Best-estimate LOCA simulation in a PWR-W containment building with a detailed 3D GOTHIC model

International Nuclear Information System (INIS)

Jimenez, G.; Fernandez-Cosials, K.; Bocanegra, R.; Lopez-Alonso, E.

2015-01-01

The design-basis accidents in a PWR-W containment building are usually simulated with a lumped parameter model, normally used for license analysis. Nevertheless, some phenomenology is difficult to be simulated with a lumped model: the condensation rate in each structure, stagnant water areas, temperature in different compartments, sumps and recirculation pumps disabled because of lack of water, etc. Therefore, for the detailed study of the thermal-hydraulic (TH) behaviour in every room of the containment building could be more appropriate to do it with a detailed 3D representation of the containment building geometry. The main objective of this project has been to build a 3D PWR-W containment model with the GOTHIC code to analyze the detailed behavior during a design basis accident. In the process of the 3D GOTHIC model development some previous steps were necessary: a detailed CAD model of the containment, followed by a simplified model adapted to the GOTHIC geometric capabilities. Once the geometry has been adapted to the GOTHIC requirements, the 3D model is created with this information. A design-basis accident has been simulated with the 3D model (LBLOCA), and the local TH behaviour is analysed. The results show that in comparison with a lumped parameter model, high temperatures are reached locally. Nevertheless the average pressure behaviour is found to be similar to that given by a lumped parameter model. The present paper demonstrates that is possible to build a 3D PWR-W model with the GOTHIC code with enough resolution to analyse the TH behaviour in each one of the containment rooms but at the same time with reasonable computing time. Once the GOTHIC model has been created a new road is opened enabling the simulation of other accidents such as MSLB, a SBLOCA or even a long-term SBO sequence. This document is made up of an abstract and the slides of the presentation. (authors)

GeV C.W. electron microtron design report

International Nuclear Information System (INIS)

1982-05-01

Rising interest in the nuclear physics community in a GeV C.W. electron accelerator reflects the growing importance of high-resolution short-range nuclear physics to future advances in the field. In this report major current problems are reviewed and the details of prospective measurements which could be made with a GeV C.W. electron facility are discussed, together with their impact on an understanding of nuclear forces and the structure of nuclear matter. The microtron accelerator has been chosen as the technology to generate the electron beams required for the research discussed because of the advantages of superior beam quality, low capital and operating cost and capability of furnishing beams of several energies and intensities simultaneously. A complete technical description of the conceptual design for a 2 GeV double-sided C.W. electron microtron is presented. The accelerator can furnish three beams with independently controlled energy and intensity. The maximum current per beam is 100 μamps. Although the precise objective for maximum beam energy is still a subject of debate, the design developed in this study provides the base technology for microtron accelerators at higher energies (2 to 6 GeV) using multi-sided geometries

GeV C. W. electron microtron design report

Energy Technology Data Exchange (ETDEWEB)

1982-05-01

Rising interest in the nuclear physics community in a GeV C.W. electron accelerator reflects the growing importance of high-resolution short-range nuclear physics to future advances in the field. In this report major current problems are reviewed and the details of prospective measurements which could be made with a GeV C.W. electron facility are discussed, together with their impact on an understanding of nuclear forces and the structure of nuclear matter. The microtron accelerator has been chosen as the technology to generate the electron beams required for the research discussed because of the advantages of superior beam quality, low capital and operating cost and capability of furnishing beams of several energies and intensities simultaneously. A complete technical description of the conceptual design for a 2 GeV double-sided C.W. electron microtron is presented. The accelerator can furnish three beams with independently controlled energy and intensity. The maximum current per beam is 100 ..mu..amps. Although the precise objective for maximum beam energy is still a subject of debate, the design developed in this study provides the base technology for microtron accelerators at higher energies (2 to 6 GeV) using multi-sided geometries.

Design, performance, and economics of 50-kW and 500-kW vertical axis wind turbines

Science.gov (United States)

Schienbein, L. A.; Malcolm, D. J.

1983-11-01

A review of the development and performance of the DAF Indal 50-kW vertical axis Darrieus wind turbine shows that a high level of technical development and reliability has been achieved. Features of the drive train, braking and control systems are discussed and performance details are presented. Details are also presented of a 500-kW VAWT that is currently in production. A discussion of the economics of both the 50-kW and 500-kW VAWTs is included, showing the effects of charge rate, installed cost, operating cost, performance, and efficiency.

Test Results of a 200 W Class Hall Thruster

Science.gov (United States)

Jacobson, David; Jankovsky, Robert S.

1999-01-01

The performance of a 200 W class Hall thruster was evaluated. Performance measurements were taken at power levels between 90 W and 250 W. At the nominal 200 W design point, the measured thrust was 11.3 mN. and the specific impulse was 1170 s excluding cathode flow in the calculation. A laboratory model 3 mm diameter hollow cathode was used for all testing. The engine was operated on laboratory power supplies in addition to a breadboard power processing unit fabricated from commercially available DC to DC converters.

Conceptual design report, plutonium stabilization and handling,project W-460

Energy Technology Data Exchange (ETDEWEB)

Weiss, E.V.

1997-03-06

Project W-460, Plutonium Stabilization and Handling, encompasses procurement and installation of a Stabilization and Packaging System (SPS) to oxidize and package for long term storage remaining plutonium-bearing special nuclear materials currently in inventory at the Plutonium Finishing Plant (PFP), and modification of vault equipment to allow storage of resulting packages of stabilized SNM for up to fifty years. This Conceptual Design Report (CDR) provides conceptual design details for the vault modification, site preparation and site interface with the purchased SPS. Two concepts are described for vault configuration; acceleration of this phase of the project did not allow completion of analysis which would clearly identify a preferred approach.

W-Band Sheet Beam Klystron Design

International Nuclear Information System (INIS)

Scheitrum, G.; Caryotakis, G.; Burke, A.; Jensen, A.; Jongewaard, E.; Krasnykh, A.; Neubauer, M.; Phillips, R.; Rauenbuehler, K.

2011-01-01

Sheet beam devices provide important advantages for very high power, narrow bandwidth RF sources like accelerator klystrons (1). Reduced current density and increased surface area result in increased power capabi1ity, reduced magnetic fields for focusing and reduced cathode loading. These advantages are offset by increased complexity, beam formation and transport issues and potential for mode competition in the ovennoded cavities and drift tube. This paper will describe the design issues encountered in developing a 100 kW peak and 2 kW average power sheet beam k1ystron at W-band including beam formation, beam transport, circuit design, circuit fabrication and mode competition.

Designs of Langmuir probes for W7-X

International Nuclear Information System (INIS)

Laube, Ralph; Laux, Michael; Ye, Min You; Greuner, Henri; Lindig, Stefan

2011-01-01

Several designs of Langmuir probes for the stellarator Wendelstein 7-X (W7-X) are described. Different types of probes are proposed for the different divertors to be used during different operational phases of W7-X. Comb-like arrays of stiff probes, arrays of flexible probes, and fixed inlay probes are reviewed. For the initial phase of W7-X it was decided to install arrays of fixed inlay probes. Two mockups were manufactured and one of them was tested with success in the high heat flux test facility GLADIS. For long-pulse operation of W7-X different conceptual designs are proposed and are still developed further. This paper summarizes the different design constrains for the Langmuir probes in the different divertor surroundings, describes the design of the array of inlay probes for the initial phase and the result of the GLADIS test, and gives a preview of the conceptual designs of probes for the long-pulse operational phase of W7-X.

Design and component test performance of an efficient 4 W, 130 K sorption refrigerator

International Nuclear Information System (INIS)

Alvarez, J.; Ryba, E.; Sywulka, P.; Wade, L.

1990-01-01

A recent advance in sorption cooler technology has resulted in cryocooler designs offering high performance and the promise of long-life operation. A 4-W, 130 K sorption refrigeration stage which incorporates the advanced concept design is presently being constructed. Powdered charcoal is used as the sorbent, and methane is used as the refrigerant. Expansion is accomplished using a passive Joule-Thomson expansion valve. The design details of this cooler and the component performance test results are discussed. 5 refs

Development and installation in cell of generators of 113Sn/sup(113m)In in the Argentine National Atomic Energy Commission

International Nuclear Information System (INIS)

Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.

1978-05-01

The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es

Design study of wind turbines 50 kW to 3000 kW for electric utility applications. Volume 2: Analysis and design

Science.gov (United States)

1976-01-01

All possible overall system configurations, operating modes, and subsystem concepts for a wind turbine configuration for cost effective generation of electrical power were evaluated for both technical feasibility and compatibility with utility networks, as well as for economic attractiveness. A design optimization computer code was developed to determine the cost sensitivity of the various design features, and thus establish the configuration and design conditions that would minimize the generated energy costs. The preliminary designs of both a 500 kW unit and a 1500 kW unit operating in a 12 mph and 18 mph median wind speed respectively, were developed. The various design features and components evaluated are described, and the rationale employed to select the final design configuration is given. All pertinent technical performance data and component cost data is included. The costs of all major subassemblies are estimated and the resultant energy costs for both the 500 kW and 1500 kW units are calculated.

Design, performance and economics of the DAF Indal 50 kW and 375 kW vertical axis wind turbine

Science.gov (United States)

Schienbein, L. A.; Malcolm, D. J.

1982-03-01

A review of the development and performance of the DAF Indal 50 kW vertical axis Darrieus wind turbines shows that a high level of technical development and reliability has been achieved. Features of the drive train, braking and control systems are discussed and performance details are presented. A description is given of a wind-diesel hybrid presently being tested. Details are also presented of a 375 kW VAWT planned for production in late 1982. A discussion of the economics of both the 50 kW and 375 kW VAWTs is included, showing the effects of charge rate, installed cost, operating cost, performance and efficiency. The energy outputs are translated into diesel fuel cost savings for remote communities.

Contribution to a Theory of Detailed Design

DEFF Research Database (Denmark)

Mortensen, Niels Henrik

1999-01-01

It has been recognised, that literature actually do not propose a theory of detailed design. In this paper a theory contribution is proposed, linking part design to organ design and allowing a type of functional reasoning. The proposed theory satisfies our need for explaining the nature of a part...... structure, for support of synthesis of part structure, i.e. detailed design, and our need for digital modelling of part structures.The aim of this paper is to contribute to a design theory valid for detailed design. The proposal is based upon the theory's ability to explain the nature of machine parts...... and assemblies, to support the synthesis of parts and to allow the modelling, especially digital modelling of a part structure. The contribution is based upon Theory of Technical Systems, Hubka, and the Domain Theory, Andreasen. This paper is based on a paper presented at ICED 99, Mortensen, but focus...

33 CFR 136.113 - Other compensation.

Science.gov (United States)

2010-07-01

...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...

Design of Radial Inflow Turbine for 30 kW Microturbine

Directory of Open Access Journals (Sweden)

Sangsawangmatum Thanate

2017-01-01

Full Text Available Microturbines are small gas turbines that have the capacity range of 25-300 kW. The main components of microturbine are compressor, turbine, combustor and recuperator. This research paper focuses on the design of radial inflow turbine that operates in 30 kW microturbine. In order to operate the 30 kW microturbine with the back work ratio of 0.5, the radial inflow turbine should be designed to produce power at 60 kW. With the help of theory of turbo-machinery and the analytical methods, the design parameters are derived. The design results are constructed in 3D geometry. The 3D fluid-geometry is validated by computational fluid dynamics (CFD simulation. The simulation results show the airflow path, the temperature distribution, the pressure distribution and Mach number. According to the simulation results, there is no flow blockage between vanes and no shock flow occurs in the designed turbine.

Flexible power 90W to 120W ArF immersion light source for future semiconductor lithography

Science.gov (United States)

Burdt, R.; Thornes, J.; Duffey, T.; Bibby, T.; Rokitski, R.; Mason, E.; Melchior, J.; Aggarwal, T.; Haran, D.; Wang, J.; Rechtsteiner, G.; Haviland, M.; Brown, D.

2014-03-01

Semiconductor market demand for improved performance at lower cost continues to drive enhancements in excimer light source technologies. Increased output power, reduced variability in key light source parameters, and improved beam stability are required of the light source to support immersion lithography, multi-patterning, and 450mm wafer applications in high volume semiconductor manufacturing. To support future scanner needs, Cymer conducted a technology demonstration program to evaluate the design elements for a 120W ArFi light source. The program was based on the 90W XLR 600ix platform, and included rapid power switching between 90W and 120W modes to potentially support lot-to-lot changes in desired power. The 120W requirements also included improved beam stability in an exposure window conditionally reduced by 20%. The 120W output power is achieved by efficiency gains in system design, keeping system input power at the same level as the 90W XLR 600ix. To assess system to system variability, detailed system testing was conducted from 90W - 120W with reproducible results.

Study on Detailing Design of Precast Concrete Frame Structure

Science.gov (United States)

Lida, Tian; Liming, Li; Kang, Liu; Jiao, Geng; Ming, Li

2018-03-01

Taking a certain precast concrete frame structure as an example, this paper introduces the general procedures and key points in detailing design of emulative cast-in-place prefabricated structure from the aspects of structural scheme, precast element layout, shop drawing design and BIM 3D modelling. This paper gives a practical solution for the detailing design of precast concrete frame structure under structural design codes in China.

Design of W-Band photoinjector

International Nuclear Information System (INIS)

Zhu, Xiongwei; Nakajima, Kazuhisa

2000-01-01

We present a design study on W-Band photocathode RF gun which is capable of generating and accelerating 300 pC electron bunch. The design system is made up of 91.392 GHz photocathode RF gun and 91.392 GHz travelling wave linac cells. Based on the numerical simulation using SUPERFISH and PARMELA and the conventional RF linac scaling law, the design will produce 300 pC at 1.74 MeV with bunch length 0.72 ps and normalized tranverse emittance 0.5 mm mrad. We study the beam dynamics in high frequency and high gradient; due to the high gradient, the pondermotive effect plays an important role in beam dynamics; we found the pondermotive effect still exist with only the fundamental space harmonics (synchrotron mode) due to the coupling of the transverse and longitudinal motion. (author)

Structural concepts and details for seismic design

International Nuclear Information System (INIS)

Johnson, M.W.; Smietana, E.A.; Murray, R.C.

