For the amorphous ribbons and rods, a non-monotonic change of the nearest neighbour distance r{sub 1} with increasing Si content c{sub Si} was detected, which is parallel to that of the glass transition and crystallization temperatures T{sub g} and T{sub x}, but opposite to that of the magnetization at room temperature M{sub RT} and the Curie temperature T{sub c}. This correlation can be interpreted by a structure model presuming that iron atoms appear simultaneously in two types of local structures in the amorphous samples.

  9. Present status of research reactor decommissioning programme in Indonesia

    International Nuclear Information System (INIS)

    Suripto, A.; Mulyanto, N.

    2002-01-01

    At present Indonesia has 3 research reactors, namely the 30 MW MTR-type multipurpose reactor at Serpong Site, two TRIGA-type research reactors, the first one being 1 MW located at Bandung Site and the second one a small reactor of 100 kW at Yogyakarta Site. The TRIGA Reactor at the Bandung Site reached its first criticality at 250 kW in 1964, and then was operated at 1000 kW since 1971. In October 2000 the reactor power was successfully upgraded to 2 MW. This reactor has already been operated for 38 years. There is not yet any decision for the decommissioning of this reactor. However it will surely be an object for the near future decommissioning programme and hence anticipation for the above situation becomes necessary. The regulation on decommissioning of research reactor is already issued by the independent regulatory body (BAPETEN) according to which the decommissioning permit has to be applied by the BATAN. For Indonesia, an early decommissioning strategy for research reactor dictates a restricted re-use of the site for other nuclear installation. This is based on high land price, limited availability of radwaste repository site, and other cost analysis. Spent graphite reflector from the Bandung TRIGA reactor is recommended for a direct disposal after conditioning, without any volume reduction treatment. Development of human resources, technological capability as well as information flow from and exchange with advanced countries are important factors for the future development of research reactor decommissioning programme in Indonesia. (author)

  10. Astronauts McNair and Stewart prepare for reentry

    Science.gov (United States)

    1984-01-01

    Astronauts Ronald E. McNair and Robert L. Stewart prepare for the re-entry phase of the shuttle Challenger near the end of the 41-B mission. The are stationed behind the crew commander and pilot. Stewart is already wearing his helmet. McNair is stowing some of his gear.

  11. Development of a technology for the preparation of 188W-188Re generators

    International Nuclear Information System (INIS)

    Oliveira, Alexandre de

    2004-01-01

    A big interest has recently arisen concerning the use of Rhenium-188 (188Re) for various medical applications. Tumor therapy with antibodies labeled with 188Re is the main application, but it is being studied its application in carcinomas of medullar thyroid, bone pain palliation and radionuclide synovectomy, among others. Rhenium-188 decays 79% to the ground state of stable 188Os (Eβ1max - 2,11 MeV) and 20% to the first excited state (Eβ2max = 1,97 MeV). The deexcitation of this state gives a 155 keV gamma ray (15r%) which can be detected by imaging. Another great advantage is the viability of carrier-free 188Re from the decay of 188W (t 1/2 = 69.4 days) in a generator system. The objective of this work is the development of the technology for the preparation of 188W- 188Re generators. To accomplish this, the steps of the work are: preparation of the targets of W; irradiation of W targets in order to measure the activation and radionuclidic impurities; development of 188W-188Re generators; development of a method for the quality control of 188Re: chemical, radiochemical and radionuclidic purities. The study of alumina-based generators was performed with the irradiation of targets of natural metallic W and W03 and showed that this kind of generator will only be viable with the importation of 188W, due to the low neutron flux of the Reactor IEA-R1 Reactor for the commercial routine production of this radioisotope, but the technology of production and quality control were successful. The gel type chromatographic generators of WZr were produced with natural WO3 targets and showed that, if enriched targets are to be used and with the power upgrade of the IEA-R1 Reactor, they can be produced by the Radiopharmacy Center at IPEN-SP. The quality control methodology were determined and the results were inside the limits given by the Pharmacopoeia. (author)

  12. A comparison of the electrochemical recovery of palladium using a parallel flat plate flow-by reactor and a rotating cylinder electrode reactor

    International Nuclear Information System (INIS)

    Terrazas-Rodriguez, J.E.; Gutierrez-Granados, S.; Alatorre-Ordaz, M.A.; Ponce de Leon, C.; Walsh, F.C.

    2011-01-01

    The production of catalytic converters generates large amounts of waste water containing Pd 2+ , Rh 3+ and Nd 3+ ions. The electrochemical treatment of these solutions offers an economic and effective alternative to recover the precious metals in comparison with other traditional metal recovery technologies. The separation of palladium from this mixture of metal ions by catalytic deposition was carried out using a rotating cylinder electrode reactor (RCER) and a parallel plate reactor (FM01-LC) with the same cathode area (64 cm 2 ) and electrolyte volume (300 cm 3 ). The study was carried out at mean linear flow velocities of 1.27 -1 (120 e /v -1 (7390 2+ ions in the parallel plate electrode reactor was 35% while the recovery of 97% of Pd 2+ in the RCER was 62%. The volumetric energy consumption during the electrolysis was 0.56 kW h m -3 and 2.1 kW h m -3 for the RCER and the FM01-LC reactors, respectively. Using a three-dimensional stainless steel electrode in the FM01-LC laboratory reactor, 99% of palladium ions were recovered after 30 min of electrolysis while in the RCER, 120 min were necessary.

  13. Badania epidemiologiczne jako podstawa informacyjna rozpoznania chorób alergicznych układu oddechowego i skóry u dzieci w wieku 6–7 i 13–14 lat w rejonie grodzieńskim

    Directory of Open Access Journals (Sweden)

    Andrei Shpakou

    2015-03-01

    Full Text Available Wstęp: Duże rozpowszechnienie, skutki medyczne i społeczne, wpływ na jakość życia oraz znaczący koszt chorób alergicznych uzasadniają liczne działania na rzecz ich profilaktyki. Nie ma wątpliwości, iż oficjalne statystyki mogą nie odpowiadać rzeczywistej częstotliwości występowania chorób alergicznych. Cel pracy: Celem pracy jest ocena częstotliwości występowania astmy i chorób alergicznych, głównych objawów alergicznych i oddechowych wśród miejskich i wiejskich dzieci w wieku 6–7 i 13–14 lat (w grupach wiekowych według badań ISAAC w rejonie Grodna. Materiał i metody: W badaniu kwestionariuszowym (na podstawie ankiety ISAAC wzięło udział 2187 rodziców dzieci w wieku 6–7 i 13–14 lat z Grodna i  jego okolic (1091 dzieci z miasta i 1096 ze wsi. Wśród nich 955 dzieci było w wieku 6–7 lat, a 1232 w wieku 13–14 lat. Wiedząc o tym, że astmę oskrzelową można podejrzewać u osób, które odczuwają duszności z towarzyszącymi świstami, uciskiem w klatce piersiowej lub kaszlem i chorobami alergicznymi (alergiczny nieżyt nosa i atopowe zapalenie skóry, przeanalizowano częstotliwość występowania tych objawów i chorób wśród dzieci. Wyniki: Wykazano niską częstotliwość występowania astmy wśród dzieci w  standaryzowanych grupach wiekowych. Rodzice 30 dzieci (1,37% badanych potwierdzają istnienie choroby u dzieci na podstawie jej zdiagnozowania przez lekarza. Wskaźnik występowania astmy wyniósł wśród dzieci miejskich 1,74% (19 osób, a wiejskich – 1,0% (11 dzieci. Po głębszej analizie odpowiedzi ustalono, że 60 dzieci (2,74% miało w ciągu ostatnich 12 miesięcy świsty w klatce piersiowej i napady kaszlu. Częstotliwość występowania alergicznego nieżytu nosa i atopowego zapalenia skóry wynosiła około 4% i 10%. Choroby te częściej spotykano u dzieci chorych na astmę. Wnioski: Ponieważ rozpoznawalność astmy u dzieci na

  14. Delayed photoneutrons of the of the Dalat Nuclear Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Huy, Ngo Quang [Centre for Nuclear Technique Application, Ho Chi Minh City (Viet Nam); Thong, Ha Van; Long, Vu Hai; Khang, Ngo Phu; Dien, Nguyen Nhi; Lam, Pham Van; Phuong, Huynh Dong; Vien, Luong Ba; Vinh, Le Vinh [Nuclear Research Inst., Da Lat (Viet Nam)

    1994-10-01

    Time spectrum of delayed neutrons of the Dalat nuclear research reactor is measured and analyzed. It corresponds to a shut-down neutron fluxes of about 10{sup 5}/10{sup 8} n/cm{sup 2}/sec after 100 hours continuous reactor operation at steady power level of 500 kW. Data processing of experimental time neutron spectrum gives 16 exponents, of which 10, resulting from photoneutrons due to ({gamma},n) reactions on beryllium used inside the reactor core, are obtained by using successive exponential stripping fitting method. For the Dalat reactor, the effective delayed photoneutron fraction relative to the total effective delayed neutron fraction is {beta}{sup B}e{sub eff}=0.49%{beta}{sub eff} for a beryllium weight relative to U{sup 235} fuel of m{sub B}e/m{sub U} = 8.5. This result is acceptable in comparison to those obtained for other Be-U{sup 235} media. (author). 5 refs., 2 figs., 4 tabs.