1991-01-01

As a part of the DOE Natural Phenomena Hazards Program, a new manual has been developed, entitled UCRL-CR-106554, open-quotes Structural Concepts and Details for Seismic Design.close quotes This manual describes and illustrates good practice for seismic-resistant design

Quality control of the 113Sn-113mIn generator

International Nuclear Information System (INIS)

Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.

1989-01-01

Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia

Detailed Design Documentation, without the Pain

Science.gov (United States)

Ramsay, C. D.; Parkes, S.

2004-06-01

Producing detailed forms of design documentation, such as pseudocode and structured flowcharts, to describe the procedures of a software system:(1) allows software developers to model and discuss their understanding of a problem and the design of a solution free from the syntax of a programming language,(2) facilitates deeper involvement of non-technical stakeholders, such as the customer or project managers, whose influence ensures the quality, correctness and timeliness of the resulting system,(3) forms comprehensive documentation of the system for its future maintenance, reuse and/or redeployment.However, such forms of documentation require effort to create and maintain.This paper describes a software tool which is currently being developed within the Space Systems Research Group at the University of Dundee which aims to improve the utility of, and the incentive for, creating detailed design documentation for the procedures of a software system. The rationale for creating such a tool is briefly discussed, followed by a description of the tool itself, a summary of its perceived benefits, and plans for future work.

47 CFR 15.113 - Power line carrier systems.

Science.gov (United States)

2010-10-01

....113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES Unintentional... shall submit the details of all existing systems plus any proposed new systems or changes to existing... operation on electric lines which connect the distribution substation to the customer or house wiring. Such...

Preventive effects of the novel antimicrobial peptide Nal-P-113 in a rat Periodontitis model by limiting the growth of Porphyromonas gingivalis and modulating IL-1β and TNF-α production.

Science.gov (United States)

Wang, Hong-Yan; Lin, Li; Fu, Wei; Yu, Hui-Yuan; Yu, Ning; Tan, Li-Si; Cheng, Jya-Wei; Pan, Ya-Ping

2017-08-29

P-113 (AKRHHGYKRKFH-NH2) is a 12-amino-acid histidine-rich peptide derived from histatin 5 that is highly degradable in high salt concentrations and biological fluids such as serum, plasma and saliva. Nal-P-113, a novel antimicrobial peptide whose histidine residues are replaced by the bulky amino acids β-naphthylalanine, causes the antimicrobial peptide to retain its bactericidal activity even in physiological environments. This study evaluated the effect of the novel antimicrobial peptide Nal-P-113 in a rat periodontitis model and the mechanisms of action of Nal-P-113 for suppressing periodontitis. Periodontitis was induced in mandibular first molars in rats receiving a ligature and infected with Porphyromonas gingivalis. Animals were randomly divided into six groups: a, P. gingivalis W83 alone; b, P. gingivalis W83 with 6.25 μg/mL of Nal-P-113; c, P. gingivalis W83 with 25 μg/mL of Nal-P-113; d, P. gingivalis W83 with 100 μg/mL of Nal-P-113; e, P. gingivalis W83 with 400 μg/mL of Nal-P-113; and f, control without P. gingivalis W83 or Nal-P-113. Morphometric analysis was used to evaluate alveolar bone loss. Microbiological assessment of the presence of Porphyromonas gingivalis and total bacteria was performed using absolute quantitative real-time PCR and scanning electron microscopy. Gingival tissue was collected for western blot and immunohistochemical assays of IL-1β and TNF-α levels. Alveolar bone loss was inhibited by 100 μg/mL or 400 μg/mL of Nal-P-113 compared to the control group (P periodontal tissue (P periodontitis in rats by limiting the amount of bacteria and modulating IL-1β and TNF-α production. The use of Nal-P-113 in vivo might serve as a beneficial preventive or therapeutic approach for periodontitis.

Project W-420 Stack Monitoring system upgrades conceptual design report

International Nuclear Information System (INIS)

TUCK, J.A.

1998-01-01

This document describes the scope, justification, conceptual design, and performance of Project W-420 stack monitoring system upgrades on six NESHAP-designated, Hanford Tank Farms ventilation exhaust stacks

Project W-420 Stack Monitoring system upgrades conceptual design report

Energy Technology Data Exchange (ETDEWEB)

TUCK, J.A.

1998-11-06

This document describes the scope, justification, conceptual design, and performance of Project W-420 stack monitoring system upgrades on six NESHAP-designated, Hanford Tank Farms ventilation exhaust stacks.

Detailed design report for an operational phase panel-closure system

International Nuclear Information System (INIS)

1996-01-01

Under contract to Westinghouse Electric Corporation (Westinghouse), Waste Isolation Division (WID), IT Corporation has prepared a detailed design of a panel-closure system for the Waste Isolation Pilot Plant (WIPP). Preparation of this detailed design of an operational-phase closure system is required to support a Resource Conservation and Recovery Act (RCRA) Part B permit application and a non-migration variance petition. This report describes the detailed design for a panel-closure system specific to the WIPP site. The recommended panel-closure system will adequately isolate the waste-emplacement panels for at least 35 years. This report provides detailed design and material engineering specifications for the construction, emplacement, and interface-grouting associated with a panel-closure system at the WIPP repository, which would ensure that an effective panel-closure system is in place for at least 35 years. The panel-closure system provides assurance that the limit for the migration of volatile organic compounds (VOC) will be met at the point of compliance, the WIPP site boundary. This assurance is obtained through the inherent flexibility of the panel-closure system

Detailed investigation of the gamma-ray emission in the vicinity of SNR W28 with Fermi-LAT

Energy Technology Data Exchange (ETDEWEB)

Hanabata, Y. [Institute for Cosmic-Ray Research, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8582 (Japan); Katagiri, H. [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Hewitt, J.W. [CRESST, University of Maryland, Baltimore County, Baltimore, MD 21250 (United States); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d' Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Fukazawa, Y. [Department of Physical Sciences, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Fukui, Y.; Hayakawa, T. [Department of Physics and Astrophysics, Nagoya University, Chikusa-ku Nagoya 464-8602 (Japan); Lemoine-Goumard, M. [Centre d' Études Nucléaires de Bordeaux Gradignan, IN2P3/CNRS, Université Bordeaux 1, BP120, F-33175 Gradignan Cedex (France); Pedaletti, G.; Torres, D. F. [Institut de Ciències de l' Espai (IEEE-CSIC), Campus UAB, 08193 Barcelona (Spain); Strong, A. W. [Max-Planck Institut für extraterrestrische Physik, D-85748 Garching (Germany); Yamazaki, R., E-mail: hanabata@icrr.u-tokyo.ac.jp, E-mail: katagiri@mx.ibaraki.ac.jp [Department of Physics and Mathematics, Aoyama Gakuin University, Sagamihara, Kanagawa 252-5258 (Japan)

2014-05-10

We present a detailed investigation of the γ-ray emission in the vicinity of the supernova remnant (SNR) W28 (G6.4–0.1) observed by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. We detected significant γ-ray emission spatially coincident with TeV sources HESS J1800–240A, B, and C, located outside the radio boundary of the SNR. Their spectra in the 2-100 GeV band are consistent with the extrapolation of the power-law spectra of the TeV sources. We also identified a new source of GeV emission, dubbed Source W, which lies outside the boundary of TeV sources and coincides with radio emission from the western part of W28. All of the GeV γ-ray sources overlap with molecular clouds in the velocity range from 0 to 20 km s{sup –1}. Under the assumption that the γ-ray emission toward HESS J1800–240A, B, and C comes from π{sup 0} decay due to the interaction between the molecular clouds and cosmic rays (CRs) escaping from W28, they can be naturally explained by a single model in which the CR diffusion coefficient is smaller than the theoretical expectation in the interstellar space. The total energy of the CRs escaping from W28 is constrained through the same modeling to be larger than ∼2 × 10{sup 49} erg. The emission from Source W can also be explained with the same CR escape scenario.

Detailed investigation of the gamma-ray emission in the vicinity of SNR W28 with Fermi-LAT

International Nuclear Information System (INIS)

Hanabata, Y.; Katagiri, H.; Hewitt, J.W.; Ballet, J.; Fukazawa, Y.; Fukui, Y.; Hayakawa, T.; Lemoine-Goumard, M.; Pedaletti, G.; Torres, D. F.; Strong, A. W.; Yamazaki, R.

2014-01-01

We present a detailed investigation of the γ-ray emission in the vicinity of the supernova remnant (SNR) W28 (G6.4–0.1) observed by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. We detected significant γ-ray emission spatially coincident with TeV sources HESS J1800–240A, B, and C, located outside the radio boundary of the SNR. Their spectra in the 2-100 GeV band are consistent with the extrapolation of the power-law spectra of the TeV sources. We also identified a new source of GeV emission, dubbed Source W, which lies outside the boundary of TeV sources and coincides with radio emission from the western part of W28. All of the GeV γ-ray sources overlap with molecular clouds in the velocity range from 0 to 20 km s –1 . Under the assumption that the γ-ray emission toward HESS J1800–240A, B, and C comes from π 0 decay due to the interaction between the molecular clouds and cosmic rays (CRs) escaping from W28, they can be naturally explained by a single model in which the CR diffusion coefficient is smaller than the theoretical expectation in the interstellar space. The total energy of the CRs escaping from W28 is constrained through the same modeling to be larger than ∼2 × 10 49 erg. The emission from Source W can also be explained with the same CR escape scenario.

Supplemental design requirements document enhanced radioactive and mixed waste storage Phase V Project W-112

International Nuclear Information System (INIS)

Ocampo, V.P.; Boothe, G.F.; Greager, T.M.; Johnson, K.D.; Kooiker, S.L.; Martin, J.D.

1994-11-01

This document provides additional and supplemental information to WHC-SD-W112-FDC-001, Project W-112 for radioactive and mixed waste storage. It provides additional requirements for the design and summarizes Westinghouse Hanford Company key design guidance and establishes the technical baseline agreements to be used for definitive design of the Project W-112 facilities

Quality system target on a detail design activity irradiator ISG 500

International Nuclear Information System (INIS)

Reinhard Pardede

2010-01-01

Currently, an engineering team of Nuclear Equipment Engineering Center PRPN has been beening technology innovation detail design of Irradiator ISG 500, then enter continuing to a construction phase. A schedule detail design still being not finish yet. The installation of Irradiator ISG 500 will be used to preservative the result of agricultural product in Indonesia. It is known as an export commodity and row material for food. However, its quality need some improvements in order to meet internal and foreign consumer standard. To enhance a quality system in detail design phase has already used ISO 9001: 2008 on clausul-7: Product Realization-design. It also needs a radioactive regulation Bapeten-Indonesian Nuclear Energy Surveillance Agency compliance with IAEA GS-R 3: 2006 as well. Scope of activity design is Instrumentation and Control system; Mechanical- Electrical; Radiation and Safety and Dosimetry; Civil Structured; Quality Assurance and Technoeconomic. Technology Innovating be applied to achieved economics through Costumer and Market Focused. Gamma irradiation of Irradiator ISG 500 can be used to improve hygienic quality in terms of technological as well as economical aspects. Technology innovation fit with the state of the arts right now. Assessment should be done base not only internal audit but also monitoring and surveillance as well. By application of a Quality System on detail design activity hopefully to enhance quality on detail design, construction, more over irradiator operation. (author)

A W Joshi

Indian Academy of Sciences (India)

What can we Learn from the Electromagnetic Spectrum? A W Joshi Alok Kumar · More Details Fulltext PDF. Volume 8 Issue 7 July 2003 pp 76-84 Classroom. Simple, Concept-Centred, Innovative, Open-Ended Experiments in Physics – 1 · A W Joshi Vijay H Raybagkar F I Surve · More Details Fulltext PDF. Volume 8 Issue 9 ...

Thermal-hydraulic analysis best-estimate of an accident in the containment a PWR-W reactor with GOTHIC code using a 3D model detailed; Analisis termo-hidraulico best-estimate de un accidente en contencion de un reactor PWR-W con el codigo GOTHIC mediante un modelo 3D detallado

Energy Technology Data Exchange (ETDEWEB)

Bocanegra, R.; Jimenez, G.

2013-07-01

The objective of this project will be a model of containment PWR-W with the GOTHIC code that allows analyzing the behavior detailed after a design basis accident or a severe accident. Unlike the models normally used in codes of this type, the analysis will take place using a three-dimensional model of the containment, being this much more accurate.

Detailed design of product oriented manufacturing systems

OpenAIRE

Silva, Sílvio Carmo; Alves, Anabela Carvalho

2006-01-01

This paper presents a procedure for the detailed design and redesign of manufacturing systems within a framework of constantly fitting production system configuration to the varying production needs of products. With such an approach is achieved the design of Product Oriented Manufacturing Systems – POMS. This approach is in opposition to the fitting, before hand, of a production system to all products within a company. In this case is usual to adopt a Function Oriented Manufactur...

Design study of wind turbines 50 kW to 3000 kW for electric utility applications. Volume 1: Summary report

Science.gov (United States)

1976-01-01

Wind turbine configurations that would lead to generation of electrical power in a cost effective manner were considered. All possible overall system configurationss, operating modes, and sybsystem concepts were evaluated for both technical feasibility and compatibility with utility networks, as well as for economic attractiveness. A design optimization computer code was developed to determine the cost sensitivity of the various design features, and thus establish the configuration and design conditions that would minimize the generated energy costs. The preliminary designs of both a 500 kW unit and a 1500 kW unit operating in a 12 mph and 18 mph median wind speed respectively, were developed. The rationale employed and the key findings are summarized.

Design of 28 GHz, 200 kW Gyrotron for ECRH Applications

Science.gov (United States)

Yadav, Vivek; Singh, Udaybir; Kumar, Nitin; Kumar, Anil; Deorani, S. C.; Sinha, A. K.

2013-01-01

This paper presents the design of 28 GHz, 200 kW gyrotron for Indian TOKAMAK system. The paper reports the designs of interaction cavity, magnetron injection gun and RF window. EGUN code is used for the optimization of electron gun parameters. TE03 mode is selected as the operating mode by using the in-house developed code GCOMS. The simulation and optimization of the cavity parameters are carried out by using the Particle-in-cell, three dimensional (3-D)-electromagnetic simulation code MAGIC. The output power more than 250 kW is achieved.

13 CFR 113.310 - Recruitment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...

Preliminary Design Requirements Document for Project W-314

Energy Technology Data Exchange (ETDEWEB)

MCGREW, D.L.

2000-04-27

This document sets forth functional requirements, performance requirements, and design constraints for the tank farm systems elements identified in Section 3.1 of this document. These requirements shall be used to develop the Design Requirements Baseline for those system elements. System Overview--The tank farm system at Hanford Site currently consists of 149 single shell tanks and 28 double shell tanks with associated facilities and equipment, located in 18 separate groupings. Each grouping is known as a tank farm. They are located in the areas designated as 200 West and 200 East. Table 1-1 shows the number of tanks in each farm. The farms are connected together through a transfer system consisting of piping, diversion boxes, Double Contained Receiver Tanks (DCRT) and other miscellaneous facilities and elements. The tank farm system also connects to a series of processing plants which generate radioactive and hazardous wastes. The primary functions of the tank farm system are to store, transfer, concentrate, and characterize radioactive and hazardous waste generated at Hanford, until the waste can be safely retrieved, processed and dispositioned. The systems provided by Project W-314 support the store and transfer waste functions. The system elements to be upgraded by Project W-314 are identified in Section 3.1.

Preliminary Design Requirements Document for Project W-314

International Nuclear Information System (INIS)

MCGREW, D.L.

2000-01-01

This document sets forth functional requirements, performance requirements, and design constraints for the tank farm systems elements identified in Section 3.1 of this document. These requirements shall be used to develop the Design Requirements Baseline for those system elements. System Overview--The tank farm system at Hanford Site currently consists of 149 single shell tanks and 28 double shell tanks with associated facilities and equipment, located in 18 separate groupings. Each grouping is known as a tank farm. They are located in the areas designated as 200 West and 200 East. Table 1-1 shows the number of tanks in each farm. The farms are connected together through a transfer system consisting of piping, diversion boxes, Double Contained Receiver Tanks (DCRT) and other miscellaneous facilities and elements. The tank farm system also connects to a series of processing plants which generate radioactive and hazardous wastes. The primary functions of the tank farm system are to store, transfer, concentrate, and characterize radioactive and hazardous waste generated at Hanford, until the waste can be safely retrieved, processed and dispositioned. The systems provided by Project W-314 support the store and transfer waste functions. The system elements to be upgraded by Project W-314 are identified in Section 3.1

Radioactive contamination mapping system detailed design report

International Nuclear Information System (INIS)

Bauer, R.G.; O'Callaghan, P.B.

1996-08-01

The Hanford Site's 100 Area production reactors released radioactively and chemically contaminated liquids into the soil column. The primary source of the contaminated liquids was reactor coolant and various waste waters released from planned liquid discharges, as well as pipelines, pipe junctions, and retention basins leaking into the disposal sites. Site remediation involves excavating the contaminated soils using conventional earthmoving techniques and equipment, treating as appropriate, transporting the soils, and disposing the soils at ERDF. To support remediation excavation, disposal, and documentation requirements, an automated radiological monitoring system was deemed necessary. The RCMS (Radioactive Contamination Mapping System) was designed to fulfill this need. This Detailed Design Report provides design information for the RCMS in accordance with Bechtel Hanford, Inc. Engineering Design Project Instructions

study on 113 Sn-113m In generator of the chromatographic column elution mode

International Nuclear Information System (INIS)

Abdel-Halim, A.A.

2002-01-01

this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days

Effect of impurities on the growth of {113} interstitial clusters in silicon under electron irradiation

Science.gov (United States)

Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.

2011-01-01

The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucleated uniformly throughout the specimen without incubation, and began to shrink under prolonged irradiation at higher electron beam intensity. At lower beam intensity, however, the {113} interstitial cluster grew stably. These results demonstrate that the {113} interstitial cluster cannot grow without a continuous supply of impurities during electron irradiation. Detailed kinetics of {113} interstitial cluster growth and shrinkage in silicon, including the effects of impurities, are proposed. Then, experimental results are analyzed using rate equations based on these kinetics.

From the components to the stack. Developing and designing 5kW HT-PEFC stacks; Von der Komponente zum Stack. Entwicklung und Auslegung von HT-PEFC-Stacks der 5 kW-Klasse

Energy Technology Data Exchange (ETDEWEB)

Bendzulla, Anne

2010-12-22

The aim of the present project is to develop a stack design for a 5-kW HTPEFC system. First, the state of the art of potential materials and process designs will be discussed for each component. Then, using this as a basis, three potential stack designs with typical attributes will be developed and assessed in terms of practicality with the aid of a specially derived evaluation method. Two stack designs classified as promising will be discussed in detail, constructed and then characterized using short stack tests. Comparing the stack designs reveals that both designs are fundamentally suitable for application in a HT-PEFC system with on-board supply. However, some of the performance data differ significantly for the two stack designs. The preferred stack design for application in a HT-PEFC system is characterized by robust operating behaviour and reproducible high-level performance data. Moreover, in compact constructions (120 W/l at 60 W/kg), the stack design allows flexible cooling with thermal oil or air, which can be adapted to suit specific applications. Furthermore, a defined temperature gradient can be set during operation, allowing the CO tolerance to be increased by up to 10 mV. The short stack design developed within the scope of the present work therefore represents an ideal basis for developing a 5-kW HT-PEFC system. Topics for further research activities include improving the performance by reducing weight and/or volume, as well as optimizing the heat management. The results achieved within the framework of this work clearly show that HTPEFC stacks have the potential to play a decisive role in increasing efficiency in the future, particularly when combined with an on-board supply system. (orig.) [German] Ziel der vorliegenden Arbeit ist die Entwicklung eines Stackkonzeptes fuer ein 5 kW-HT-PEFC System. Dazu wird zunaechst fuer jede Komponente der Stand der Technik moeglicher Materialien und Prozesskonzepte diskutiert. Darauf aufbauend werden drei

Combined preliminary–detailed design of wind turbines

Directory of Open Access Journals (Sweden)

P. Bortolotti

2016-05-01

Full Text Available This paper is concerned with the holistic optimization of wind turbines. A multi-disciplinary optimization procedure is presented that marries the overall sizing of the machine in terms of rotor diameter and tower height (often termed “preliminary design” with the detailed sizing of its aerodynamic and structural components. The proposed combined preliminary–detailed approach sizes the overall machine while taking into full account the subtle and complicated couplings that arise due to the mutual effects of aerodynamic and structural choices. Since controls play a central role in dictating performance and loads, control laws are also updated accordingly during optimization. As part of the approach, rotor and tower are sized simultaneously, even in this case capturing the mutual effects of one component over the other due to the tip clearance constraint. The procedure, here driven by detailed models of the cost of energy, results in a complete aero-structural design of the machine, including its associated control laws. The proposed methods are tested on the redesign of two wind turbines, a 2.2 MW onshore machine and a large 10 MW offshore one. In both cases, the optimization leads to significant changes with respect to the initial baseline configurations, with noticeable reductions in the cost of energy. The novel procedures are also exercised on the design of low-induction rotors for both considered wind turbines, showing that they are typically not competitive with conventional high-efficiency rotors.

Design And Construction Of 300W Audio Power Amplifier For Classroom

Directory of Open Access Journals (Sweden)

Shune Lei Aung

2015-07-01

Full Text Available Abstract This paper describes the design and construction of 300W audio power amplifier for classroom. In the construction of this amplifier microphone preamplifier tone preamplifier equalizer line amplifier output power amplifier and sound level indicator are included. The output power amplifier is designed as O.C.L system and constructed by using Class B among many types of amplifier classes. There are two types in O.C.L system quasi system and complementary system. Between them the complementary system is used in the construction of 300W audio power amplifier. The Multisim software is utilized for the construction of audio power amplifier.

Holistyczne kompetencje zawodowe studentów pielęgniarskich studiów magisterskich = The holistic nursing professional competence of students graduate

OpenAIRE

Brodowicz-Król, Magdalena; Zarzycka, Danuta; Stadnicka, Sabina; Bartoń, Elżbieta

2016-01-01

Brodowicz-Król Magdalena, Zarzycka Danuta, Stadnicka Sabina, Bartoń Elżbieta. Holistyczne kompetencje zawodowe studentów pielęgniarskich studiów magisterskich = The holistic nursing professional competence of students graduate. Journal of Education, Health and Sport. 2016;6(8):113-127. eISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.59880 http://ojs.ukw.edu.pl/index.php/johs/article/view/3736 The journal has had 7 points in Ministry of Science and Higher Educat...

Transient heat transfer phenomena of the liquid metal layer cooled by overlying R113 coolant

International Nuclear Information System (INIS)

Cho, J. S.; Seo, K. R.; Jung, C. H.; Park, R. J.; Kim, S. B.

1999-01-01

To understand the fundamental relationship of the natural convection heat transfer in the molten metal pool and the boiling mechanism of the overlying coolant, experiments were performed for the transient heat transfer of the liquid metal pool with overlying R113 coolant with boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 deg C. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted by changing the bottom surface boundary condition. The bottom heating condition was varied from 8kW to 14kW. As a result the boiling mechanism of the R113 coolant is changed from the nuclear boiling to film boiling. The Nusselt number and the Rayleigh number in the molten metal pool region obtained as functions of time. Analysis was made for the relationship between the heat flux and the temperature difference of the metal layer surface temperature and the boiling coolant bulk temperature

Cost model relationships between textile manufacturing processes and design details for transport fuselage elements

Science.gov (United States)

Metschan, Stephen L.; Wilden, Kurtis S.; Sharpless, Garrett C.; Andelman, Rich M.

1993-01-01

Textile manufacturing processes offer potential cost and weight advantages over traditional composite materials and processes for transport fuselage elements. In the current study, design cost modeling relationships between textile processes and element design details were developed. Such relationships are expected to help future aircraft designers to make timely decisions on the effect of design details and overall configurations on textile fabrication costs. The fundamental advantage of a design cost model is to insure that the element design is cost effective for the intended process. Trade studies on the effects of processing parameters also help to optimize the manufacturing steps for a particular structural element. Two methods of analyzing design detail/process cost relationships developed for the design cost model were pursued in the current study. The first makes use of existing databases and alternative cost modeling methods (e.g. detailed estimating). The second compares design cost model predictions with data collected during the fabrication of seven foot circumferential frames for ATCAS crown test panels. The process used in this case involves 2D dry braiding and resin transfer molding of curved 'J' cross section frame members having design details characteristic of the baseline ATCAS crown design.

Design of 500kW grate fired test facility using CFD

DEFF Research Database (Denmark)

Rosendahl, Lasse Aistrup; Kær, Søren Knudsen; Jørgensen, K.

2005-01-01

A 500kW vibrating grate fired test facility for solid biomass fuels has been designed using numerical models including CFD. The CFD modelling has focussed on the nozzle layout and flowpatterns in the lower part of the furnace, and the results have established confidence in the chosen design...

Project W-441 cold vacuum drying facility design requirements document

International Nuclear Information System (INIS)

O'Neill, C.T.

1997-01-01

This document has been prepared and is being released for Project W-441 to record the design basis for the design of the Cold Vacuum Drying Facility. This document sets forth the physical design criteria, Codes and Standards, and functional requirements that were used in the design of the Cold Vacuum Drying Facility. This document contains section 3, 4, 6, and 9 of the Cold Vacuum Drying Facility Design Requirements Document. The remaining sections will be issued at a later date. The purpose of the Facility is to dry, weld, and inspect the Multi-Canister Overpacks before transport to dry storage

Project W-236A, work plan for preparation of a design requirements document

International Nuclear Information System (INIS)

Groth, B.D.

1995-01-01

This work plan outlines the tasks necessary, and defines the organizational responsibilities for preparing a Design Requirements Document (DRD) for project W-236A, Multi-Function Waste Tank Facility (MWTF). A DRD is a Systems Engineering document which bounds, at a high level, the requirements of a discrete system element of the Tank Waste Remediation System (TWRS) Program. This system element is usually assigned to a specific project, in this case the MWTF. The DRD is the document that connects the TWRS program requirements with the highest level projects requirements and provides the project's link to the overall TWRS mission. The MWTF DRD effort is somewhat unique in that the project is already in detailed design, whereas a DRO is normally prepared prior to preliminary design. The MWTF design effort was initiated with a Functional Design Criteria (FDC) and a Supplemental Design Requirements Document (SDRD) bounding the high level requirements. Another unique aspect of this effort is that some of the TWRS program requirements are still in development. Because of these unique aspects of the MWTF DRD development, the MWTF will be developed from existing TWRS Program requirements and project specific requirements contained in the FDC and SDRD. The following list describes the objectives of the MWTF DRD: determine the primary functions of the tanks through a functional decomposition of the TWRS Program high level functions; allocate the primary functions to a sub-system architecture for the tanks; define the fundamental design features in terms of performance requirements for the system and subsystems; identify system interfaces and design constraints; and document the results in a DRD

7 CFR 1220.113 - Marketing.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...

32 CFR 724.113 - Application.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...

A 200-kW wind turbine generator conceptual design study

Science.gov (United States)

1979-01-01

A conceptual design study was conducted to define a 200 kW wind turbine power system configuration for remote applications. The goal was to attain an energy cost of 1 to 2 cents per kilowatt-hour at a 14-mph site (mean average wind velocity at an altitude of 30 ft.) The costs of the Clayton, New Mexico, Mod-OA (200-kW) were used to identify the components, subsystems, and other factors that were high in cost and thus candidates for cost reduction. Efforts devoted to developing component and subsystem concepts and ideas resulted in a machine concept that is considerably simpler, lighter in weight, and lower in cost than the present Mod-OA wind turbines. In this report are described the various innovations that contributed to the lower cost and lighter weight design as well as the method used to calculate the cost of energy.

w zhang

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. W ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 51. Effect of oxygen vacancies on Li-storage of anatase TiO 2 (001) facets: a first principles study · H CHEN Y H DING X Q TANG W ZHANG J R YIN P ZHANG Y JIANG · More Details ...