  15. Brayton rotating units for space reactor power systems

    Energy Technology Data Exchange (ETDEWEB)

    Gallo, Bruno M.; El-Genk, Mohamed S. [Institute for Space and Nuclear Power Studies and Chemical and Nuclear Engineering Dept., The Univ. of New Mexico, Albuquerque, NM 87131 (United States)

    2009-09-15

    Designs and analyses models of centrifugal-flow compressor and radial-inflow turbine of 40.8kW{sub e} Brayton Rotating Units (BRUs) are developed for 15 and 40 g/mole He-Xe working fluids. Also presented are the performance results of a space power system with segmented, gas cooled fission reactor heat source and three Closed Brayton Cycle loops, each with a separate BRU. The calculated performance parameters of the BRUs and the reactor power system are for shaft rotational speed of 30-55 krpm, reactor thermal power of 120-471kW{sub th}, and turbine inlet temperature of 900-1149 K. With 40 g/mole He-Xe, a power system peak thermal efficiency of 26% is achieved at rotation speed of 45 krpm, compressor and turbine inlet temperatures of 400 and 1149 K and 0.93 MPa at exit of the compressor. The corresponding system electric power is 122.4kW{sub e}, working fluid flow rate is 1.85 kg/s and the pressure ratio and polytropic efficiency are 1.5% and 86.3% for the compressor and 1.42% and 94.1% for the turbine. For the same nominal electrical power of 122.4kW{sub e}, decreasing the molecular weight of the working fluid (15 g/mole) decreases its flow rate to 1.03 kg/s and increases the system pressure to 1.2 MPa. (author)

  16. Low-temperature thermionics in space nuclear power systems with the safe-type fast reactor

    International Nuclear Information System (INIS)

    Zrodnikov, A.V.; Yarygin, V.I.; Lazarenko, G.E.; Zabudko, A.N.; Ovcharenko, M.K.; Pyshko, A.P.; Mironov, V.S.; Kuznetsov, R.V.

    2007-01-01

    The potentialities of the use of the low-temperature thermionic converters (TIC) with the emitter temperature ≤ 1500 K in the space nuclear power system (SNPS) with the SAFE-type (Safe Affordable Fission Engine) fast reactor proposed and developed by common efforts of American experts have been considered. The main directions of the 'SAFE-300-TEG' SNPS (300 kW(thermal)) design update by replacing the thermoelectric converters with the low-temperature high-performance thermionic converters (with the barrier index V B1.9 eV and efficiency ≥ 10%) meant for a long-term operation (5 years at least) as the components of the SAFE-300-TIC SNPS for a Lunar base have been discussed. The concept of the SNPS with the SAFE-type fast reactor and low-temperature TICs with specific electric power of about 1.45 W/cm 2 as the components of the SAFE-300-TIC system meeting the Nasa's initial requirements to a Lunar base with the electric power demand of about 30 kW(electrical) for robotic mission has been considered. The results, involving optimization and mass-and-size estimation, show that the SAFE-300-TIC system meets the initial requirements by Nasa to the lunar base power supply. The main directions of the system update aimed at the output electric power increase up to 100 kW(electrical) have also been presented. (authors)

  17. Firmy rodzinne w Polsce w dobie globalizacji

    OpenAIRE

    Zalewska, Agnieszka

    2016-01-01

    Celem publikacji jest ukazanie dorobku naukowego, głównie polskich i ukraińskich uczonych, w zakresie uwarunkowań procesów i rezultatów internacjonalizacji przedsiębiorstw oraz jej wpływu na funkcjonowanie biznesu w dobie globalizacji. Opracowanie stanowi istotny wkład w zakresie teorii i praktyki w proces restrukturyzacji przedsiębiorstw w kierunku ich internacjonalizacji. Może posłużyć jako inspiracja do stworzenia strategii opartej na poszukiwaniach (prospector strategy), co będzie sprzyja...

  18. Signal to background interference in p p →t H-→t W-b b ¯ at the LHC Run II

    Science.gov (United States)

    Arhrib, Abdesslam; Benbrik, Rachid; Moretti, Stefano; Santos, Rui; Sharma, Pankaj

    2018-04-01

    We investigate in the Large Hadron Collider (LHC) environment the possibility that sizeable interference effects between a heavy charged Higgs boson signal produced via b g →t H- (+c .c . ) scattering and decaying via H-→W-A →W-b b ¯ (+c .c . ) and the irreducible background given by b g →t W-b b ¯ topologies could spoil current search approaches where the former and latter channels are treated separately. The rationale for this comes from the fact that a heavy charged Higgs state can have a large width, which can also happen for the C P -odd neutral Higgs state emerging in the ensuing decays, which in turn enables such interferences. We conclude that effects are very significant, both at the inclusive and exclusive level (i.e., both before and after H± selection cuts are enforced, respectively) and typically of a destructive nature. This, therefore, implies that currently established LHC reaches for heavy charged Higgs bosons require some level of rescaling. However, this is possible a posteriori, as the aforementioned H± selection cuts shape the interference contributions at the differential level in a way similar to that of the isolated H± signal, so there is no need to reassess the efficiency of the individual cuts. We show such effects quantitatively by borrowing benchmark points from different Yukawa types of a 2-Higgs doublet model parameter space for H± values starting from around 200 GeV.

  19. Training courses at VR-1 reactor

    International Nuclear Information System (INIS)

    Sklenka, L.; Kropik, M.

    2006-01-01

    This paper describes one of the main purposes of the VR-1 training reactor utilization - i.e. extensive educational program. The educational program is intended for the training of university students and selected nuclear power plant personnel. The training courses provide them experience in reactor and neutron physics, dosimetry, nuclear safety and operation of nuclear facilities. At present, the training course participants can go through more than 20 standard experimental exercises; particular exercises for special training can be prepared. Approximately 200 university students become familiar with the reactor (lectures, experiments, experimental and diploma works, etc.) every year. About 12 different faculties from Czech universities use the reactor. International co-operation with European universities in Germany, Hungary, Austria, Slovakia, Holland and UK is frequent. The VR-1 reactor takes also part in Eugene Wigner Course on Reactor Physics Experiments in the framework of European Nuclear Educational Network (ENEN) association. Recently, training courses for Bulgarian research reactor specialists supported by IAEA were carried out. An attractive program including demonstration of reactor operation is prepared also for high school students. Every year, more than 1500 high school students come to visit the reactor, as do many foreigner visitors. (author)

  20. Project W-314 specific test and evaluation plan 241-AN-B valve pit

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-B Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

  1. Measurement of the production cross section of a W boson in association with two b jets in pp collisions at √(s) = 8 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Khachatryan, V.; Sirunyan, A.M.; Tumasyan, A. [Yerevan Physics Institute, Yerevan (Armenia); Collaboration: CMS Collaboration; and others

    2017-02-15

    The production cross section of a W boson in association with two b jets is measured using a sample of proton-proton collisions at √(s) = 8 collected by the CMS experiment at the CERN LHC. The data sample corresponds to an integrated luminosity of 19.8 fb{sup -1}. The W bosons are reconstructed via their leptonic decays, W → lν, where l = μ or e. The fiducial region studied contains exactly one lepton with transverse momentum p{sub T}{sup l} > 30 GeV and pseudorapidity vertical stroke η{sup l} vertical stroke < 2.1, with exactly two b jets with p{sub T} > 25 GeV and vertical stroke η vertical stroke < 2.4 and no other jets with p{sub T} > 25 GeV and vertical stroke η vertical stroke < 4.7. The cross section is measured to be σ(pp → W(lν)+b anti b) = 0.64 ± 0.03(stat)±0.10(syst)±0.06(theo)±0.02(lumi)pb, in agreement with standard model predictions. (orig.)

  2. MC1R studies in dogs with melanistic mask or brindle patterns.

    Science.gov (United States)

    Schmutz, S M; Berryere, T G; Ellinwood, N M; Kerns, J A; Barsh, G S

    2003-01-01

    Black mask is a characteristic pattern in which red, yellow, tan, fawn, or brindle dogs exhibit a melanistic muzzle which may extend up onto the ears. Melanistic mask is inherited in several breeds as an autosomal dominant trait, and appears to be a fixed trait in a few breeds of dogs. A MC1R nonsense mutation, R306ter, has been shown to cause a completely red or yellow coat color in certain breeds such as Irish setters, yellow Labrador retrievers, and golden retrievers. The amino acid sequence for the melanocortin receptor 1 gene (MC1R) was examined in 17 dogs with melanistic masks from seven breeds, 19 dogs without melanistic masks, and 7 dogs in which their coat color made the mask difficult to distinguish. We also examined nine brindle dogs of four breeds, including three dogs who also had a black mask. No consistent amino acid change was observed in the brindle dogs. All dogs with a melanistic mask had at least one copy of a valine substitution for methionine at amino acid 264 (M264V) and none were homozygous for the premature stop codon (R306ter). These results suggest that black mask, but not brindle, is caused by a specific MC1R allele.

  3. Environmental Impact Statement for BOMARC Missile Site, McGuire AFB, New Jersey. Volume 1, Sections 1 through 8

    Science.gov (United States)

    1992-05-22

    OF C Hunted, Trapped Loizg taile weasel Mustela freenata OF, OF C Trapped Mivk Mustela vison OF, OF C Trapped striped skunk Mephitis mephitis OF, OF C... respiratory protective equipment and safety garments (including disposable coveralls and booties) to be utilized by site personnel, identify requirements of a

  4. ECCS analysis of B and W's 177-FA lowered-loop NSS

    International Nuclear Information System (INIS)

    Jones, R.C.; Biller, J.R.; Dunn, B.M.

    1975-06-01

    The effectiveness for the ECCS for B and W's 177-FA Lowered-Loop NSS is shown to meet the five criteria of 10 CFR 50.46. A spectrum analysis is performed and the worst case is used to establish allowable linear heat rates as a function of elevation in the core. (U.S.)

  5. Recent developments in the ROCS/MC code for retrieving local power information in coarse-mesh reactor analysis

    International Nuclear Information System (INIS)

    Grill, S.F.; Jonsson, A.; Crump, M.W.