42 CFR 66.113 - Publications.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...

Performance of a 250 kW Organic Rankine Cycle System for Off-Design Heat Source Conditions

Directory of Open Access Journals (Sweden)

Ben-Ran Fu

2014-06-01

Full Text Available An organic Rankine cycle system comprised of a preheater, evaporator, condenser, turbine, generator, and pump was used to study its off-design performance and the operational control strategy. R245fa was used as the working fluid. Under the design conditions, the net power output is 243 kW and the system thermal efficiency is 9.5%. For an off-design heat source flow rate (mW, the operating pressure was controlled to meet the condition that the R245fa reached the liquid and vapor saturation states at the outlet of the preheater and the evaporator, respectively. The analytical results demonstrated that the operating pressure increased with increasing mW; a higher mW yielded better heat transfer performance of the preheater and required a smaller evaporator heat capacity, and the net power output and system thermal efficiency increased with increasing mW. For the range of mW studied here, the net power output increased by 64.0% while the total heat transfer rate increased by only 9.2%. In summary, off-design operation of the system was examined for a heat source flow rate which varied by –39.0% to +78.0% from the designed rate, resulting in –29.2% to +16.0% and –25.3% to +12.6% variations in the net power output and system thermal efficiency, respectively.

Experimental design: Case studies of diagnostics optimization for W7-X

International Nuclear Information System (INIS)

Dreier, H.; Dinklage, A.; Fischer, R.; Hartfuss, H.-J.; Hirsch, M.; Kornejew, P.; Pasch, E.; Turkin, Yu.

2005-01-01

The preparation of diagnostics for Wendelstein 7-X is accompanied by diagnostics simulations and optimization. Starting from the physical objectives, the design of diagnostics should incorporate predictive modelling (e.g. transport modelling) and simulations of respective measurements. Although technical constraints are governing design considerations, it appears that several design parameters of different diagnostics can be optimized. However, a general formulation for fusion diagnostics design in terms of optimization is lacking. In this paper, first case studies of Bayesian experimental design aiming at applications on W7-X diagnostics preparation are presented. The information gain of a measurement is formulated as a utility function which is expressed in terms of the Kullback-Leibler divergence. Then, the expected range of data is to be included and the resulting expected utility represents the objective for optimization. Bayesian probability theory gives a framework allowing us for an appropriate formulation of the design problem in terms of probability distribution functions. Results are obtained for the information gain from interferometry and for the design of polychromators for Thomson scattering. For interferometry, studies of the choice of line-of-sights for optimum signal and for the reproduction of gradient positions are presented for circular, elliptical and W7-X geometries. For Thomson scattering, the design of filter transmissions for density and temperature measurements are discussed. (author)

28 CFR 551.113 - Counseling.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...

W-geometry

International Nuclear Information System (INIS)

Hull, C.M.

1993-01-01

The geometric structure of theories with gauge fields of spins two and higher should involve a higher spin generalisation of Riemannian geometry. Such geometries are discussed and the case of W ∝ -gravity is analysed in detail. While the gauge group for gravity in d dimensions is the diffeomorphism group of the space-time, the gauge group for a certain W-gravity theory (which is W ∝ -gravity in the case d=2) is the group of symplectic diffeomorphisms of the cotangent bundle of the space-time. Gauge transformations for W-gravity gauge fields are given by requiring the invariance of a generalised line element. Densities exist and can be constructed from the line element (generalising √detg μν ) only if d=1 or d=2, so that only for d=1,2 can actions be constructed. These two cases and the corresponding W-gravity actions are considered in detail. In d=2, the gauge group is effectively only a subgroup of the symplectic diffeomorphisms group. Some of the constraints that arise for d=2 are similar to equations arising in the study of self-dual four-dimensional geometries and can be analysed using twistor methods, allowing contact to be made with other formulations of W-gravity. While the twistor transform for self-dual spaces with one Killing vector reduces to a Legendre transform, that for two Killing vectors gives a generalisation of the Legendre transform. (orig.)

21 CFR 113.60 - Containers.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...

The study of the reaction e+e-→W+W-

International Nuclear Information System (INIS)

Blondel, A.; Raimondi, P.; Schlatter, W.

1987-01-01

The reaction e + e - →W + W - provides an unique opportunity to test some important aspects of the Standard Model. After a review of the basic relevant measurements, data are presented which simulate the performance of LEP detectors for this process around 95 GeV beam energy. Of particular interest are measurements of the W helicity providing new information on the process. The role of beam polarization is discussed in some detail. 32 figs; 15 refs

13 CFR 113.405 - Housing.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

13 CFR 113.500 - Employment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...

21 CFR 163.113 - Cocoa.

Science.gov (United States)

2010-04-01

... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...

23 CFR 660.113 - Construction.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...

14 CFR 1240.113 - Financial accounting.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...

48 CFR 49.113 - Cost principles.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...

Dicty_cDB: CHC113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

42 CFR 56.113 - Grantee accountability.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...

Technical basis for the ITER detailed design report, cost review and safety analysis (DDR)

International Nuclear Information System (INIS)

1997-01-01

The ITER Detailed Design Report (DDR), Cost Review and Safety Analysis is the 3rd major milestone representing the progress made in the ITER Engineering Design Activities. With the approval of the Interim Design Report (IDR), it has been possible to freeze the main concepts and system approaches for ITER and to develop the design in more detail for the individual components and sub-systems. This report, although designed to be fully understandable as a separate document, focusses particularly on the main changes since the IDR

Thermal analysis of a conceptual design for a 250 W(e) GPHS/FPSE space power system

International Nuclear Information System (INIS)

Mccomas, T.J.; Dugan, E.T.

1991-01-01

A thermal analysis has been performed for a 250-W(e) space nuclear power system which combines the US Department of Energy's general purpose heat source (GPHS) modules with a state-of-the-art free-piston Stirling engine (FPSE). The focus of the analysis is on the temperature of the indium fuel clad within the GPHS modules. The thermal analysis results indicate fuel clad temperatures slightly higher than the design goal temperature of 1573 K. The results are considered favorable due to numerous conservative assumptions used. To demonstrate the effects of the conservatism, a brief sensitivity analysis is performed in which a few of the key system parameters are varied to determine their effect on the fuel clad temperatures. It is shown that thermal analysis of a more detailed thermal mode should yield fuel clad temperatures below 1573 K. 3 refs

Design of 20 W fiber-coupled green laser diode by Zemax

Science.gov (United States)

Qi, Yunfei; Zhao, Pengfei; Wu, Yulong; Chen, Yongqi; Zou, Yonggang

2017-09-01

We represent a design of a 20 W, fiber-coupled diode laser module based on 26 single emitters at 520 nm. The module can produce more than 20 W output power from a standard fiber with core diameter of 400 μm and numerical aperture (NA) of 0.22. To achieve a 20 W laser beam, the spatial beam combination and polarization beam combination by polarization beam splitter are used to combine output of 26 single emitters into a single beam, and then an aspheric lens is used to couple the combined beam into an optical fiber. The simulation shows that the total coupling efficiency is more than 95%. Project supported by the National Key R& D Program of China (No. 2016YFB0402105), the Key Deployment Program of the Chinese Academy of Sciences (No. KGZD-SW-T01-2), and the National Natural Science Foundation of China (No. 61404135).

24 CFR 27.113 - Foreclosure costs.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...

10 CFR 71.113 - Document control.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...

Technical basis for the ITER detailed design report, cost review and safety analysis (DDR)

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

The ITER Detailed Design Report (DDR), Cost Review and Safety Analysis is the 3rd major milestone representing the progress made in the ITER Engineering Design Activities. With the approval of the Interim Design Report (IDR), it has been possible to freeze the main concepts and system approaches for ITER and to develop the design in more detail for the individual components and sub-systems. This report, although designed to be fully understandable as a separate document, focusses particularly on the main changes since the IDR. Refs, figs, tabs

Generator 113Sn- 113mIn. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds

International Nuclear Information System (INIS)

Adan, L.; Rebollo, D. V.

1978-01-01

The design for the construction of a generator 113 S n -113m l n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs

9 CFR 113.7 - Multiple fractions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...

49 CFR 194.113 - Information summary.

Science.gov (United States)

2010-10-01

... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...

Project W-314 specific test and evaluation plan 241-AN-B valve pit

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-B Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

19 CFR 113.35 - Individual sureties.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...

7 CFR 1710.113 - Loan security.

Science.gov (United States)

2010-01-01

... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...

Dicty_cDB: VFB113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

Radiative corrections to e+e- → W+W- in the Weinberg model

NARCIS (Netherlands)

Veltman, M.J.G.; Lemoine, M.

1980-01-01

The one-loop radiation corrections to the process e+e- ->W+W- are calculated in the Weinberg model. The corrections are computed in a c.m. energy range of 180-1000 GeV. The dependence on the Higgs mass is studied in detail; it is found that variations in the Higgs mass from 10-1000 GeV give rise

Design study of wind turbines 50 kW to 3000 kW for electric utility applications. Volume 3: Supplementary design and analysis tasks

Science.gov (United States)

1976-01-01

Additional design and analysis data are provided to supplement the results of the two parallel design study efforts. The key results of the three supplemental tasks investigated are: (1) The velocity duration profile has a significant effect in determining the optimum wind turbine design parameters and the energy generation cost. (2) Modest increases in capacity factor can be achieved with small increases in energy generation costs and capital costs. (3) Reinforced concrete towers that are esthetically attractive can be designed and built at a cost comparable to those for steel truss towers. The approach used, method of analysis, assumptions made, design requirements, and the results for each task are discussed in detail.

38 CFR 75.113 - Data breach.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...

Physics design of a 10 MeV, 6 kW travelling wave electron linac for industrial applications

International Nuclear Information System (INIS)

Kulkarni, Nita S.; Dhingra, Rinky; Kumar, Vinit

2016-01-01

We present the physics design of a 10 MeV, 6 kW S-band (2856 MHz) electron linear accelerator (linac), which has been recently built and successfully operated at Raja Ramanna Centre for Advanced Technology, Indore. The accelerating structure is a 2π/3 mode constant impedance travelling wave structure, which comprises travelling wave buncher cells, followed by regular accelerating cells. The structure is designed to accelerate 50 keV electron beam from the electron gun to 10 MeV. This paper describes the details of electromagnetic design simulations to fix the mechanical dimensions and tolerances, as well as heat loss calculations in the structure. Results of design simulations have been compared with those obtained using approximate analytical formulae. The beam dynamics simulation with space charge is performed and the required magnetic field profile for keeping the beam focussed in the linac has been evaluated and discussed. An important feature of a travelling wave linac (in contrast with standing wave linac) is that it accepts the RF power over a band of frequencies. Three dimensional transient simulations of the accelerating structure along with the input and output couplers have been performed using the software CST-MWS to explicitly demonstrate this feature. (author)

Detailed Design and Fabrication Method of the ITER Vacuum Vessel Ports

International Nuclear Information System (INIS)

Hee-Jae Ahn; Kwon, T.H.; Hong, Y.S.

2006-01-01

The engineering design of the ITER vacuum vessel (VV) has been progressed by the ITER International Team (IT) with the cooperation of several participant teams (PT). The VV and ports are the components allocated to Korea for the construction of the ITER. Hyundai Heavy Industries has been involved in the structural analysis, detailed design and development of the fabrication method of the upper and lower ports within the framework of the ITER transitional arrangements (ITA). The design of the port structures has been investigated to validate and to improve the conceptual designs of the ITER IT and other PT. The special emphasis was laid on the flange joint between the port extension and the in-port plug to develop the design of the upper port. The modified design with a pure friction type flange with forty-eight pieces of bolts instead of the tangential key is recommended. Furthermore, the alternative flange designs developed by the ITER IT have been analyzed in detail to simplify the lip seal maintenance into the port flange. The structural analyses of the lower RH port have been also performed to verify the capacity for supporting the VV. The maximum stress exceeds the allowable value at the reinforcing block and basement. More elaborate local models have been developed to mitigate the stress concentration and to modify the component design. The fabrication method and the sequence of the detailed fabrication for the ports are developed focusing on the cost reduction as well as the simplification. A typical port structure includes a port stub, a stub extension and a port extension with a connecting duct. The fabrication sequence consists of surface treatment, cutting, forming, cleaning, welding, machining, and non-destructive inspection and test. Tolerance study has been performed to avoid the mismatch of each fabricated component and to obtain the suitable tolerances in the assembly at the shop and site. This study is based on the experience in the fabrication of

13 CFR 113.540 - Advertising.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

Advanced conceptual design report. Phase II. Liquid effluent treatment and disposal Project W-252

International Nuclear Information System (INIS)

1995-01-01

This Advanced Conceptual Design Report (ACDR) provides a documented review and analysis of the Conceptual Design Report (CDR), WHC-SD-W252-CDR-001, June 30, 1993. The ACDR provides further design evaluation of the major design approaches and uncertainties identified in the original CDR. The ACDR will provide a firmer basis for the both the design approach and the associated planning for the performance of the Definitive Design phase of the project

48 CFR 32.113 - Customary contract financing.

Science.gov (United States)

2010-10-01

... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...

Project W-314 specific test and evaluation plan for 241-AN-A valve pit

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

W.A. Parish Post Combustion CO₂ Capture and Sequestration Project Final Public Design Report

Energy Technology Data Exchange (ETDEWEB)

Armpriester, Anthony [Petra Nova Parish Holdings, Washington, DC (United States)

2017-02-17

The Petra Nova Project is a commercial scale post-combustion carbon dioxide capture project that is being developed by a joint venture between NRG Energy (NRG) and JX Nippon Oil and Gas Exploration (JX). The project is designed to separate and capture carbon dioxide from an existing coal-fired unit's flue gas slipstream at NRG's W.A. Parish Generation Station located southwest of Houston, Texas. The captured carbon dioxide will be transported by pipeline and injected into the West Ranch oil field to boost oil production. The project, which is partially funded by financial assistance from the U.S. Department of Energy will use Mitsubishi Heavy Industries of America, Inc.'s Kansai Mitsubishi Carbon Dioxide Recovery (KM-CDR(R)) advanced amine-based carbon dioxide absorption technology to treat and capture at least 90% of the carbon dioxide from a 240 megawatt equivalent flue gas slipstream off of Unit 8 at W.A. Parish. The project will capture approximately 5,000 tons of carbon dioxide per day or 1.5 million tons per year that Unit 8 would otherwise emit, representing the largest commercial scale deployment of post-combustion carbon dioxide capture at a coal power plant to date. The joint venture issued full notice to proceed in July 2014 and when complete, the project is expected to be the world's largest post-combustion carbon dioxide capture facility on an existing coal plant. The detailed engineering is sufficiently complete to prepare and issue the Final Public Design Report.

48 CFR 432.113 - Customary contract financing.

Science.gov (United States)

2010-10-01

... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...

13 CFR 113.450 - Athletics.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...

W. E. B. Du Bois: A Dynamic Communicator and Cultural Iconoclast.

Science.gov (United States)

Reppert, James E.

This paper presents a biographical sketch of the prolific African-American writer and sociologist W.E.B. Du Bois, designed as an instructional unit in an introduction to mass communication course which can help make students aware of the roles played by ethnic minorities in shaping American and world media. The paper provides numerous details of…

Preparation of an sup(113m) indium generator

International Nuclear Information System (INIS)

Ling, H.W.

1979-01-01

This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt

5 CFR 831.113 - Payments to children.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...

Design of multichannel laser interferometry for W7-X

International Nuclear Information System (INIS)

Kornejew, P.; Hirsch, M.; Bindemann, T.; Dinklage, A.; Dreier, H.; Hartfuss, H.-J.

2006-01-01

An eight channel interferometer is developed for density feedback control and the continuous measurement of electron density profiles in the stellarator W7-X. An additional sightline is launched in the geometry of the Thomson scattering for cross calibration. Due to the W7-X coil geometry access is strongly restricted. This motivates the optimization of the sightline geometry and design studies for supplementary chords. In-vessel retroreflectors will be used and inserted in the first wall elements. To cope with associated mechanical vibrations and thermal drifts during the discharges with envisaged duration of 30 min either two-color or second harmonic interferometry techniques must be applied. Optimum wavelengths are found to be about 10 and 5 μm. A CO 2 /CO interferometer (10 μm/5 μm) will be tested and compared with an existing CO 2 /HeNe test interferometer. A special difficulty of remotely operated diagnostics is the need of long transmission lines with a path length of about 60 m required from the diagnostics location to the torus hall and back. Different arrangements will be compared

Usability as the Key Factor to the Design of a Web Server for the CReF Protein Structure Predictor: The wCReF

Directory of Open Access Journals (Sweden)

Vanessa Stangherlin Machado Paixão-Cortes

2018-01-01

Full Text Available Protein structure prediction servers use various computational methods to predict the three-dimensional structure of proteins from their amino acid sequence. Predicted models are used to infer protein function and guide experimental efforts. This can contribute to solving the problem of predicting tertiary protein structures, one of the main unsolved problems in bioinformatics. The challenge is to understand the relationship between the amino acid sequence of a protein and its three-dimensional structure, which is related to the function of these macromolecules. This article is an extended version of the article wCReF: The Web Server for the Central Residue Fragment-based Method (CReF Protein Structure Predictor, published in the 14th International Conference on Information Technology: New Generations. In the first version, we presented the wCReF, a protein structure prediction server for the central residue fragment-based method. The wCReF interface was developed with a focus on usability and user interaction. With this tool, users can enter the amino acid sequence of their target protein and obtain its approximate 3D structure without the need to install all the multitude of necessary tools. In this extended version, we present the design process of the prediction server in detail, which includes: (A identification of user needs: aiming at understanding the features of a protein structure prediction server, the end user profiles and the commonly-performed tasks; (B server usability inspection: in order to define wCReF’s requirements and features, we have used heuristic evaluation guided by experts in both the human-computer interaction and bioinformatics domain areas, applied to the protein structure prediction servers I-TASSER, QUARK and Robetta; as a result, changes were found in all heuristics resulting in 89 usability problems; (C software requirements document and prototype: assessment results guiding the key features that wCReF must

Design of a double-anode magnetron-injection gun for the W-band gyrotron

Science.gov (United States)

Jang, Kwang Ho; Choi, Jin Joo; So, Joon Ho

2015-07-01

A double-anode magnetron-injection gun (MIG) was designed. The MIG is for a W-band 10-kW gyrotron. Analytic equations based on adiabatic theory and angular momentum conservation were used to examine the initial design parameters such as the cathode angle, and the radius of the beam emitting surface. The MIG's performances were predicted by using an electron trajectory code, the EGUN code. The beam spread of the axial velocity, Δvz/vz, obtained from the EGUN code was observed to be 1.34% at α = 1.3. The cathode edge emission and the thermal effect were modeled. The cathode edge emission was found to have a major effect on the velocity spread. The electron beam's quality was significantly improved by affixing non-emissive cylinders to the cathode.

Design principles for handmade electrical insulation of superconducting joints in W7-X

Energy Technology Data Exchange (ETDEWEB)

Rummel, K., E-mail: kerstin.rummel@ipp.mpg.de [Max Planck Institute for Plasma Physics, EURATOM Association, Wendelsteinstr. 1, 17491 Greifswald (Germany); John, A. [Max Planck Institute for Plasma Physics, EURATOM Association, Wendelsteinstr. 1, 17491 Greifswald (Germany); Sulek, Z. [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Krakow, Radzikowskiego 152 (Poland)

2013-10-15

Highlights: ► In W-7X there are several types of handmade electrical insulation. ► In general insulation based on impregnated glass tapes and special G10 pieces. ► A proper overlapping of glass tapes turned out to be mandatory. ► Detailed qualification and training helps to minimize the failure rate. ► Visual inspection and Paschen tests after every insulation steps are important. -- Abstract: The superconducting magnet system of the Wendelstein 7-X (W7-X) experiment consists of 50 non-planar and 20 planar coils, 121 bus bars and 14 current leads. The connection between bus bars, coils and current leads will be provided by 198 joints. The joints have to be insulated manually during the assembly of the machine in constraint positions and a tight environment. In general the insulation is based on glass tapes impregnated with epoxy resin and special G10 insulating pieces embedded in the glass tape insulation. In critical areas Kapton{sup ®}-foils are embedded in the insulation. All types of insulation were qualified at mock-ups in a 1:1 model of the expected environment in W7-X. The qualification programme comprises thermal cycling between room temperature and 77 K and high voltage tests under air, under vacuum and under reduced pressure (Paschen test). The paper describes the main principles used for different types of handmade Paschen-tight insulations in W7-X and the visual and electrical tests during and after assembly.

21 CFR 113.5 - Current good manufacturing practice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...

40 CFR 113.3 - Definitions.

Science.gov (United States)

2010-07-01

... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...

13 CFR 113.510 - Recruitment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

19 CFR 113.0 - Scope.

Science.gov (United States)

2010-04-01

... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...

34 CFR 668.113 - Request for review.

Science.gov (United States)

2010-07-01

... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...

46 CFR 113.25-6 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...

14 CFR 1214.113 - Allocation of risk.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...

6 CFR 11.3 - Demand for payment.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...

9 CFR 113.4 - Exemptions to tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...

Technical Details on Beyond Design Basis Event Pilot Evaluations

Energy Technology Data Exchange (ETDEWEB)

None, None

2013-01-01

The primary focus of the BDBE pilot project was the review of BDBE analysis and mitigation features at four DOE nuclear facilities representing a range of DOE sites, nuclear facility types/activities, and responsible program offices. The pilots looked at (1) how beyond design basis accidents were evaluated and documented in the facility Documented Safety Analysis, (2) potential BDBE vulnerabilities and margins to failure of facility safety features as obtained from general area and specific system walkdowns and design documents reviews, and (3) preparations made in facility and site emergency management programs to respond to severe accidents. It also evaluated whether draft BDBE guidance on safety analysis and emergency management could be used to improve the analysis of and preparations for mitigating severe and beyond design basis accidents. The details of these activities are organized in this report as described below.

46 CFR 113.05-7 - Environmental tests.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...

9 CFR 113.33 - Mouse safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...

Design requirements document for project W-520, immobilized low-activity waste disposal

International Nuclear Information System (INIS)

Ashworth, S.C.

1998-01-01

This design requirements document (DRD) identifies the functions that must be performed to accept, handle, and dispose of the immobilized low-activity waste (ILAW) produced by the Tank Waste Remediation System (TWRS) private treatment contractors and close the facility. It identifies the requirements that are associated with those functions and that must be met. The functional and performance requirements in this document provide the basis for the conceptual design of the Tank Waste Remediation System Immobilized Low-Activity Waste disposal facility project (W-520) and provides traceability from the program-level requirements to the project design activity

Design requirements document for project W-520, immobilized low-activity waste disposal

Energy Technology Data Exchange (ETDEWEB)

Ashworth, S.C.

1998-08-06

This design requirements document (DRD) identifies the functions that must be performed to accept, handle, and dispose of the immobilized low-activity waste (ILAW) produced by the Tank Waste Remediation System (TWRS) private treatment contractors and close the facility. It identifies the requirements that are associated with those functions and that must be met. The functional and performance requirements in this document provide the basis for the conceptual design of the Tank Waste Remediation System Immobilized Low-Activity Waste disposal facility project (W-520) and provides traceability from the program-level requirements to the project design activity.

Design and development of 3 MeV, 30 kW DC industrial electron accelerator at Electron Beam Centre, Kharghar

International Nuclear Information System (INIS)

Mittal, K.C.; Nanu, K.; Jain, A.

2006-01-01

High power electron beam accelerators are becoming an important tool for industrial radiation process applications. Keeping this in mind, a 3 MeV, 10 mA, 30 kW DC industrial electron accelerator has been designed and is in advanced stage of development at Electron Beam Center, Kharghar, Navi Mumbai. The operating range of this accelerator is 1 MeV to 3 MeV with maximum beam current of 10 mA. Electron beam at 5 keV is generated in electron gun with LaB 6 cathode and is injected into accelerating column at a vacuum of 10 -7 torr. After acceleration the beam is scanned and taken out in air through a 100 cm X 7 cm titanium window for radiation processing applications. The high voltage accelerating power supply is based on a capacitive coupled parallel fed voltage multiplier scheme operating at 120 kHz. A 50 kW oscillator feeds power to high voltage multiplier column. The electron gun, accelerating column and high voltage multiplier column are housed in accelerator tank filled with SF 6 gas insulation at 6 kg/cm 2 . The accelerator is located in a RCC building with product conveyor for handling products. A central computerized control system is adopted for operation of the accelerator. Accelerator is in the advance stage of commissioning. Many of the subsystems have been commissioned and tested. This paper describes the design details and current status of the accelerator and various subsystems. (author)

Conceptual design statement of work for the immobilized low-activity waste disposal facility, project W-520

International Nuclear Information System (INIS)

Pickett, W.W.

1998-01-01

This Statement of Work outlines the deliverables and schedule for preparation of the Project W-520 Conceptual Design Report, including, work plans, site development plan, preliminary safety evaluation, and conceptual design

Definitive design report: Design report project W-025, Radioactive Mixed Waste (RMW) Land Disposal Facility NON-DRAG-OFF. Revision 1, Volume 1 and 2

International Nuclear Information System (INIS)

Roscha, V.

1994-01-01

The purpose of this report is to describe the definitive design of the Radioactive Mixed Waste (RMW) Non-Drag-Off disposal facility, Project W-025. This report presents a n of the major landfill design features and a discussion of how each of the criteria is addressed in the design. The appendices include laboratory test results, design drawings, and individual analyses that were conducted in support of the design. Revision 1 of this document incorporates design changes resulting from an increase in the required operating life of the W-025 landfill from 2 to 20 years. The rationale for these design changes is described in Golder Associates Inc. 1991a. These changes include (1) adding a 1.5-foot-thick layer of compacted admix directory-under the primary FML on the floor of the landfill to mitigate the effects of possible stress cracking in the primary flexible membrane liner (FML), and (2) increasing the operations layer thickness from two to three feet over the entire landfill area, to provide additional protection for the secondary admix layer against mechanical damage and the effects of freezing and desiccation. The design of the W-025 Landfill has also been modified in response to the results of the EPA Method 9090 chemical compatibility testing program (Golder Associates Inc. 1991b and 1991c), which was completed after the original design was prepared. This program consisted of testing geosynthetic materials and soil/bentonite admix with synthetic leachate having the composition expected during the life of the W-025 Landfill., The results of this program indicated that the polyester geotextile originally specified for the landfill might be susceptible to deterioration. On this basis, polypropylene geotextiles were substituted as a more chemically-resistant alternative. In addition, the percentage of bentonite in the admix was increased to provide sufficiently low permeability to the expected leachate

9 CFR 113.326 - Avian Pox Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...

9 CFR 113.39 - Cat safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...

46 CFR 113.10-9 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...

46 CFR 113.43-5 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...

9 CFR 113.40 - Dog safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...

Design of a 3 kW wind turbine generator with thin airfoil blades

Energy Technology Data Exchange (ETDEWEB)

Ameku, Kazumasa; Nagai, Baku M.; Roy, Jitendro Nath [Faculty of Mechanical Engineering, University of the Ryukyus, 1 Senbaru, Nishihara-cho, Okinawa 903-0213 (Japan)

2008-09-15

Three blades of a 3 kW prototype wind turbine generator were designed with thin airfoil and a tip speed ratio of 3. The wind turbine has been controlled via two control methods: the variable pitch angle and by regulation of the field current of the generator and examined under real wind conditions. The characteristics of the thin airfoil, called ''Seven arcs thin airfoil'' named so because the airfoil is composed of seven circular arcs, are analyzed with the airfoil design and analysis program XFOIL. The thin airfoil blade is designed and calculated by blade element and momentum theory. The performance characteristics of the machine such as rotational speed, generator output as well as stability for wind speed changes are described. In the case of average wind speeds of 10 m/s and a maximum of 19 m/s, the automatically controlled wind turbine ran safely through rough wind conditions and showed an average generator output of 1105 W and a power coefficient 0.14. (author)

W+W- production at the LHC. Fiducial cross sections and distributions in NNLO QCD

International Nuclear Information System (INIS)

Grazzini, Massimiliano; Wiesemann, Marius; Kallweit, Stefan; California Univ., Santa Barbara, CA; Pozzorini, Stefano; California Univ., Santa Barbara, CA; Rathlev, Dirk

2016-05-01

We consider QCD radiative corrections to W + W - production at the LHC and present the first fully differential predictions for this process at next-to-next-to-leading order (NNLO) in perturbation theory. Our computation consistently includes the leptonic decays of the W bosons, taking into account spin correlations, off-shell effects and non-resonant contributions. Detailed predictions are presented for the different-flavour channel pp→μ + e - ν μ anti ν e +X at √(s)=8 and 13 TeV. In particular, we discuss fiducial cross sections and distributions in the presence of standard selection cuts used in experimental W + W - and H→W + W - analyses at the LHC. The inclusive W + W - cross section receives large NNLO corrections, and, due to the presence of a jet veto, typical fiducial cuts have a sizeable influence on the behaviour of the perturbative expansion. The availability of differential NNLO predictions, both for inclusive and fiducial observables, will play an important role in the rich physics programme that is based on precision studies of W + W - signatures at the LHC.