    1983-01-01

    The inclusion of 3-D effects in PWR analysis is necessary for accurate predictions of reactivity, power distributions, and reactivity coefficients. The ROCS/MC code system has been developed by Combustion Engineering to provide 3-D coarse mesh analysis (ROCS) with the capability to retrieve local information on flux, power and burnup (MC). A review of the finite difference representation of the MC diffusion equation, along with recent improvements to the ROCS/MC system are presented. These improvements include the implementation if fine mesh radial boundary conditions and internal calculation of coarse mesh boundary conditions, generalization of the imbedded calculation to account for the local neighboring environment, and the automation of ROCS/MC links to C-E's code system for in-core power distribution monitoring and core-follow analysis. The results of the ROCS/MC verification program are described and show good agreement with C-E's ROCS/PDQ based methodologies

  6. Current status of the Thai Research Reactor (TRR-1/M1)

    International Nuclear Information System (INIS)

    Chueinta, Siripone; Julanan, Mongkol; Charncanchee, Decharchai

    2006-01-01

    The first Thai Research Reactor, TRR-1 went critical on 27 October 1962 at the maximum power of 1 MW. It was located at Office of Atoms for Peace (OAP) in Bangkok. Since then, TRR-1 was continuously operated and eventually shut down in 1975. Plate type, high-enriched uranium (HEU) and U 3 O 8 A1 cladding were used as the reactor fuel. Light water was used as moderator and coolant as well. In 1975, because of the problem from fuel supplier and also to supporting the Treaty of Non Proliferation of Nuclear Weapon or NPT, TRR-1 was shut down for modification. The reactor core and control system were disassembled and replaced by TRIGA Mark III. A new core was a hexagonal core shape designed by General Atomics (GA). Afterwards, TRR-1 was officially renamed to the Thai Research Reactor-1/Modification 1 (TRR-1/M1). TRR-1/M1 is a multipurpose swimming pool type reactor with nominal power of 2 MW. The TRR-1/M1 uses uranium enriched at 20% in U-235 (LEU) and ZrH alloy as fuel. Light water is also used as coolant and moderator. At present, the reactor is operating with core No.14. The reactor has been serving for various kinds of utilization namely, radioisotope production, neutron activation analysis, beam experiments and reactor physics experiments. (author)

  7. J-R Fracture Resistance of SA533 Gr.B-Cl.1 Steel for Reactor Pressure Vessel

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Ji-Hyun; Hong, Seokmin; Lee, Bong-Sang [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    A rolled plate might show different mechanical behaviors from a forging, even though they contain same chemical compositions. Furthermore, it is known that the fracture behavior of a rolled plate is very sensitive to material orientation comparing to a forging. In this study, the J-R fracture resistances of SA533 Gr.B-Cl.1 plate were measured at reactor operating temperature and the material orientation sensitivity was discussed. The decrease of fracture resistance of this kind of low alloy steel at an elevated temperature is known as the effect of dynamic strain aging (DSA). It was attributed to that the carbides and grains elongated to primary rolling direction, so that the aspect ratio of carbides and grains in the specimen with T-L orientation is larger. Generally, the hard second phase could take a roll of trigger point of unstable fracture. It is needed that the fracture surfaces of the tested specimens to be examined profoundly.

  8. Solvent extraction of W(VI) and Hg(II) with malachite green and rhodamine-B respectively into organic solvents

    International Nuclear Information System (INIS)

    Patil, V.B.; David, M.M.; Turel, Z.R.

    1992-01-01

    Aqueous malachite green and alcoholic rhodamine-B have been used for the extraction of tungsten( W(VI)) and mercury( Hg(II)) respectively into nitrobenzene. This paper deals with developing a rapid method and selective method for the extraction of tungsten(W(VI)) and mercury (Hg(II)) using malachite green and rhodamine-B respectively. 185 W and 203 Hg were used as tracers for studying the extraction process.(author). 2 refs., 2 tab

  9. Extraction of the width of the $W$ boson from a measurement of the ratio of the $W$ and $Z$ cross-sections

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Gervasio [Univ. of Maryland, College Park, MD (United States)

    1999-01-01

    This dissertation reports on measurements of inclusive cross sections times branching fractions into electrons for W and Z bosons produced in pp collisions at ps = 1.8 TeV. From an integrated luminosity of 84.5 pb-1 recorded in 1994-1995 by the D0 detector at the Fermilab Tevatron, the cross sections are measured to be (p$\\bar{p}$ → W +X) ∙ B(W → e )= 2310 ± 10 (stat) ± 50 (syst) ± 100 (lum) pb and (p$\\bar{p}$ → Z +X) ∙ B(Z → ee)= 221 ± 3 (stat) ± 4 (syst) ± 10 (lum) pb. The cross section ratio R is determined to be (p$\\bar{p}$ → W+X) B(W → e )= (p$\\bar{p}$ → Z + X) ∙ B(Z → ee) = 10.43 ± 0.15 (stat) 0.20 (syst) ± 0.10 (NLO), and R is used to determine B(W → ev ) = 0.1044 ± 0.0015 (stat) ± 0.0020 (syst) 0.0017 (theory) ± 0.0010 (NLO), and W = 2.169 ± 0.031 (stat) ± 0.042 (syst) 0.041 (theory) ± 0.022 (NLO) GeV. The latter is used to set a 95% confidence level upper limit on the partial decay width of the W boson into non-standard model final states, $inv\\atop{W}$ , of 0.213 GeV.

  10. The performance of ENDF/B-V.2 nuclear data for fast reactor calculations

    International Nuclear Information System (INIS)

    Atkinson, C.A.; Collins, P.J.

    1987-01-01

    Calculations with ENDF/B-V.2 data have been made for twenty-five fast-spectrum integral assemblies covering a wide range of sizes and compositions. Analysis was done by transport codes with refined cross section processing methods and detailed reactor modelling. The predictions of fission rate distributions and control rod worths were emphasized for the more prototypic benchmark cores. The results show considerable improvements in agreement with experiment compared with analysis using ENDF/B-IV data, but it is apparent that significant errors remain for fast reactor design calculations

  11. Assessment of MC1R and α-MSH gene sequences in Iranian vitiligo patients

    Directory of Open Access Journals (Sweden)

    Eskandani M

    2010-01-01

    Full Text Available Background: Vitiligo is an acquired pigmentary disorder of the skin that is caused by unknown factors and is characterized by white and depigmented patches that enlarge and become more numerous with time. Genetic factors, oxidative stress, autoimmunity, and neurochemical agents, such as catecholamines might also contribute to vitiligo. Cutaneous pigmentation is determined by the amounts of eumelanin and pheomelanin synthesized by the epidermal melanocytes and interference of melanocortin-1 receptor (MC1R, a G-protein coupled receptor, its normal agonist, alpha-melanocyte stimulating hormone (α-MSH, and key enzymes, such as tyrosinase, to protect against sun-induced DNA damage. The MC1R, a 7 pass trans-membrane G-protein coupled receptor, is a key control point in melanogenesis. Loss-of-function mutations at the MC1R are associated with a switch from eumelanin to pheomelanin production, resulting in a red or yellow coat color. Aim: In this research, we aim to examine the genetic variety of MC1R and α-MSH gene in 20 Iranian vitiligo patients and 20 healthy controls. Materials and Methods: Analysis of the MC1R coding gene was performed with direct sequencing. Results: We found the following 9 MC1R coding region variants: Arg163Gl (G488A, Arg227Leu (G680A, Val 97Phe (G289T, Asp184Asn (G550A, Arg227Lys (G680A, Arg142His (G425A, Val60Leu (G178T, Val247Met (C739A, and Val174Ile (G520A. We also found 2 frameshift changes: one of them was the Insertion of C (frameshift in Pro136, stop at Trp148 and the other, Insertion of G (frameshift in Pro256, stop at Trp 333. Of all the changes, the most common was Val60Leu at 5% in patients vs 20% in controls, Val247Met at 15% in patients vs 0% in controls and Val174Ile at 15% in controls and 0% in patients. The other variants showed a frequency <5% in both patients and controls. Also in this study, we have examined the frequency of single nucleotide polymorphisms within the α-MSH genes with direct sequencing in

  12. Annual report on JEN-1 reactor; Informe periodico del Reactor JEN-1 correspondiente al ano 1971

    Energy Technology Data Exchange (ETDEWEB)

    Montes, J

    1972-07-01

    In the annual report on the JEN-1 reactor the main features of the reactor operations and maintenance are described. The reactor has been critical for 1831 hours, what means 65,8% of the total working time. Maintenance and pool water contamination have occupied the rest of the time. The maintenance schedule is shown in detail according to three subjects. The main failures and reactor scrams are also described. The daily maximum values of the water activity are given so as the activity of the air in the reactor hall. (Author)

  13. Correlation of microstructure and low cycle fatigue properties for 13.5Cr1.1W0.3Ti ODS steel

    International Nuclear Information System (INIS)

    He, P.; Klimenkov, M.; Möslang, A.; Lindau, R.; Seifert, H.J.

    2014-01-01

    Reduced activation oxide dispersion strengthened (ODS) steels are prospective structural materials for the blanket system and first wall components in Tokamak-type fusion reactors. Under the pulsed operation, these components will be predominantly subjected to cyclic thermal–mechanical loading which leads to inevitable fatigue damage. In this work, strain controlled isothermal fatigue tests were conducted for 13.5Cr1.1W0.3Ti ODS steel at 550 °C. The total strain range varied from 0.54% to 0.9%. After thermomechanical processing, 13.5CrWTi–ODS steel exhibits a remarkable lifetime extension with a factor of 10–20 for strain ranges Δε ⩽ 0.7%. 13.5Cr ODS steel shows no cyclic softening at all during the whole testing process irrespective of the strain range. TEM observations reveal ultrastable grain structure and constant dislocation densities around 10 14 m −2 , independent of the number of cycles or the applied strain amplitude. The presence of the stabilized ultrafine Y–Ti–O dispersoids enhances the microstructural stability and therefore leads to outstanding fatigue resistance for 13.5Cr1.1W0.3Ti–ODS steel

  14. Correlation of microstructure and low cycle fatigue properties for 13.5Cr1.1W0.3Ti ODS steel

    Energy Technology Data Exchange (ETDEWEB)

    He, P., E-mail: pei.he@kit.edu; Klimenkov, M.; Möslang, A.; Lindau, R.; Seifert, H.J.

    2014-12-15

    Reduced activation oxide dispersion strengthened (ODS) steels are prospective structural materials for the blanket system and first wall components in Tokamak-type fusion reactors. Under the pulsed operation, these components will be predominantly subjected to cyclic thermal–mechanical loading which leads to inevitable fatigue damage. In this work, strain controlled isothermal fatigue tests were conducted for 13.5Cr1.1W0.3Ti ODS steel at 550 °C. The total strain range varied from 0.54% to 0.9%. After thermomechanical processing, 13.5CrWTi–ODS steel exhibits a remarkable lifetime extension with a factor of 10–20 for strain ranges Δε ⩽ 0.7%. 13.5Cr ODS steel shows no cyclic softening at all during the whole testing process irrespective of the strain range. TEM observations reveal ultrastable grain structure and constant dislocation densities around 10{sup 14} m{sup −2}, independent of the number of cycles or the applied strain amplitude. The presence of the stabilized ultrafine Y–Ti–O dispersoids enhances the microstructural stability and therefore leads to outstanding fatigue resistance for 13.5Cr1.1W0.3Ti–ODS steel.