Direct design of LPV feedback controllers: technical details and numerical examples

OpenAIRE

Novara, Carlo

2014-01-01

The paper contains technical details of recent results developed by the author, regarding the design of LPV controllers directly from experimental data. Two numerical examples are also presented, about control of the Duffing oscillator and control of a two-degree-of-freedom manipulator.

Single Cell Oil Production from Hydrolysates of Inulin by a Newly Isolated Yeast Papiliotrema laurentii AM113 for Biodiesel Making.

Science.gov (United States)

Wang, Guangyuan; Liu, Lin; Liang, Wenxing

2018-01-01

Microbial oils are among the most attractive alternative feedstocks for biodiesel production. In this study, a newly isolated yeast strain, AM113 of Papiliotrema laurentii, was identified as a potential lipid producer, which could accumulate a large amount of intracellular lipids from hydrolysates of inulin. P. laurentii AM113 was able to produce 54.6% (w/w) of intracellular oil in its cells and 18.2 g/l of dry cell mass in a fed-batch fermentation. The yields of lipid and biomass were 0.14 and 0.25 g per gram of consumed sugar, respectively. The lipid productivity was 0.092 g of oil per hour. Compositions of the fatty acids produced were C 14:0 (0.9%), C 16:0 (10.8%), C 16:1 (9.7%), C 18:0 (6.5%), C 18:1 (60.3%), and C 18:2 (11.8%). Biodiesel obtained from the extracted lipids could be burnt well. This study not only provides a promising candidate for single cell oil production, but will also probably facilitate more efficient biodiesel production.

49 CFR 214.113 - Head protection.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...

The E-ELT project: the telescope main structure detailed design study

Science.gov (United States)

Marchiori, Gianpietro; Busatta, Andrea; Ghedin, Leonardo; De Lorenzi, Simone

2012-09-01

The European Extremely Large Telescope (E-ELT) is the biggest telescope in the world. Within the Detailed Design activities, ESO has awarded EIE GROUP (European Industrial Engineering) a contract for the Design of the Main Structure to the point where the concept of the telescope has been consolidated, from a construction point of view. All the Design activities have been developed in order to create an integrated system in terms of functionality and performance, while the engineering activities have been performed with the aim of obtaining a telescope that can be built, transported, integrated, with a reduced maintainability.

Rapid prototyping in order to improve building performance simulation for detailed design support

NARCIS (Netherlands)

Hopfe, C.J.; Hensen, J.L.M.; Stankov, P.

2006-01-01

Building performance simulation (BPS) is a powerful tool to support building and system designers in emulating how orientation, building type, HVAC system etc. interacts the overall building performance. Currently BPS is used only for code compliance in the detailed design, neither to make informed

7 CFR 1955.113 - Price (housing).

Science.gov (United States)

2010-01-01

... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...

W-026, health physics instrumentation operational test report

International Nuclear Information System (INIS)

Hackworth, M.F.

1998-01-01

This report documents the testing of the Health Physics Instrumentation associated with phase 2 and 3 start-up of Project W-026, WRAP. The Health Physics Instrumentation includes: Alpha and Beta Continuous Air Monitors (CAMS), Personnel Contamination Monitors (PCMs), Gamma Area Radiation Monitors (ARMs), Criticality Monitors, Alpha and Beta Smear Sample Counters, Portable Friskers, and Operator Breathing Zone Air Samplers. This OTR will cover only the Health Physics Instrumentation that was tested under the Operational test Plan for Health Physics Instrumentation (Phase 2 and 3). That instrumentation included: Alpha CAMS, Beta CAMs and ARMs located in rooms 107 and 113 of 2336-W. The remaining Health Physics Instrumentation that will be used for phase 2 and 3 start-up is tested during calibrations. These calibrations are outside the scope of the Operational Test Plan

A 66pW Discontinuous Switch-Capacitor Energy Harvester for Self-Sustaining Sensor Applications.

Science.gov (United States)

Wu, Xiao; Shi, Yao; Jeloka, Supreet; Yang, Kaiyuan; Lee, Inhee; Sylvester, Dennis; Blaauw, David

2016-06-01

We present a discontinuous harvesting approach for switch capacitor DC-DC converters that enables ultra-low power energy harvesting. By slowly accumulating charge on an input capacitor and then transferring it to a battery in burst-mode, switching and leakage losses in the DC-DC converter can be optimally traded-off with the loss due to non-ideal MPPT operation. The harvester uses a 15pW mode controller, an automatic conversion ratio modulator, and a moving sum charge pump for low startup energy upon a mode switch. In 180nm CMOS, the harvester achieves >40% end-to-end efficiency from 113pW to 1.5μW with 66pW minimum input power, marking a >10× improvement over prior ultra-low power harvesters.

Generator 113{sup S}n-113m{sup I}n. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds; Generador de 113{sup S}n- 113m{sup I}n. Estudio de las caracteristicas mas relevantes en la composicion del eluido con miras a la obtencion de compuestos marcados de aplicacion clinica

Energy Technology Data Exchange (ETDEWEB)

Adan, L; Rebollo, D V

1978-07-01

The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.

Ethylenediaminetetramethylene phosphate labelled with Indium-113 m (sup(113m)In-EDTMP) in bone scintigraphy

International Nuclear Information System (INIS)

Guzman Acevedo, C.

1981-08-01

Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable

Project W-314 specific test and evaluation plan for 241-AY-02A pump pit upgrade

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-02A Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-02A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

Project W-314 specific test and evaluation plan for 241-AY-01A pump pit upgrade

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-0IA Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-01A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

Background analysis for the beta-spectrum of the isotope 113Cd in the COBRA experiment

Energy Technology Data Exchange (ETDEWEB)

Platzek, Stephan [Technische Universitaet Dresden (Germany); Collaboration: COBRA-Collaboration

2016-07-01

The COBRA experiment uses Cadmium-Zinc-Telluride as detector material. This semiconductor contains several isotopes that are candidates for neutrinoless double beta-decay. Due to the natural abundance of the detector material various other isotopes are present as well. One of them is {sup 113}Cd with an abundance of about 12%. The fourfold forbidden non-unique beta-decay of {sup 113}Cd is a rare process with a half-life of about 8.10{sup 15} years. The shape of the spectrum is still topic of scientific discussions because of various forecasts given by theoretical models. The signal related to this decay is by far the most prominent in the COBRA setup causing more than 98% of the total rate. In this talk potential background components contributing to the {sup 113}Cd beta-spectrum are discussed with the aim to develop a detailed background simulation with the program VENOM (based on Geant4), that includes background sources originating from cosmic activation as well as natural radioactivity and detector specific effects.

9 CFR 113.2 - Testing aids.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...

27 CFR 21.113 - Isopropyl alcohol.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...

9 CFR 113.451 - Tetanus Antitoxin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...

9 CFR 11.3 - Scar rule.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...

Design of a high efficiency 30 kW boost composite converter

Energy Technology Data Exchange (ETDEWEB)

Kim, Hyeokjin [Univ. of Colorado, Boulder, CO (United States); Chen, Hua [Univ. of Colorado, Boulder, CO (United States); Maksimovic, Dragan [Univ. of Colorado, Boulder, CO (United States); Erickson, Robert W. [Univ. of Colorado, Boulder, CO (United States)

2015-09-20

An experimental 30 kW boost composite converter is described in this paper. The composite converter architecture, which consists of a buck module, a boost module, and a dual active bridge module that operates as a DC transformer (DCX), leads to substantial reductions in losses at partial power points, and to significant improvements in weighted efficiency in applications that require wide variations in power and conversion ratio. A comprehensive loss model is developed, accounting for semiconductor conduction and switching losses, capacitor losses, as well as dc and ac losses in magnetic components. Based on the developed loss model, the module and system designs are optimized to maximize efficiency at a 50% power point. Experimental results for the 30 kW prototype demonstrate 98.5%peak efficiency, very high efficiency over wide ranges of power and voltage conversion ratios, as well as excellent agreements between model predictions and measured efficiency curves.

Advanced solar panel designs

Science.gov (United States)

Ralph, E. L.; Linder, E.

1995-01-01

This paper describes solar cell panel designs that utilize new hgih efficiency solar cells along with lightweight rigid panel technology. The resulting designs push the W/kg and W/sq m parameters to new high levels. These new designs are well suited to meet the demand for higher performance small satellites. This paper reports on progress made on two SBIR Phase 1 contracts. One panel design involved the use of large area (5.5 cm x 6.5 cm) GaAs/Ge solar cells of 19% efficiency combined with a lightweight rigid graphite fiber epoxy isogrid substrate configuration. A coupon (38 cm x 38 cm) was fabricated and tested which demonstrated an array specific power level of 60 W/kg with a potential of reaching 80 W/kg. The second panel design involved the use of newly developed high efficiency (22%) dual junction GaInP2/GaAs/Ge solar cells combined with an advanced lightweight rigid substrate using aluminum honeycomb core with high strength graphite fiber mesh facesheets. A coupon (38 cm x 38 cm) was fabricated and tested which demonstrated an array specific power of 105 W/kg and 230 W/sq m. This paper will address the construction details of the panels and an a analysis of the component weights. A strawman array design suitable for a typical small-sat mission is described for each of the two panel design technologies being studied. Benefits in respect to weight reduction, area reduction, and system cost reduction are analyzed and compared to conventional arrays.

13 CFR 113.410 - Comparable facilities.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...

The 25 kW resonant dc/dc power converter

Science.gov (United States)

Robson, R. R.

1983-01-01

The feasibility of processing 25-kW of power with a single, transistorized, series resonant converter stage was demonstrated by the successful design, development, fabrication, and testing of such a device which employs four Westinghouse D7ST transistors in a full-bridge configuration and operates from a 250-to-350 Vdc input bus. The unit has an overall worst-case efficiency of 93.5% at its full rated output of 1000 V and 25 A dc. A solid-state dc input circuit breaker and output-transient-current limiters are included in and integrated into the design. Full circuit details of the converter are presented along with the test data.

21 CFR 113.81 - Product preparation.

Science.gov (United States)

2010-04-01

...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

Design criteria of the bolometer diagnostic for steady-state operation of the W7-X stellarator

International Nuclear Information System (INIS)

Zhang, D.; Burhenn, R.; Koenig, R.; Giannone, L.; Grodzki, P. A.; Klein, B.; Grosser, K.; Baldzuhn, J.; Ewert, K.; Erckmann, V.; Hirsch, M.; Laqua, H. P.; Oosterbeek, J. W.

2010-01-01

A bolometric diagnostic system with features necessary for steady-state operation in the superconducting stellarator W7-X was designed. During a pulse length of 1800 s with an ECRH (electron cyclotron resonance heating) power of 10 MW, the components suffer not only from a large thermal load but also from stray radiation of the nonabsorbed isotropic microwaves. This paper gives an overview of the technical problems encountered during the design work and the solutions to individual problems to meet the special requirements in W7-X, e.g., component thermal protection, detector offset thermal drift suppression, as well as a microwave shielding technique.

Design criteria of the bolometer diagnostic for steady-state operation of the W7-X stellaratora)

Science.gov (United States)

Zhang, D.; Burhenn, R.; Koenig, R.; Giannone, L.; Grodzki, P. A.; Klein, B.; Grosser, K.; Baldzuhn, J.; Ewert, K.; Erckmann, V.; Hirsch, M.; Laqua, H. P.; Oosterbeek, J. W.

2010-10-01

A bolometric diagnostic system with features necessary for steady-state operation in the superconducting stellarator W7-X was designed. During a pulse length of 1800 s with an ECRH (electron cyclotron resonance heating) power of 10 MW, the components suffer not only from a large thermal load but also from stray radiation of the nonabsorbed isotropic microwaves. This paper gives an overview of the technical problems encountered during the design work and the solutions to individual problems to meet the special requirements in W7-X, e.g., component thermal protection, detector offset thermal drift suppression, as well as a microwave shielding technique.

Conceptual design report for tank farm restoration and safe operations, project W-314

Energy Technology Data Exchange (ETDEWEB)

Briggs, S.R., Westinghouse Hanford

1996-05-02

This Conceptual Design Report (CDR) presents the conceptual level design approach that satisfies the established technical requirements for Project W-314, `Tank Farm Restoration and Safe Operations.` The CDR also addresses the initial cost and schedule baselines for performing the proposed Tank Farm infrastructure upgrades. The scope of this project includes capital improvements to Hanford`s existing tank farm facilities(primarily focused on Double- Shell Tank Farms) in the areas of instrumentation/control, tank ventilation, waste transfer, and electrical systems.