  15. Welding of the A1 reactor pressure vessel

    International Nuclear Information System (INIS)

    Becka, J.

    1975-01-01

    As concerns welding, the A-1 reactor pressure vessel represents a geometrically complex unit containing 1492 welded joints. The length of welded sections varies between 10 and 620 mm. At an operating temperature of 120 degC and a pressure of 650 N/cm 2 the welded joints in the reactor core are exposed to an integral dose of 3x10 18 n/cm 2 . The chemical composition is shown for pressure vessel steel as specified by CSN 413090.9 modified by Ni, Ti and Al additions, and for the welding electrodes used. The requirements are also shown for the mechanical properties of the base and the weld metals. The technique and conditions of welding are described. No defects were found in ultrasonic testing of welded joints. (J.B.)

  16. Rytuksymab – miejsce w leczeniu reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Małgorzata Tłustochowicz

    2011-02-01

    Full Text Available Rytuksymab jest przeciwciałem powodującym niszczenie limfocytówB zaangażowanych w proces zapalny w chorobach autoimmunologicznych.W reumatoidalnym zapaleniu stawów jest zalecanyu chorych, u których utrzymuje się aktywny proces zapalny, mimoleczenia klasycznymi lekami modyfikującymi przebieg chorobyi lekami anty-TNF-α. U tych chorych jest lekiem bardzo skutecznym,skuteczniejszym niż inny lek z grupy anty-TNF-α. Rytuksymabmoże być stosowany przez wiele lat, a jego skuteczność utrzymujesię na tym samym poziomie. Najczęstsze zdarzenia niepożądanewystępują w czasie wlewu leku, są one głównie związane z uwalnianiemcytokin z limfocytów B. Częstość i natężenie tych reakcjiznacznie się zmniejsza po premedykacji glikokortykosteroidami,a także przy kolejnych podaniach leku. Innymi powikłaniami sąinfekcje, ale ich liczba nie jest większa niż w populacji chorych nareumatoidalne zapalenie stawów. W artykule przedstawiono praktyczneaspekty kwalifikacji chorego do leczenia rytuksymabemoraz sposób przygotowania i podawania wlewu.

  17. Status of Dalat research reactor and progress of new reactor plan in Vietnam

    International Nuclear Information System (INIS)

    Dien, Nguyen Nhi; Vien, Luong Ba

    2005-01-01

    The Dalat Nuclear Research Reactor (DNRR) is a 500-kW pool-type reactor loaded with the Soviet WWR-M2 Fuel Assemblies (FA), moderated and cooled by light water. The reactor was reconstructed from the USA 250-kW TRIGA Mark-II reactor built in early 1960s. The first criticality of the renovated reactor was achieved on 1 st November 1983, and then on 20 March 1984 the reactor was officially inaugurated and its activities restarted. During the last twenty years, the DNRR has played an important role as a large national research facility to implement researches and applications, and its utilization has been broadened in various fields of human life. However, due to the limitation of the neutron flux and power level, the out-of date design of the experimental facilities and the ageing of the reactor facilities, it cannot meet the increasing user's demands even in the existing utilization areas. In addition, the utilization demands of the Research Reactor (RR) will be increased along with the development of the nation's economy growth. In this aspect, it is necessary to have in Vietnam a new high performance multipurpose RR with a sufficient neutron flux and power level. According to the last draft of a national strategy for atomic energy development submitted to the Government for consideration and approval, it is expected that a new high power RR would be put into operation before 2020. The operation and utilization status of the DNRR is presented and some preliminary results of the national research project on new reactor plan for Vietnam are discussed in this paper

  18. The History of Disability Services in Higher Education

    Science.gov (United States)

    Madaus, Joseph W.

    2011-01-01

    In 2002, Brinckerhoff, McGuire, and Shaw observed that the field of postsecondary education and disability services had "moved through its adolescence and was embarking on adulthood" (xiii). Indeed, the field had undergone rapid expansion nationwide in the prior 30 years and grew into a full-fledged profession within higher education (Jarrow…

  19. Creativity, Culture and Translation

    Science.gov (United States)

    Babaee, Siamak; Wan Yahya, Wan Roselezam; Babaee, Ruzbeh

    2014-01-01

    Some scholars (Bassnett-McGuire, Catford, Brislin) suggest that a good piece of translation should be a strict reflection of the style of the original text while some others (Gui, Newmark, Wilss) consider the original text untranslatable unless it is reproduced. Opposing views by different critics suggest that translation is still a challenging…

  20. Project management plan for the 105-C Reactor interim safe storage project. Revision 1

    International Nuclear Information System (INIS)

    Miller, R.L.

    1997-01-01

    In 1942, the Hanford Site was commissioned by the US Government to produce plutonium. Between 1942 and 1955, eight water-cooled, graphite-moderated reactors were constructed along the Columbia River at the Hanford Site to support the production of plutonium. The reactors were deactivated from 1964 to 1971 and declared surplus. The Surplus Production Reactor Decommissioning Project (BHI 1994b) will decommission these reactors and has selected the 105-C Reactor to be used as a demonstration project for interim safe storage at the present location and final disposition of the entire reactor core in the 200 West Area. This project will result in lower costs, accelerated schedules, reduced worker exposure, and provide direct benefit to the US Department of Energy for decommissioning projects complex wide. This project sets forth plans, organizational responsibilities, control systems, and procedures to manage the execution of the Project Management Plan for the 105-C Reactor Interim Safe Storage Project (Project Management Plan) activities to meet programmatic requirements within authorized funding and approved schedules. The Project Management Plan is organized following the guidelines provided by US Department of Energy Order 4700.1, Project Management System and the Richland Environmental Restoration Project Plan (DOE-RL 1992b)

  1. Signature of balancing selection at the MC1R gene in Kunming dog populations.

    Directory of Open Access Journals (Sweden)

    Guo-dong Wang

    Full Text Available Coat color in dog breeds is an excellent character for revealing the power of artificial selection, as it is extremely diverse and likely the result of recent domestication. Coat color is generated by melanocytes, which synthesize pheomelanin (a red or yellow pigment or eumelanin (a black or brown pigment through the pigment type-switching pathway, and is regulated by three genes in dogs: MC1R (melanocortin receptor 1, CBD103 (β-defensin 103, and ASIP (agouti-signaling protein precursor. The genotypes of these three gene loci in dog breeds are associated with coat color pattern. Here, we resequenced these three gene loci in two Kunming dog populations and analyzed these sequences using population genetic approaches to identify evolutionary patterns that have occurred at these loci during the recent domestication and breeding of the Kunming dog. The analysis showed that MC1R undergoes balancing selection in both Kunming dog populations, and that the Fst value for MC1R indicates significant genetic differentiation across the two populations. In contrast, similar results were not observed for CBD103 or ASIP. These results suggest that high heterozygosity and allelic differences at the MC1R locus may explain both the mixed color coat, of yellow and black, and the difference in coat colors in both Kunming dog populations.

  2. Tumor Suppressor Activity of the EphB2 Receptor in Prostate Cancer

    Science.gov (United States)

    2008-11-01

    H. (2006) Cancer Sci. 97, 1211–1216 34. Yao, V. J., Ozawa, M. G., Trepel, M., Arap, W., McDonald, D. M., and Pasqualini , R. (2005) Am. J. Pathol...and Lemay, S. (2006) Am. J. Physiol. 291, F960–F971 72. Ogawa, K., Pasqualini , R., Lindberg, R. A., Kain, R., Freeman, A. L., and Pasquale, E. B...Science 117: 2037-2049. 21. Ogawa K Pasqualini R Lindberg RA et al. (2000) The ephrin-A1 ligand and its receptor, EphA2, are expressed during tumor

  3. Nuclear reactor instrumentation at research reactor renewal

    International Nuclear Information System (INIS)

    Baers, B.; Pellionisz, P.

    1981-10-01

    The paper overviews the state-of-the-art of research reactor renewals. As a case study the instrumentation reconstruction of the Finnish 250 kW TRIGA reactor is described, with particular emphasis on the nuclear control instrumentation and equipment which has been developed and manufactured by the Central Research Institute for Physics, Budapest. Beside the presentation of the nuclear instrument family developed primarily for research reactor reconstructions, the quality assurance policy conducted during the manufacturing process is also discussed. (author)

  4. Nuclear Regulatory Commission Issuances, May 81

    International Nuclear Information System (INIS)

    1981-05-01

    Contents: Issuances of the Nuclear Regulatory Commission--Consolidated Edison Company of New York, Inc. (Indian Point, Unit No. 2), Power Authority of the State of New York (Indian Point, No. 3 Nuclear Power Plant), Pacific Gas and Electric Company (Diablo Canyon Nuclear Power Plant, Units 1 and 2), Statement of Policy on Conduct of Licensing Proceedings, Uranium Mill Licensing Requirements; Issuances of Atomic Safety and Licensing Appeal Boards--Houston Lighting and Power Company, et al. (South Texas Project, Units 1 and 2), Metropolitan Edison Company, et al. (Three Mile Island Nuclear Station, Unit No. 2), Pennsylvania Power and Light Company and Allegheny Electric Cooperative, Inc. (Susquehanna Steam Electric Station, Units 1 and 2), Philadelphia Electric Company et al. (Peach Bottom Atomic Power Station, Units 2 and 3), Public Service Electric and Gas Company (Hope Creek Generating Station, Units 1 and 2); Issuances of the Atomic Safety and Licensing Boards--Duke Power Company (William B. McGuire Nuclear Station, Units 1 and 2), Florida Light and Power Company (Turkey Point Nuclear Generating, Units 3 and 4), Illinois Power Company, et al. (Clinton Power Station, Units 1 and 2), Sacramento Municipal Utility District (Rancho Seco Nuclear Generating Station); Issuances of the Directors Denial--Commonwealth Edison Company (Byron Station, Units 1 and 2), Consolidated Edison Company of New York, Inc. (Indian Point Unit No. 2), Gulf States Utilities Company (River Bend Station Units 1 and 2), Petition to Suspend All Operating Licenses for Pressurized Water Reactors (River Bend Station Units 1 and 2), Portland General Electric Company (Trojan Nuclear

  5. The transcription factor Rbf1 is the master regulator for b-mating type controlled pathogenic development in Ustilago maydis.

    Directory of Open Access Journals (Sweden)

    Kai Heimel

    Full Text Available In the phytopathogenic basidiomycete Ustilago maydis, sexual and pathogenic development are tightly connected and controlled by the heterodimeric bE/bW transcription factor complex encoded by the b-mating type locus. The formation of the active bE/bW heterodimer leads to the formation of filaments, induces a G2 cell cycle arrest, and triggers pathogenicity. Here, we identify a set of 345 bE/bW responsive genes which show altered expression during these developmental changes; several of these genes are associated with cell cycle coordination, morphogenesis and pathogenicity. 90% of the genes that show altered expression upon bE/bW-activation require the zinc finger transcription factor Rbf1, one of the few factors directly regulated by the bE/bW heterodimer. Rbf1 is a novel master regulator in a multilayered network of transcription factors that facilitates the complex regulatory traits of sexual and pathogenic development.

  6. Reactor benchmarks and integral data testing and feedback into ENDF/B-VI

    International Nuclear Information System (INIS)

    McKnight, R.D.; Williams, M.L.

    1992-01-01

    The role of integral data testing and its feedback into the ENDF/B evaluated nuclear data files are reviewed. The use of the CSEWG reactor benchmarks in the data testing process is discussed and selected results based on ENDF/B Version VI data are presented. Finally, recommendations are given to improve the implementation in future integral data testing of ENDF/B

  7. Concurrence of B-lymphoblastic leukemia and myeloproliferative neoplasm with copy neutral loss of heterozygosity at chromosome 1p harboring a MPL W515S mutation.

    Science.gov (United States)

    Tao, Jiangchuan; Zhang, Xiaohui; Lancet, Jeffrey; Bennett, John M; Cai, Li; Papenhausen, Peter; Moscinski, Lynn; Zhang, Ling

    2014-01-01

    B-lymphoblastic leukemia (B-ALL) is a neoplasm of precursors committed to B-cell lineage, whereas myeloproliferative neoplasm (MPN) is a clonal proliferation derived from myeloid stem cells. Concurrent B-ALL with MPN is uncommon except in the presence of abnormalities of the PDGFRA, PDGFRB, or FGFR1 genes or the BCR-ABL1 fusion gene. Herein, we describe a rare concurrence, B-ALL with MPN without the aforementioned genetic aberrations, in a 64-year-old male patient. The patient was initially diagnosed with B-ALL with normal karyotype and responded well to aggressive chemotherapy but had sustained leukocytosis and splenomegaly. The posttreatment restaging bone marrow was free of B-ALL but remained hypercellular with myeloid predominance. Using a single nucleotide polymorphism microarray study, we identified a copy neutral loss of heterozygosity at the terminus of 1p in the bone marrow samples taken at diagnosis and again at remission, 49% and 100%, respectively. Several additional genetic abnormalities were present in the initial marrow sample but not in the remission marrow samples. Retrospective molecular studies detected a MPL W515S homozygous mutation in both the initial and remission marrows for B-ALL, at 30-40% and 80% dosage effect, respectively. In summary, we present a case of concurrent B-ALL and MPN and demonstrate a stepwise cytogenetic and molecular approach to the final diagnosis. Copyright © 2014 Elsevier Inc. All rights reserved.

  8. Post-irradiation examination of Oconee 1 fuel - cycle 1 destructive test phase

    International Nuclear Information System (INIS)

    1979-07-01

    Standard B and W Mark-B (15 x 15) pressurized water reactor fuel rods were destructively examined after one cycle of irradiation in the Oconee 1 reactor. Fuel rod average burnup ranged from 10,603 to 11,270 MWd/mtU for the rods examined. Data obtained included fuel rod extraction loads, rod dimensional changes, cladding tensile properties, fuel pellet gap length, fission product distribution, fission gas and crud composition, fuel densification, chemical burnup analysis, and fuel and cladding microstructure. As expected, parametric changes were well within the design envelope. Superficial corrosion and wear were found at spacer grid contact points. However, the 19 rods examined were structurally sound and exhibited no indications of cladding defects associated with pelletcladding interactions

  9. Incorporation of water-in-oil-in-water (W1/O/W2) double emulsion in a set-type yogurt model.

    Science.gov (United States)

    Lalou, Sofia; Kadri, Hani El; Gkatzionis, Konstantinos

    2017-10-01

    The effect of W 1 /O/W 2 emulsion incorporation in set-type yogurt on the acidification process, physicochemical properties, bacterial growth kinetics and structural characteristics was investigated. The W 1 /O/W 2 emulsion was formed by using a two-step homogenisation process and milk as the W 1 and W 2 phases, and stability was monitored with optical microscopy and cryo-SEM. Adding the W 1 /O/W 2 emulsions reduced the acidification rate, viscosity and water retention capacity. Texture (adhesiveness, cohesiveness, hardness, and gumminess) differed in yogurts containing W 1 /O/W 2 emulsion compared to controls during the acidification process, however, trends became stable during storage. The growth of S. thermophilus during the acidification process of yogurt was reduced in the presence of W 1 /O/W 2 emulsion while L. bulgaricus trended higher during storage. This study shows that yogurts containing W 1 /O/W 2 emulsion are feasible subject to processing modification. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Evaluation of Torsatrons as reactors

    International Nuclear Information System (INIS)

    Lyon, J.F.; Gulec, K.; Miller, R.L.; El-Guebaly, L.

    1994-03-01

    Stellarators have significant operational advantages over tokamaks as ignited steady-state reactors. This scoping study, which uses an integrated cost-minimization code that incorporates costing and reactor component models self-consistently with a 1-D energy transport calculation, shows that a torsatron reactor could also be economically competitive with a tokamak reactor. The projected cost of electricity (COE) estimated using the Advanced Reactor Innovation and Evaluation Studies (ARIES) costing algorithms is 65.6 mill/kW(e)h in constant 1992 dollars for a reference 1-GW(e) Compact Torsatron reactor case. The COE is relatively insensitive (<10% variation) over a wide range of assumptions, including variations in the maximum field allowed on the coils, the coil elongation, the shape of the density profile, the beta limit, the confinement multiplier, and the presence of a large loss region for alpha particles. The largest variations in the COE occur for variations in the electrical power output demanded and the plasma-coil separation ratio

  11. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  12. W. E. B. Du Bois: A Dynamic Communicator and Cultural Iconoclast.

    Science.gov (United States)

    Reppert, James E.

    This paper presents a biographical sketch of the prolific African-American writer and sociologist W.E.B. Du Bois, designed as an instructional unit in an introduction to mass communication course which can help make students aware of the roles played by ethnic minorities in shaping American and world media. The paper provides numerous details of…

  13. Extension of TRIGA reactor capabilities

    International Nuclear Information System (INIS)

    Gietzen, A.J.

    1980-01-01

    The first TRIGA reactor went into operation at 10 kW about 22 years ago. Since that time 55 TRIGAs have been put into operation including steady-state powers up to 14,000 kW and pulsing reactors that pulse to 20,000,000 kW. Five more are under construction and a proposal will soon be submitted for a reactor of 25,000 kW. Along with these increases in power levels (and the corresponding fluxes) the experimental facilities have also been expanded. In addition to the installation of new TRIGA reactors with enhanced capabilities many of the older reactors have been modified and upgraded. Also, a number of reactors originally fueled with plate fuel were converted to TRIGA fuel to take advantage of the improved technical and safety characteristics, including the ability for pulsed operation. In order to accommodate increased power and performance the fuel has undergone considerable evolution. Most of the changes have been in the geometry, enrichment and cladding material. However, more recently further development on the UZrH alloy has been carried out to extend the uranium content up to 45% by weight. This increased U content is necessary to allow the use of less than 20% enrichment in the higher powered reactors while maintaining longer core lifetime. The instrumentation and control system has undergone remarkable improvement as the electronics technology has evolved so rapidly in the last two decades. The information display and the circuitry logic has also undergone improvements for enhanced ease of operation and safety. (author)

  14. Analysis of ex-vessel steam explosion with MC3D

    International Nuclear Information System (INIS)

    Leskovar, M.; Mavko, B.

    2007-01-01

    An ex-vessel steam explosion may occur when, during a severe reactor accident, the reactor vessel fails and the molten core pours into the water in the reactor cavity. A steam explosion is a fuel coolant interaction process where the heat transfer from the melt to water is so intense and rapid that the timescale for heat transfer is shorter than the timescale for pressure relief. This can lead to the formation of shock waves and production of missiles that may endanger surrounding structures. A strong enough steam explosion in a nuclear power plant could jeopardize the containment integrity and so lead to a direct release of radioactive material to the environment. In the paper, different scenarios of ex-vessel steam explosions in a typical pressurized water reactor cavity are analyzed with the code MC3D, which was developed for the simulation of fuel-coolant interactions. A comprehensive parametric study was performed varying the location of the melt release (central, left and right side melt pour), the cavity water subcooling, the primary system overpressure at vessel failure and the triggering time for explosion calculations. The main purpose of the study was to determine the most challenging ex-vessel steam explosion cases in a typical pressurized water reactor and to estimate the expected pressure loadings on the cavity walls. The performed analysis shows that for some ex-vessel steam explosion scenarios significantly higher pressure loads are predicted than obtained in the OECD programme SERENA Phase 1. (author)

  15. Recuperation of the energy released in the G-1, an air-cooled graphite reactor core

    International Nuclear Information System (INIS)

    Chambadal, P.; Pascal, M.