49 CFR 230.113 - Wheels and tire defects.

Science.gov (United States)

2010-10-01

... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...

Fentanyl-related designer drugs W-18 and W-15 lack appreciable opioid activity in vitro and in vivo.

Science.gov (United States)

Huang, Xi-Ping; Che, Tao; Mangano, Thomas J; Le Rouzic, Valerie; Pan, Ying-Xian; Majumdar, Susruta; Cameron, Michael D; Baumann, Michael H; Pasternak, Gavril W; Roth, Bryan L

2017-11-16

W-18 (4-chloro-N-[1-[2-(4-nitrophenyl)ethyl]-2-piperidinylidene]-benzenesulfonamide) and W-15 (4-chloro-N-[1-(2-phenylethyl)-2-piperidinylidene]-benzenesulfonamide) represent two emerging drugs of abuse chemically related to the potent opioid agonist fentanyl (N-(1-(2-phenylethyl)-4-piperidinyl)-N-phenylpropanamide). Here, we describe the comprehensive pharmacological profiles of W-18 and W-15, as examination of their structural features predicted that they might lack opioid activity. We found W-18 and W-15 to be without detectible activity at μ, δ, κ, and nociception opioid receptors in a variety of assays. We also tested W-18 and W-15 for activity as allosteric modulators at opioid receptors and found them devoid of significant positive or negative allosteric modulatory activity. Comprehensive profiling at essentially all the druggable GPCRs in the human genome using the PRESTO-Tango platform revealed no significant activity. Weak activity at the sigma receptors and the peripheral benzodiazepine receptor was found for W-18 (Ki = 271 nM). W-18 showed no activity in either the radiant heat tail-flick or the writhing assays and also did not induce classical opioid behaviors. W-18 is extensively metabolized, but its metabolites also lack opioid activity. Thus, although W-18 and W-15 have been suggested to be potent opioid agonists, our results reveal no significant activity at these or other known targets for psychoactive drugs.

W/SiC X-ray multilayers optimized for use above 100 keV

DEFF Research Database (Denmark)

Windt, D.L.; Dongey, S.; Hailey, C.J.

2002-01-01

-derived optical constants, which we determined from reflectance-vs-incidence angle measurements also made using synchrotron radiation, in the range E=120 - 180 keV. We describe our experimental investigation in detail, compare the new W/SiC multilayers with both W/Si and W/B4C films that have been studied......We have developed a new depth-graded multilayer system comprising W and SiC layers, suitable for use as hard X-ray reflective coatings operating in the energy range 100 - 200 keV. Grazing incidence X-ray reflectance at E=8 keV was used to characterize the interface widths, as well as the temporal...... and thermal stability in both periodic and depth-graded W/SiC structures, while synchrotron radiation was used to measure the hard X-ray reflectance of a depth-graded multilayer designed specifically for use in the range Esimilar to150 - 170 keV. We have modeled the hard X-ray reflectance using newly...

W/SiC x-ray multilayers optimized for use above 100 keV

DEFF Research Database (Denmark)

Windt, D.L.; Donguy, S.; Hailey, C.J.

2003-01-01

optical constants, which we determined from reflectance versus incidence angle measurements also made using synchrotron radiation, in the range E = 120-180 keV. We describe our experimental investigation in detail, compare the new W/SiC multilayers with both W/Si and W/B4C films that have been studied......We have developed a new depth-graded multilayer system comprising W and SiC layers, suitable for use as hard x-ray reflective coatings operating in the energy range 100-200 keV. Grazing-incidence x-ray reflectance at E = 8 keV was used to characterize the interface widths, as well as the temporal...... and thermal stability in both periodic and depth-graded W/SiC structures, whereas synchrotron radiation was used to measure the hard x-ray reflectance of a depth-graded multilayer designed specifically for use in, the range Esimilar to150-170 keV. We have modeled the hard x-ray reflectance using newly derived...

The major results from W7-AS stellarator

Science.gov (United States)

Wagner, Friedrich

2002-11-01

W7-AS has terminated operation this summer. In the last phase, W7-AS was equipped with an island divertor using the natural edge islands of the low-shear, n=5 design. NBI heating has been done with co-injection (3 MW), ECRH was successfully extended to high density with the OXB scheme, and ICRH was applied in all standard modes but also in beach wave heating. The island divertor allowed high β and provided excellent exhaust conditions thanks to the accessibility to high densities (ne rationals; in the plasma core the neo-classical bifurcation between ion and electron roots is observed. A distinct difference to tokamaks is the lack of Te - profile resilience. The H-mode operational range is governed by poloidal flow damping. At high density, a further bifurcation appears into a regime characterised by good energy and low impurity confinement (HDH). Because of its appealing features, this regime will be described in detail. The most visible MHD are beam driven global Alfven modes and ELMs. The operational limits are set by NBI power: The balance of heating and edge radiation determines the density limit; the maximal β is limited to 3.1%. The operation at high densities and high β is quiescent and quasi-steady state. The intrinsic stellarator features - steady state and no disruptions - remain close to operational limits. The results of W7-AS confirm the design criteria of W7-X and contribute to establish the stellarator line as independent route to a reactor.

Detailed mechanical design of the LIPAc beam dump radiological shielding

Energy Technology Data Exchange (ETDEWEB)

Nomen, Oriol, E-mail: onomen@irec.cat [IREC, Barcelona, Catalonia (Spain); CDEI-UPC, Barcelona, Catalonia (Spain); Martínez, José I.; Arranz, Fernando; Iglesias, Daniel; Barrera, Germán; Brañas, Beatriz [CIEMAT, Madrid (Spain); Ogando, Francisco [UNED, Madrid (Spain); Molla, Joaquín [CIEMAT, Madrid (Spain); Sanmartí, Manel [IREC, Barcelona, Catalonia (Spain)

2013-10-15

Highlights: ► Mechanical design of the IFMIF LIPAc beam dump shielding has been performed. ► Lead shutter design performed to shield radiation from beam dump when LIPAc is off. ► External loads, working and dismantling conditions, included as design constraints. -- Abstract: The LIPAc is a 9 MeV, D{sup +} linear prototype accelerator for the validation of the IFMIF accelerator design. The high intensity, 125 mA CW beam is stopped in a copper cone involving a high production of neutrons and gamma radiation and activation of its surface. The beam stopper is surrounded by a shielding to attenuate the resulting radiation so that dose rate values comply with the limits at the different zones of the installation. The shielding includes for that purpose polyethylene rings, water tanks and gray cast iron rings. A lead shutter has also been designed to shield the gamma radiation that comes through the beam tube when the linear accelerator is not in operation, in order to allow access inside the building for maintenance tasks. The present work summarizes the detailed mechanical design of the beam dump shielding and the lead shutter taking into account the design constraints, such as working conditions and other external loads, as well as including provisions for dismantling.

Functional design criteria for project W-252, phase II liquid effluent treatment and disposal. Revision 2

International Nuclear Information System (INIS)

Hatch, C.E.

1995-05-01

This document is the Functional Design Criteria for Project W-252. Project W-252 provides the scope to provide BAT/AKART (best available technology...) to 200 Liquid Effluent Phase II streams (B-Plant). This revision (Rev. 2) incorporates a major descoping of the project. The descoping was done to reflect a combination of budget cutting measures allowed by a less stringent regulatory posture toward the Phase II streams

Design review report: 200 East upgrades for Project W-314, tank farm restoration and safe operations

International Nuclear Information System (INIS)

Boes, K.A.

1998-01-01

This Design Review Report (DRR) documents the contractor design verification methodology and records associated with project W-314's 200 East (200E) Upgrades design package. The DRR includes the documented comments and their respective dispositions for this design. Acceptance of the comment dispositions and closure of the review comments is indicated by the signatures of the participating reviewers. Project W-314 is a project within the Tank Waste Remediation System (TWRS) Tank Waste Retrieval Program. This project provides capital upgrades for the existing Hanford tank farm waste transfer, instrumentation, ventilation, and electrical infrastructure systems. To support established TWRS programmatic objectives, the project is organized into two distinct phases. The initial focus of the project (i.e., Phase 1) is on waste transfer system upgrades needed to support the TWRS Privatization waste feed delivery system. Phase 2 of the project will provide upgrades to support resolution of regulatory compliance issues, improve tank infrastructure reliability, and reduce overall plant operating/maintenance costs. Within Phase 1 of the W-314 project, the waste transfer system upgrades are further broken down into six major packages which align with the project's work breakdown structure. Each of these six sub-elements includes the design, procurement, and construction activities necessary to accomplish the specific tank farm upgrades contained within the package. The first design package (AN Valve Pit Upgrades) was completed in November 1997, and the associated design verification activities are documented in HNF-1893. The second design package, 200 East (200E) Upgrades, was completed in March 1998. This design package identifies modifications to existing valve pits 241-AX-B and 241-A-B, as well as several new waste transfer pipelines to be constructed within the A Farm Complex of the 200E Area. The scope of the valve pit modifications includes new pit cover blocks, valve

Design of diode electron gun for 250 kW CW klystron

International Nuclear Information System (INIS)

Prasad, M.; Pande, S.A.; Hannurkar, P.R.

2005-01-01

A 250 kW CW klystron at frequencies 350 MHz and 700 MHz is being developed at Centre for Advanced Technology. These klystrons are required for forthcoming project like 100 MeV proton Linac for Spallation Neutron Source (SNS) as a main rf sources. In order to develop klystrons, we have designed the diode electron gun, which delivers more than 10 A beam current at 50 kV. This paper describes the simulation results of electron gun with computer code EGUN. (author)

47 CFR 25.113 - Station licenses and launch authority.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...

Design of a 200kW electric powertrain for a high performance electric vehicle

Directory of Open Access Journals (Sweden)

Wilmar Martinez

2016-09-01

Full Text Available With the purpose of designing the electric powertrain of a high performance electric vehicle capable of running a quarter mile in 10 seconds, firstly it is necessary to calculate the required energy, torque, and power in order to size and select the suitable storage components and electric motors. Secondly, an assessment of the powertrain arrangement is needed to choose the best internal configuration of the vehicle and guarantee the highest efficiency possible. Finally, a design of the power conversion stages, specifically the DC-DC converter that interfaces the storage unit with the electric motors, is required as well. This paper shows the energy calculation procedure based on a longitudinal dynamic model of the vehicle and the selection method of the storage components and motors needed for this application, as well as the design of two 100kW interleaved boost converters with coupled inductors. In addition, a novel operation of the interleaved boost converter is proposed in order to increase the efficiency of the converter. As a result, the designed converter achieved a power density of 24,2kW/kg with an efficiency of 98 %, which was validated by experimental tests of a low power prototype.

9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...

9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...

9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...

9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...

9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...

Wooden houses in detail. Holzhaeuser im Detail

Energy Technology Data Exchange (ETDEWEB)

Ruske, W. (ed.)

1986-01-01

Under the serial title 'Planning and construction of wooden houses', WEKA will publish a number of books of which this is the first. Details of design and construction are presented, e.g.: Details of modern one-family houses; Fundamentals of design and hints for planning of wooden houses and compact wooden structures; Constructional ecology, wood protection, thermal insulation, sound insulation; Modular systems for domestic buildings; The 'bookshelf-type' house at the Berlin International Construction Exhibition (IBA); Experience with do-it-yourself systems. With 439 figs.

Current status on detail design and fabrication techniques development of ITER blanket shield block in Korea

International Nuclear Information System (INIS)

Kim, Duck Hoi; Cho, Seungyon; Ahn, Mu-Young; Lee, Eun-Seok; Jung, Ki Jung

2007-01-01

The allocation of components and systems to be delivered to ITER on an in-kind basis, was agreed between the ITER Parties. Among parties, Korea agreed to procure inboard blanket modules 1, 2 and 6, which consists of FW and shield block. Regarding shield block the detail design and Fabrication techniques development have been undertaken in Korea. Especially manufacturing feasibility study on shield block had been performed and some technical issues for the fabrication were selected. Based on these results, fabrication techniques using EB welding are being developed. Meanwhile, the detail design of inboard standard module has been carried out. The optimization of flow driver design to improve the cooling performance was executed. And, thermo-hydraulic analysis on half block of inboard standard module was performed. In this study, current status and some results from Fabrication techniques development on ITER blanket shield block are described. The detail design activity and results on shield block are also introduced herein. (orig.)

Experimental Studies of W-Band Accelerator Structures at High Field

Energy Technology Data Exchange (ETDEWEB)

Hill, Marc E

2001-02-09

A high-gradient electron accelerator is desired for high-energy physics research, where frequency scalings of breakdown and trapping of itinerant beamline particles dictates operation of the accelerator at short wavelengths. The first results of design and test of a high-gradient mm-wave linac with an operating frequency at 91.392 GHz (W-band) are presented. A novel approach to particle acceleration is presented employing a planar, dielectric lined waveguide used for particle acceleration. The traveling wave fields in the planar dielectric accelerator (PDA) are analyzed for an idealized structure, along with a circuit equivalent model used for understanding the structure as a microwave circuit. Along with the W-band accelerator structures, other components designed and tested are high power rf windows, high power attenuators, and a high power squeeze-type phase shifter. The design of the accelerator and its components where eased with the aide of numerical simulations using a finite-difference electromagnetic field solver. Manufacturing considerations of the small, delicate mm-wave components and the steps taken to reach a robust fabrication process are detailed. These devices were characterized under low power using a two-port vector network analyzer to verify tune and match, including measurements of the structures' fields using a bead-pull. The measurements are compared with theory throughout. Addition studies of the W-band structures were performed under high power utilizing a 11.424 GHz electron linac as a current source. Test results include W-band power levels of 200 kW, corresponding to fields in the PDA of over 20 MV/m, a higher gradient than any collider. Planar accelerator devices naturally have an rf quadrupole component of the accelerating field. Presented for the first time are the measurements of this effect.

14 CFR 13.113 - Noncompliance with the investigative process.

Science.gov (United States)

2010-01-01

... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...

9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...

Design review plan for Multi-Function Waste Tank Facility (Project W-236A)

International Nuclear Information System (INIS)

Renfro, G.G.