    1955-01-01

    The CEA (in his five-year setting plan) has objective among others, the realization of the two first french reactors moderated with graphite. The construction of the G-1 reactor in Marcoule, first french plutonic core, is achieved so that it will diverge in the beginning of 1956 and reach its full power in the beginning of the second semester of the same year. In this report we will detail the specificities of the reactor and in particular its cooling and energy recuperation system. The G-1 reactor being essentially intended to allow the french technicians to study the behavior of an energy installation supply taking its heat in a nuclear source as early as possible. (M.B.) [fr

  16. McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple.

    Science.gov (United States)

    Tian, Ji; Zhang, Jie; Han, Zhen-Yun; Song, Ting-Ting; Li, Jin-Yan; Wang, Ya-Ru; Yao, Yun-Cong

    2017-03-03

    The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to their promoters, but to be only partially responsible for regulating PAs biosynthetic genes. In contrast, McMYB12b showed preferential binding to the promoters of PAs biosynthetic genes. Overexpression of McMYB12a and McMYB12b in tobacco (Nicotiana tabacum) altered the expression of flavonoid biosynthetic genes and promoted the accumulation of PAs and anthocyanins in tobacco petals. Conversely, transient silencing their expression in crabapple plants, using a conserved gene region, resulted in reduced PAs and anthocyanin production a green leaf phenotype. Meanwhile, transient overexpression of the two genes and silenced McMYB12s in apple (Malus domestica) fruit had a similar effect as overexpression in tobacco and silenced in crabapple. This study reveals a new mechanism for the coordinated regulation of PAs and anthocyanin accumulation in crabapple leaves, which depends on an auto-regulatory balance involving McMYB12a and McMYB12b expression.

  17. History of Research Reactor Fuel Fabrication at Babcock and Wilcox

    International Nuclear Information System (INIS)

    Freim, J.B.

    1983-01-01

    1982 was a year of tremendous growth for Babcock and Wilcox and its Research Reactor Fuel Facility. The Division has progressed from essentially being a non-competitor to a position where we are growing in strength. This paper describes some of the general aspects of past history and where B and W is now

  18. HEDL W-1 SLSF experiment LOPI transient and boiling test results

    International Nuclear Information System (INIS)

    Henderson, J.M.; Wood, S.A.; Rothrock, R.B.

    1980-01-01

    The W-1 Sodium Loop Safety Facility (SLSF) experiment was designed to study the heat release characteristics of fast reactor fuel pins under Loss-of-Piping-Integrity (LOPI) accident conditions and determine stable sodium boiling initiation and recovery limits in a prototypic fuel pin bundle array. The results of the experiment address major second level of assurance (LOA-2) safety issues and provide increased insight and understanding of phenomena that would inherently terminate hypothesized accidents with only limited core damage. The irradiation phase of the experiment, consisting of thirteen individual transients, was performed between May 27 and July 20, 1979. The final transient produced approximately two seconds of coolant boiling, cladding dryout, and incipient fuel pin failure. The facility and test hardware performed as designed, allowing completion of all planned tests and achievement of all test objectives

  19. Current activities at the FiR 1 TRIGA reactor

    International Nuclear Information System (INIS)

    Salmenhaara, Seppo

    2002-01-01

    The FiR 1 -reactor, a 250 kW Triga reactor, has been in operation since 1962. The main purpose to run the reactor is now the Boron Neutron Capture Therapy (BNCT). The epithermal neutrons needed for the irradiation of brain tumor patients are produced from the fast fission neutrons by a moderator block consisting of Al+AlF 3 (FLUENTAL), which showed to be the optimum material for this purpose. Twenty-one patients have been treated since May 1999, when the license for patient treatment was granted to the responsible BNCT treatment organization. The treatment organization has a close connection to the Helsinki University Central Hospital. The BNCT work dominates the current utilization of the reactor: three days per week for BNCT purposes and only two days per week for other purposes such as the neutron activation analysis and isotope production. In the near future the back end solutions of the spent fuel management will have a very important role in our activities. The Finnish Parliament ratified in May 2001 the Decision in Principle on the final disposal facility for spent fuel in Olkiluoto, on the western coast of Finland. There is a special condition in our operating license. We have now about two years' time to achieve a binding agreement between VTT and the Nuclear Power Plant Companies about the possibility to use the final disposal facility of the Nuclear Power Plants for our spent fuel. If this will not happen, we have to make the agreement with the USDOE with the well-known time limits. At the moment it seems to be reasonable to prepare for both spent fuel management possibilities: the domestic final disposal and the return to the USA offered by USDOE. Because the cost estimates of the both possibilities are on the same order of magnitude, the future of the reactor itself will determine, which of the spent fuel policies will be obeyed. In a couple of years' time it will be seen, if the funding of the reactor and the incomes from the BNC treatments will cover

  20. Melanocortin 1 receptor (MC1R) gene sequence variation and melanism in the gray (Sciurus carolinensis), fox (Sciurus niger), and red (Sciurus vulgaris) squirrel.

    Science.gov (United States)

    McRobie, Helen R; King, Linda M; Fanutti, Cristina; Coussons, Peter J; Moncrief, Nancy D; Thomas, Alison P M

    2014-01-01

    Sequence variations in the melanocortin 1 receptor (MC1R) gene are associated with melanism in many different species of mammals, birds, and reptiles. The gray squirrel (Sciurus carolinensis), found in the British Isles, was introduced from North America in the late 19th century. Melanism in the British gray squirrel is associated with a 24-bp deletion in the MC1R. To investigate the origin of this mutation, we sequenced the MC1R of 95 individuals including 44 melanic gray squirrels from both the British Isles and North America. Melanic gray squirrels of both populations had the same 24-bp deletion associated with melanism. Given the significant deletion associated with melanism in the gray squirrel, we sequenced the MC1R of both wild-type and melanic fox squirrels (Sciurus niger) (9 individuals) and red squirrels (Sciurus vulgaris) (39 individuals). Unlike the gray squirrel, no association between sequence variation in the MC1R and melanism was found in these 2 species. We conclude that the melanic gray squirrel found in the British Isles originated from one or more introductions of melanic gray squirrels from North America. We also conclude that variations in the MC1R are not associated with melanism in the fox and red squirrels.

  1. Zasady żywienia dzieci w drugim i trzecim roku życia

    Directory of Open Access Journals (Sweden)

    Adam J. Sybilski

    2010-11-01

    Full Text Available W artykule przedstawiono aktualny stan wiedzy na temat zasad żywienia dzieci w 2. i 3. roku życia. W okresie poniemowlęcym zapotrzebowanie energetyczne dziecka zmniejsza się do ok. 90 kcal/kg mc./dobę. Zmianie ulega również tempo jego wzrostu. Połowa energii wydatkowana jest na potrzeby aktywności fizycznej, więc potrzeby żywieniowe dziecka są od nich uzależnione. Rozkład podaży energii pozabiałkowej powinien wynosić 60-65% z węglowodanów i 35-40% z tłuszczu. Należy zadbać o stopniowe wzbogacanie diety o kwasy tłuszczowe (NNKT, zawarte w olejach roślinnych, tłustych rybach morskich, orzechach oraz zielonych warzywach. Do 2. roku życia zalecana jest dieta bogata w tłuszcze, głównie pochodzące z masła, następnie należy stopniowo ograniczać tłuszcze zwierzęce, aby uniknąć otyłości. Dziecku nie należy podawać tłustych mięs oraz surowych jaj, gdyż zawierają one awidynę. Do 3. roku życia korzystniejsze jest podawanie mieszanek mlecznych typu „junior” niż pełnego mleka krowiego. Rekomendowane produkty zbożowe zawierające węglowodany to przede wszystkim pieczywo razowe oraz grube kasze. Zapotrzebowanie na płyny u małego dziecka wynosi ok. 950 ml/dobę. Najlepsze do picia są woda, niesłodzone herbatki ziołowe i naturalne soki owocowe. Ważna jest też forma, czyli w jaki sposób przyjmowane są pokarmy. Należy kształtować w dziecku dobre nawyki i przyzwyczajenia związane z jedzeniem, kierując się zasadą 4U: urozmaicenie, umiar, unikanie i uregulowanie. Obecnie można zauważyć poprawę w stanie odżywienia polskich dzieci, choć nadal sposób ich żywienia bywa niezadowalający. Do najczęstszych błędów zalicza się nadmierne używanie soli, mało urozmaiconą dietę, brak czasu i zniecierpliwienie w czasie posiłków, nerwową atmosferę w czasie posiłków oraz nadmierne rozdrabnianie produktów.

  2. Nowy sposób wytwarzania odlewów precyzyjnych ze stopu miedzi w formach ceramicznych

    Directory of Open Access Journals (Sweden)

    E. Czekaj

    2012-12-01

    Full Text Available W publikacji zaprezentowano wyniki badań odlewów wytwarzanych ze stopu miedzi (brązu aluminiowego, typu BA1044 wedługopracowanej w Instytucie Odlewnictwa w Krakowie technologii wykonywania odlewów precyzyjnych przy zastosowaniu kierunkowegokrzepnięcia [9]. Wstępnie pokazano zasadność nowoopracowanego w Polsce sposobu wytwarzania skomplikowanych konstrukcyjnie, azarazem wysokojakościowych (z uwagi na właściwości użytkowe części maszyn, urządzeń i pojazdów ze stopów miedzi. Proponowanerozwiązanie jest innowacją nie tylko w skali kraju (Polski, ale również o zasięgu międzynarodowym.

  3. Analiza porównawcza wyników badania oczopląsu w teście kalorycznym uzyskanych przy użyciu metody ENG i VNG u osób zdrowych

    Directory of Open Access Journals (Sweden)

    Renata Pepaś

    2010-03-01

    Full Text Available Wprowadzenie: Najważniejszą obiektywną metodą oceny zaburzeń układu równowagi jest badanie oczopląsu. Badanie kaloryczne jako jedyny test obrazuje pobudliwość poszczególnych błędników, umożliwiając ocenę każdego z nich osobno. Cel pracy: Celem pracy jest analiza porównawcza wyników badania oczopląsu kalorycznego uzyskanych przy użyciu metody ENG i VNG u osób zdrowych. Materiał i metody: Badaniami objęto grupę 20 osób zdrowych, w tym 10 kobiet i 10 mężczyzn w wieku 22-26 lat. U wszystkich chorych przeprowadzono badanie podmiotowe oraz badanie przedmiotowe otoneurologiczne, badanie ENG i w odstępie 7-dniowym badanie VNG z kalibracją, oceną oczopląsu samoistnego oraz próbami kalorycznymi wg Hallpike’a. Test kaloryczny wykonano kalorymetrem powietrznym firmy HOMOTH, używając temperatury powietrza 30°C oraz 44°C, podawanych przez 40 s do ucha. Wyniki: W teście kalorycznym u żadnej osoby nie stwierdzono deficytu kanałowego wykraczającego poza granice przyjętych norm. Zaobserwowano niższe wartości średnie maksymalnej prędkości wolnej fazy oczopląsów w badaniu ENG niż VNG. Ponadto badanie VNG dodatkowo umożliwiło wyznaczenie wartości przewagi kierunkowej bezwzględnej oraz średniej pobudliwości błędników. Wnioski: Uzyskane wyniki wskazują, iż badanie VNG w stosunku do badania ENG jest bardziej precyzyjne i umożliwia dokładniejsze opisanie próby kalorycznej wg Hallpike’a. W badaniu VNG analiza parametru przewagi kierunkowej bezwzględnej znacznie podnosi wartość próby kalorycznej wg Hallpike’a.

  4. Erie Nuclear Plant, Units 1 and 2. License application, preliminary safety analysis report, volume 1: chapter 1

    International Nuclear Information System (INIS)

    1977-01-01

    Erie 1 and 2 reactors will be located on a site consisting of 1,740 acres in Berlin Township about 2.4 miles south of Lake Erie and 8.9 miles southeast of Sandusky, Ohio. Lake Erie will provide makeup water. The ultimate heat sink will be a 40 acre cooling reservoir shared by both units. Each unit has a proposed core thermal power level of 3,760 MW(t) and a nominal net capacity of about 1282 MW(e). Unit 1 is scheduled for commercial operation by 4/1/84 and Unit 2 by 4/1/86. Fuel will be Zircaloy-4 clad tubes containing cylindrical fuel pellets of UO 2 . B and W pressurized water reactor units to be employed are described in DOCKET-STN-50561

  5. Synthesis, Structure, Bonding, and Reactivity of Metal Complexes Comprising Diborane(4) and Diborene(2): [{Cp*Mo(CO)2 }2 {μ-η2 :η2 -B2 H4 }] and [{Cp*M(CO)2 }2 B2 H2 M(CO)4 ], M=Mo,W.

    Science.gov (United States)

    Mondal, Bijan; Bag, Ranjit; Ghorai, Sagar; Bakthavachalam, K; Jemmis, Eluvathingal D; Ghosh, Sundargopal

    2018-04-26

    The reaction of [(Cp*Mo) 2 (μ-Cl) 2 B 2 H 6 ] (1) with CO at room temperature led to the formation of the highly fluxional species [{Cp*Mo(CO) 2 } 2 {μ-η 2 :η 2 -B 2 H 4 }] (2). Compound 2, to the best of our knowledge, is the first example of a bimetallic diborane(4) conforming to a singly bridged C s structure. Theoretical studies show that 2 mimics the Cotton dimolybdenum-alkyne complex [{CpMo(CO) 2 } 2 C 2 H 2 ]. In an attempt to replace two hydrogen atoms of diborane(4) in 2 with a 2e [W(CO) 4 ] fragment, [{Cp*Mo(CO) 2 } 2 B 2 H 2 W(CO) 4 ] (3) was isolated upon treatment with [W(CO) 5 ⋅thf]. Compound 3 shows the intriguing presence of [B 2 H 2 ] with a short B-B length of 1.624(4) Å. We isolated the tungsten analogues of 3, [{Cp*W(CO) 2 } 2 B 2 H 2 W(CO) 4 ] (4) and [{Cp*W(CO) 2 } 2 B 2 H 2 Mo(CO) 4 ] (5), which provided direct proof of the existence of the tungsten analogue of 2. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Divalent Metal Ions Induced Osteogenic Differentiation of MC3T3E1

    Science.gov (United States)

    Wang, Guoshou; Su, Wenta; Chen, Pohung; Huang, Teyang

    2017-12-01

    Biomaterial scaffolds blended with biochemical signal molecules with adequate osteoinductive and osteoconductive properties have attracted significant interest in bone tissue engineering regeneration. The divalent metal ions can gradually release from the scaffold into the culture medium and then induced osteoblastic differentiation of MC3T3E1. These MC3T3E1 cells expressed high activity of alkaline phosphatase, bone-related gene expression of collagen type I, Runx2, osteopontin, osteocalcin, and significantly enhanced deposited minerals on scaffold after 21 days of culture. This experiment provided a useful inducer for osteogenic differentiation in bone repair.

  7. Justice: Constitutional Update. Bar/School Partnership Programs Series.

    Science.gov (United States)

    American Bar Association, Chicago, IL. Special Committee on Youth Education for Citizenship.

    The third in this special series on constitutional themes, this document focuses on justice. "Due Process: What Is It?" (P. McGuire) examines the concept of due process as provided in the Fifth and Fourteenth Amendments and provides lesson plans for a five-day unit on that topic. "Making Government Fair" (G. Galland) explains…

  8. Annual report on JEN-1 reactor

    International Nuclear Information System (INIS)

    Montes, J.

    1972-01-01

    In the annual report on the JEN-1 reactor the main features of the reactor operations and maintenance are described. The reactor has been critical for 1831 hours, what means 65,8% of the total working time. Maintenance and pool water contamination have occupied the rest of the time. The maintenance schedule is shown in detail according to three subjects. The main failures and reactor scrams are also described. The daily maximum values of the water activity are given so as the activity of the air in the reactor hall. (Author)

  9. Mirror reactor studies

    International Nuclear Information System (INIS)

    Moir, R.W.; Barr, W.L.; Bender, D.J.

    1976-01-01

    Design studies of a fusion mirror reactor, a fusion-fission mirror reactor, and two small mirror reactors are summarized. The fusion reactor uses 150-keV neutral-beam injectors based on the acceleration of negative ions. The injectors provide over 1 GW of continuous power at an efficiency greater than 80 percent. The fusion reactor has three-stage, modularized, Venetian blind, plasma direct converter with a predicted efficiency of 59 percent and a new concept for removal of the lune-shaped blanket: a crane is brought between the two halves of the Yin-Yang magnet, which are separated by a float. The design has desirable features such as steady-state operation, minimal impurity problems, and low first-wall thermal stress. The major disadvantage is low Q resulting in high recirculating power and hence high cost of electrical power. However, the direct capital cost per unit of gross electrical power is reasonable [$1000/kW(e)

  10. The optimal control of ITU TRIGA Mark II Reactor

    International Nuclear Information System (INIS)

    Can, Burhanettin

    2008-01-01

    In this study, optimal control of ITU TRIGA Mark-II Reactor is discussed. A new controller has been designed for ITU TRIGA Mark-II Reactor. The controller consists of main and auxiliary controllers. The form is based on Pontragyn's Maximum Principle and the latter is based on PID approach. For the desired power program, a cubic function is chosen. Integral Performance Index includes the mean square of error function and the effect of selected period on the power variation. YAVCAN2 Neutronic - Thermal -Hydraulic code is used to solve the equations, namely 11 equations, dealing with neutronic - thermal - hydraulic behavior of the reactor. For the controller design, a new code, KONTCAN, is written. In the application of the code, it is seen that the controller controls the reactor power to follow the desired power program. The overshoot value alters between 100 W and 500 W depending on the selected period. There is no undershoot. The controller rapidly increases reactivity, then decreases, after that increases it until the effect of temperature feedback is compensated. Error function varies between 0-1 kW. (author)

  11. 105-B Reactor museum feasibility assessment (Phase 2) project

    International Nuclear Information System (INIS)

    Heckel, R. P.

    2000-01-01

    This 105-B Reactor Museum feasibility assessment project report documents project activities that have been performed, including a review and assessment of previously existing information, a walk-through of the facility, an assessment of potential hazards, and selection of mitigative measures deemed to be appropriate to allow unescorted access by members of the public to a specified primary tour route

  12. Lithostratigraphy from downhole logs in Hole AND-1B, Antarctica

    Science.gov (United States)

    Williams, Trevor; Morin, Roger H.; Jarrard, Richard D.; Jackolski, Chris L.; Henrys, Stuart A.; Niessen, Frank; Magens, Diana; Kuhn, Gerhard; Monien, Donata; Powell, Ross D.

    2012-01-01

    The ANDRILL (Antarctic Drilling Project) McMurdo Ice Shelf (MIS) project drilled 1285 m of sediment in Hole AND–1B, representing the past 12 m.y. of glacial history. Downhole geophysical logs were acquired to a depth of 1018 mbsf (meters below seafloor), and are complementary to data acquired from the core. The natural gamma radiation (NGR) and magnetic susceptibility logs are particularly useful for understanding lithological and paleoenvironmental change at ANDRILL McMurdo Ice Shelf Hole AND–1B. NGR logs cover the entire interval from the seafloor to 1018 mbsf, and magnetic susceptibility and other logs covered the open hole intervals between 692 and 1018 and 237–342 mbsf. In the upper part of AND–1B, clear alternations between low and high NGR values distinguish between diatomite (lacking minerals containing naturally radioactive K, U, and Th) and diamictite (containing K-bearing clays, K-feldspar, mica, and heavy minerals). In the lower open hole logged section, NGR and magnetic susceptibility can also distinguish claystones (rich in K-bearing clay minerals, relatively low in magnetite) and diamictites (relatively high in magnetite). Sandstones can be distinguished by their high resistivity values in AND–1B. On the basis of these three downhole logs, diamictite, claystones, and sandstones can be predicted correctly for 74% of the 692–1018 mbsf interval. The logs were then used to predict facies for the 6% of this interval that was unrecovered by coring. Given the understanding of the physical property characteristics of different facies, it is also possible to identify subtle changes in lithology from the physical properties and help refine parts of the lithostratigraphy, for example, the varying terrigenous content of diatomites and the transitions from subice diamictite to open-water diatomite.

  13. On W1+∞ 3-algebra and integrable system

    Directory of Open Access Journals (Sweden)

    Min-Ru Chen

    2015-02-01

    Full Text Available We construct the W1+∞ 3-algebra and investigate its connection with the integrable systems. Since the W1+∞ 3-algebra with a fixed generator W00 in the operator Nambu 3-bracket recovers the W1+∞ algebra, it is intrinsically related to the KP hierarchy. For the general case of the W1+∞ 3-algebra, we directly derive the KP and KdV equations from the Nambu–Poisson evolution equation with the different Hamiltonian pairs of the KP hierarchy. Due to the Nambu–Poisson evolution equation involves two Hamiltonians, the deep relationship between the Hamiltonian pairs of KP hierarchy is revealed. Furthermore we give a realization of the W1+∞ 3-algebra in terms of a complex bosonic field. Based on the Nambu 3-brackets of the complex bosonic field, we derive the (generalized nonlinear Schrödinger equation and give an application in optical soliton.

  14. Double-pass tapered amplifier diode laser with an output power of 1 W for an injection power of only 200 μW.

    Science.gov (United States)

    Bolpasi, V; von Klitzing, W

    2010-11-01

    A 1 W tapered amplifier requiring only 200 μW of injection power at 780 nm is presented in this paper. This is achieved by injecting the seeding light into the amplifier from its tapered side and feeding the amplified light back into the small side. The amplified spontaneous emission of the tapered amplifier is suppressed by 75 dB. The double-passed tapered laser, presented here, is extremely stable and reliable. The output beam remains well coupled to the optical fiber for a timescale of months, whereas the injection of the seed light did not require realignment for over a year of daily operation.

  15. Photocatalytic Degradation Property of NANO-TiO2/DIATOMITE for Rodamine B Dye Wastewater

    Science.gov (United States)

    Liu, Yue; Zheng, Shuilin; Du, Gaoxiang; Shu, Feng; Chen, Juntao

    The Nano-TiO2/Diatomite compound photocatalyst is used to degrade rhodamine B dye wastewater in photochemical reactor. The test result indicates that the rate of photodegradation of rhodamine B is influenced by reactive conditions. The best technical conditions are concentration of rhodamine B solution 10mg/L, ultraviolet light 300W, the compound photocatalyst amount used 1g/L, the pH 5.8, reaction time 20min. Under these conditions the rate of photodegradation of rhodamine B may reach as high as 97.80%. And the efficiency of photodegradation of catalyst only has a little changed in recycling.

  16. Experimental research in neutron physic and thermal-hydraulic at the CDTN Triga reactor

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Amir Z.; Souza, Rose Mary G.P.; Ferreira, Andrea V.; Pinto, Antonio J.; Costa, Antonio C.L.; Rezende, Hugo C., E-mail: amir@cdtn.b, E-mail: souzarm@cdtn.b, E-mail: avf@cdtn.b, E-mail: ajp@cdtn.b, E-mail: aclc@cdtn.b, E-mail: hcr@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2011-07-01

    The IPR-R1 TRIGA (Training, Research, Isotopes production, General Atomics) at Nuclear Technology Development Center (CDTN) is a pool type reactor cooled by natural circulation of light water and an open surface. TRIGA reactors, developed by General Atomics (GA), are the most widely used research reactor in the world and characterized by inherent safety. The IPR-R1 is the only Brazilian nuclear research reactor available and able to perform experiments in which interaction between neutronic and thermal-hydraulic areas occurs. The IPR-R1 has started up on November 11th, 1960. At that time the maximum thermal power was 30 kW. The present forced cooling system was built in the 70th and the power was upgraded to 100 kW. Recently the core configuration and instrumentation was upgraded again to 250 kW at steady state, and is awaiting the license of CNEN to operate definitely at this new power. This paper describes the experimental research project carried out in the IPR-R1 reactor that has as objective evaluate the behaviour of the reactor operational parameters, and mainly to investigate the influence of temperature on the neutronic variables. The research was supported by Research Support Foundation of the State of Minas Gerais (FAPEMIG) and Brazilian Council for Scientific and Technological Development (CNPq). The research project meets the recommendations of the IAEA, for safety, modernization and development of strategic plan for research reactors utilization. This work is in line with the strategic objectives of Brazil, which aims to design and construct the Brazilian Multipurpose research Reactor (RMB). (author)

  17. Experimental research in neutron physic and thermal-hydraulic at the CDTN Triga reactor

    International Nuclear Information System (INIS)

    Mesquita, Amir Z.; Souza, Rose Mary G.P.; Ferreira, Andrea V.; Pinto, Antonio J.; Costa, Antonio C.L.; Rezende, Hugo C.

    2011-01-01

    The IPR-R1 TRIGA (Training, Research, Isotopes production, General Atomics) at Nuclear Technology Development Center (CDTN) is a pool type reactor cooled by natural circulation of light water and an open surface. TRIGA reactors, developed by General Atomics (GA), are the most widely used research reactor in the world and characterized by inherent safety. The IPR-R1 is the only Brazilian nuclear research reactor available and able to perform experiments in which interaction between neutronic and thermal-hydraulic areas occurs. The IPR-R1 has started up on November 11th, 1960. At that time the maximum thermal power was 30 kW. The present forced cooling system was built in the 70th and the power was upgraded to 100 kW. Recently the core configuration and instrumentation was upgraded again to 250 kW at steady state, and is awaiting the license of CNEN to operate definitely at this new power. This paper describes the experimental research project carried out in the IPR-R1 reactor that has as objective evaluate the behaviour of the reactor operational parameters, and mainly to investigate the influence of temperature on the neutronic variables. The research was supported by Research Support Foundation of the State of Minas Gerais (FAPEMIG) and Brazilian Council for Scientific and Technological Development (CNPq). The research project meets the recommendations of the IAEA, for safety, modernization and development of strategic plan for research reactors utilization. This work is in line with the strategic objectives of Brazil, which aims to design and construct the Brazilian Multipurpose research Reactor (RMB). (author)

  18. Experience on wet storage spent fuel sipping at IEA-R1 Brazilian research reactor

    International Nuclear Information System (INIS)

    Perrotta, J.A.; Terremoto, L.A.A.; Zeituni, C.A.

    1998-01-01

    The IEA-R1 research reactor of the Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP) is a pool type reactor of B and W design, that has been operating since 1957 at a power of 2 MW. Irradiated (spent) fuels have been stored at the facility during the various years of operation. At present there are 40 spent fuel assemblies at dry storage, 79 spent fuel assemblies at wet storage and 30 fuel assemblies in the core. The oldest fuels are of United States origin, made with U-Al alloy, both of LEU and HEU MTR fuel type. Many of these fuel assemblies have corrosion pits along their lateral fuel plates. These pits originate by galvanic corrosion between the fuel plate and the stainless steel storage racks. As a consequence of the possibility of sending the irradiated old fuels back the U.S.A., sipping tests were performed with the spent fuel assemblies. The reason for this was to evaluate their 137 Cs leaking rate, if any. This work describes the procedure and methodology used to perform the sipping tests with the fuel assemblies at the storage pool, and presents the results obtained for the 137 Cs sipping water activity for each fuel assembly. A correlation is made between the corrosion pits and the activity values measured. A 137 Cs leaking rate is determined and compared to the criteria established for canning spent fuel assemblies before shipment

  19. Development of a research nuclear reactor simulator using LABVIEW®

    Energy Technology Data Exchange (ETDEWEB)

    Lage, Aldo Marcio Fonseca; Mesquita, Amir Zacarias; Pinto, Antonio Juscelino; Souza, Luiz Claudio Andrade [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-07-01

    The International Atomic Energy Agency recommends the use of safety and friendly interfaces for monitoring and controlling the operational parameters of the nuclear reactors. The most important variable in the nuclear reactors control is the power released by fission of the fuel in the core which is directly proportional to neutron flux. It was developed a digital system to simulate the neutron evolution flux and monitoring their interaction on the other operational parameters. The control objective is to bring the reactor power from its source level (mW) to a few W. It is intended for education of basic reactor neutronic principles such as the multiplication factor, criticality, reactivity, period, delayed neutron and control by rods. The 250 kW IPR-R1 TRIGA research reactor at Nuclear Technology Development Center - CDTN (Belo Horizonte/Brazil) was used as reference. TRIGA reactors, developed by General Atomics (GA), are the most widely used research reactor in the world. They are cooled by light water under natural convection and are characterized by being inherently safety. The simulation system was developed using the LabVIEW® (Laboratory Virtual Instruments Engineering Workbench) software, considering the modern concept of virtual instruments (VI's). The main purpose of the system is to provide to analyze the behavior, and the tendency of some processes that occur in the reactor using a user-friendly operator interface. The TRIGA simulator system will allow the study of parameters, which affect the reactor operation, without the necessity of using the facility.(author)

  20. Development of a research nuclear reactor simulator using LABVIEW®

    International Nuclear Information System (INIS)

    Lage, Aldo Marcio Fonseca; Mesquita, Amir Zacarias; Pinto, Antonio Juscelino; Souza, Luiz Claudio Andrade

    2015-01-01

    The International Atomic Energy Agency recommends the use of safety and friendly interfaces for monitoring and controlling the operational parameters of the nuclear reactors. The most important variable in the nuclear reactors control is the power released by fission of the fuel in the core which is directly proportional to neutron flux. It was developed a digital system to simulate the neutron evolution flux and monitoring their interaction on the other operational parameters. The control objective is to bring the reactor power from its source level (mW) to a few W. It is intended for education of basic reactor neutronic principles such as the multiplication factor, criticality, reactivity, period, delayed neutron and control by rods. The 250 kW IPR-R1 TRIGA research reactor at Nuclear Technology Development Center - CDTN (Belo Horizonte/Brazil) was used as reference. TRIGA reactors, developed by General Atomics (GA), are the most widely used research reactor in the world. They are cooled by light water under natural convection and are characterized by being inherently safety. The simulation system was developed using the LabVIEW® (Laboratory Virtual Instruments Engineering Workbench) software, considering the modern concept of virtual instruments (VI's). The main purpose of the system is to provide to analyze the behavior, and the tendency of some processes that occur in the reactor using a user-friendly operator interface. The TRIGA simulator system will allow the study of parameters, which affect the reactor operation, without the necessity of using the facility.(author)