1994-01-01

This plan describes how the Multi-Function Waste Tank Facility (MWTF) Project conducts reviews of design media; describes actions required by Project participants; and provides the methodology to ensure that the design is complete, meets the technical baseline of the Project, is operable and maintainable, and is constructable. Project W-236A is an integrated project wherein the relationship between the operating contractor and architect-engineer is somewhat different than that of a conventional project. Working together, Westinghouse Hanford Company (WHC) and ICF Karser Hanford (ICF KH) have developed a relationship whereby ICF KH performs extensive design reviews and design verification. WHC actively participates in over-the-shoulder reviews during design development, performs a final review of the completed design, and conducts a formal design review of the Safety Class I, ASME boiler and Pressure Vessel Code items in accordance with WHC-CM-6-1, Standard Engineering Practices

9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...

Design and implementation of a 38 kW dish-Stirling concentrated solar power system

Science.gov (United States)

Yan, J.; Peng, Y. D.; Cheng, Z. R.; Liu, F. M.; Tang, X. H.

2017-11-01

Dish-Stirling concentrated solar power system (DS-CSP) is an important pathway for converting solar energy into electricity at high efficiency. In this study, a rated power 38 kW DS-CSP system was developed (installed in Xiangtan Electric Manufacturing Group). The heat engine adopted the alpha-type four cylinders double-acting Stirling engine (Stirling Biopower Flexgen S260). The absorber flux distribution simulation was conducted using ray tracing method and then the 204 m2 parabolic dish concentrator system (diameter is 17.70 m and focal length is 9.49 m) with single concentrator plus single pillar supporting has been designed and built. A water-cooled disc target and an absorber imitation device were adopted to test the tracking performance of the dish concentrator system, homogeneity of the focal spot and flux distribution of the absorber. Finally, the S260 Stirling engine was installed on the focal position of the dish concentrator and then the net output power date of the 38 kW DS-CSP system was tested. The absorber overheating problem on the DS-CSP system performance was discussed when the DS-CSP system was installed in different locations. The testing result shows that this system achieved the net output power of 38 kW and solar-to-electricity efficiency (SEE) of 25.3% with the direct normal irradiation (DNI) at 750 W/m2. The net output power can further increase to 40.5 kW with the SEE of 26.6% when the DNI reaches up to the maximum of 761 W/m2. The net output power of the 38 kW DS-CSP system has a linear function relationship with the DNI. The fitting function is Net power output=0.1003×DNI－36.129, where DNI is at the range of 460∼761 W/m2. This function could be used to predict the amount of the 38 kW DS-CSP system annual generation power.

Advanced information processing system: The Army Fault-Tolerant Architecture detailed design overview

Science.gov (United States)

Harper, Richard E.; Babikyan, Carol A.; Butler, Bryan P.; Clasen, Robert J.; Harris, Chris H.; Lala, Jaynarayan H.; Masotto, Thomas K.; Nagle, Gail A.; Prizant, Mark J.; Treadwell, Steven

1994-01-01

The Army Avionics Research and Development Activity (AVRADA) is pursuing programs that would enable effective and efficient management of large amounts of situational data that occurs during tactical rotorcraft missions. The Computer Aided Low Altitude Night Helicopter Flight Program has identified automated Terrain Following/Terrain Avoidance, Nap of the Earth (TF/TA, NOE) operation as key enabling technology for advanced tactical rotorcraft to enhance mission survivability and mission effectiveness. The processing of critical information at low altitudes with short reaction times is life-critical and mission-critical necessitating an ultra-reliable/high throughput computing platform for dependable service for flight control, fusion of sensor data, route planning, near-field/far-field navigation, and obstacle avoidance operations. To address these needs the Army Fault Tolerant Architecture (AFTA) is being designed and developed. This computer system is based upon the Fault Tolerant Parallel Processor (FTPP) developed by Charles Stark Draper Labs (CSDL). AFTA is hard real-time, Byzantine, fault-tolerant parallel processor which is programmed in the ADA language. This document describes the results of the Detailed Design (Phase 2 and 3 of a 3-year project) of the AFTA development. This document contains detailed descriptions of the program objectives, the TF/TA NOE application requirements, architecture, hardware design, operating systems design, systems performance measurements and analytical models.

W.a.w (we are watching) smart app: accommodating social perception towards public officers’ performance

Science.gov (United States)

Widhoyoko, S. A.; Sasmoko; Nasir, L. A.; Manalu, S. R.; Indrianti, Y.

2018-03-01

This research is a continuation of previous research that is corruption early prevention is expanded by using expert system to analyze data and produce information to build decision. The research method used is neuroresearch method through three stages of research, namely exploratory stage, explanatory stage and confirmatory stages. The exploratory research finds W.aW’s Principles and W.a.W’s Units of Assessment as the basis for the preparation of the application. Stages of explanatory research in the form of W.a.W’s design of IT and confirmatory research stages are the design of expert system W.a.W. Expert System uses this formulation to generate dynamic standard value for each category and current social perception.

9 CFR 113.122 - Salmonella Choleraesuis Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...

9 CFR 113.120 - Salmonella Typhimurium Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...

37 CFR 11.3 - Suspension of rules.

Science.gov (United States)

2010-07-01

... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...

Addendum to the Closure Report for Corrective Action Unit 113: Area 25 R-MAD Facility, Nevada National Security Site, Nevada

International Nuclear Information System (INIS)

2011-01-01

This addendum to the Closure Report for Corrective Action Unit 113: Area 25, Reactor Maintenance, Assembly, and Disassembly Facility, Building 3110, Nevada Test Site, Nevada, DOE/NV--891-VOL I-Rev. 1, dated July 2003, provides details of demolition, waste disposal, and use restriction (UR) modification for Corrective Action Unit 113, Area 25 R-MAD Facility. Demolition was completed on July 15, 2010, when the last of the building debris was disposed. Final field activities were concluded on August 30, 2010, after all equipment was demobilized and UR signs were posted. This work was funded by the American Recovery and Reinvestment Act.

Detailed design studies at CEA for JT-60SA TF coils

International Nuclear Information System (INIS)

Decool, P.; Marechal, J.L.; Portafaix, C.; Lacroix, B.; Gros, G.; Verger, J.M.

2011-01-01

Following a first conceptual design activity in which the general design of the JT-60SA TF system was defined and frozen in agreement with all the participants in the project (CEA, ENEA, F4E), a second phase had to be launched to deal with the detailed design. In this paper, we present the work performed at CEA on the TF coil design during this second phase. Part of this work, concerns the determination of conductor hydraulic performances during operation as well as in factory. The thermohydraulic of the conductor was also assessed to confirm the need of helium inlets and a specific design was developed and qualified to be compatible with the available hydraulic performance of the cryoplant. The mechanical behavior is still to be assessed and qualified. Last but not least, the inner electrical joints of the coil have been modified with respect to the original twin-box design developed by CEA for the ITER coils in order to simplify the fabrication process. A dedicated qualification program for their manufacture is ongoing.

Preparation of Radio-pharmaceuticals-III: An evaluation of the eluate from a {sup 113}Sn-{sup 113m}In cow system

Energy Technology Data Exchange (ETDEWEB)

Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)

1969-03-15

In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.

9 CFR 113.317 - Parvovirus Vaccine (Canine).

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...

Design and simulation of a 30 kV, 60 kW electron optical column for melting applications

Energy Technology Data Exchange (ETDEWEB)

Gupta, Sachin; Kandaswamy, E.; Bapat, A.V., E-mail: saching@barc.gov.in [Bhabha Atomic Research Centre, Mumbai (India)

2014-07-01

Electron beam offers unique advantages as a heat source for melting of refractory metals. It provides contamination free homogeneous melting with precise heat control on the melt target. This paper reports the complete electron optics design procedure for a 30 kV, 60 kW melting gun. The design objective of the electron optical column is to obtain the required power density on the target (10{sup 3}-10{sup 4} W/cm{sup 2}) using electrostatic and electromagnetic lenses. The design constrains are to minimize the high voltage discharges in the gun and beam losses in the beam transport. The challenging task of reducing the electrical discharges in the gun during high power melting with the help of twin electromagnetic lenses is presented in the paper. (author)

Thermodynamic design of 10 kW Brayton cryocooler for HTS cable

Science.gov (United States)

Chang, Ho-Myung; Park, C. W.; Yang, H. S.; Sohn, Song Ho; Lim, Ji Hyun; Oh, S. R.; Hwang, Si Dole

2012-06-01

Thermodynamic design of Brayton cryocooler is presented as part of an ongoing governmental project in Korea, aiming at 1 km HTS power cable in the transmission grid. The refrigeration requirement is 10 kW for continuously sub-cooling liquid nitrogen from 72 K to 65 K. An ideal Brayton cycle for this application is first investigated to examine the fundamental features. Then a practical cycle for a Brayton cryocooler is designed, taking into account the performance of compressor, expander, and heat exchangers. Commercial software (Aspen HYSYS) is used for simulating the refrigeration cycle with real fluid properties of refrigerant. Helium is selected as a refrigerant, as it is superior to neon in thermodynamic efficiency. The operating pressure and flow rate of refrigerant are decided with a constraint to avoid the freezing of liquid nitrogen

Optimization design of turbo-expander gas bearing for a 500W helium refrigerator

Science.gov (United States)

Li, S. S.; Fu, B.; Y Zhang, Q.

2017-12-01

Turbo-expander is the core machinery of the helium refrigerator. Bearing as the supporting element is the core technology to impact the design of turbo-expander. The perfect design and performance study for the gas bearing are essential to ensure the stability of turbo-expander. In this paper, numerical simulation is used to analyze the performance of gas bearing for a 500W helium refrigerator turbine, and the optimization design of the gas bearing has been completed. And the results of the gas bearing optimization have a guiding role in the processing technology. Finally, the turbine experiments verify that the gas bearing has good performance, and ensure the stable operation of the turbine.

9 CFR 113.315 - Feline Rhinotracheitis Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...

9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...

19 CFR 113.33 - Corporations as principals.

Science.gov (United States)

2010-04-01

... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

9 CFR 113.101 - Leptospira Pomona Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.103 - Leptospira Canicola Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.105 - Leptospira Hardjo Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.65 - Brucella Abortus Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...

9 CFR 113.123 - Salmonella Dublin Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

49 CFR 199.113 - Employee assistance program.

Science.gov (United States)

2010-10-01

... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...

Detailed mechanical design and manufacturing study for the ITER reference breeding blanket

International Nuclear Information System (INIS)

Zacchia, F.; Daenner, W.; Stefanis, L. de; Ferrari, M.; Gerber, A.; Mustoe, J.

1998-01-01

This papers relates on the detailed mechanical design, manufacturing feasibility and assembly analysis of a water-cooled solid breeding blanket concept, selected as the ITER reference design. This breeding blanket design is characterised by: i) pressurised water flowing inside flat steel panels for cooling of the internals; each panel is welded along its contour onto the first wall structure and to the rear shield plate after closure of the module (last assembly step). ii) Beryllium (neutronic multiplier) in the form of micro-spheres filling the volume between parallel flat coolant panels. iii) Breeder pebbles enclosed in rods, which form bundles and are themselves embedded inside the Beryllium micro-spheres. (authors)

A Study on Liver Scan using 113mIn Colloid

International Nuclear Information System (INIS)

Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi

1969-01-01

There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.

Detailed evaluation of ET-RR-2 neutronic design: approach to criticality

International Nuclear Information System (INIS)

Ashoub, N.; Amin, E.

2000-01-01

The ET-RR-2 safety analysis evaluation effort included the assessment of the reactor core nuclear design parameters. The present work complements the previous effort of neutronic calculations using NCNSRC computer code packages. This paper is the first in comprehensive neutronic calculation assessment up to the equilibrium core. It deals with evaluation of neutronic calculation submitted during the early phase of the licensing process; namely the proposal to assemble the first critical core, calculation of power peaking factor and determination of detailed energy group flux distribution in the core particularly in the cobalt irradiation position. The neutronic design criteria are examined qualitatively and quantitatively in the present paper

Coset realization of unifying W-algebras

International Nuclear Information System (INIS)

Blumenhagen, R.; Huebel, R.

1994-06-01

We construct several quantum coset W-algebras, e.g. sl(2,R)/U(1) and sl(2,R)+sl(2,R)/sl(2,R), and argue that they are finitely nonfreely generated. Furthermore, we discuss in detail their role as unifying W-algebras of Casimir W-algebras. We show that it is possible to give coset realizations of various types of unifying W-algebras, e.g. the diagonal cosets based on the symplectic Lie algebras sp(2n) realize the unifying W-algebras which have previously been introduced as 'WD -n '. In addition, minimal models of WD -n are studied. The coset realizations provide a generalization of level-rank-duality of dual coset pairs. As further examples of finitely nonfreely generated quantum W-algebras we discuss orbifolding of W-algebras which on the quantum level has different properties than in the classical case. We demonstrate in some examples that the classical limit according to Bowcock and Watts of these nonfreely finitely generated quantum W-algebras probably yields infinitely nonfreely generated classical W-algebras. (orig.)

Concentrations of /sup 113m/Cd in the marine environment

Energy Technology Data Exchange (ETDEWEB)

Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.

1980-09-18

Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.

A 10kW series resonant converter design, transistor characterization, and base-drive optimization

Science.gov (United States)

Robson, R.; Hancock, D.

1981-01-01

Transistors are characterized for use as switches in resonant circuit applications. A base drive circuit to provide the optimal base drive to these transistors under resonant circuit conditions is developed and then used in the design, fabrication and testing of a breadboard, spaceborne type 10 kW series resonant converter.

23 CFR 636.113 - Is the stipend amount eligible for Federal participation?

Science.gov (United States)

2010-04-01

... ENGINEERING AND TRAFFIC OPERATIONS DESIGN-BUILD CONTRACTING General § 636.113 Is the stipend amount eligible.... (b) Unless prohibited by State law, you may retain the right to use ideas from unsuccessful offerors... the stipend to qualifying offerors. The acceptance of any stipend must be optional on the part of the...

9 CFR 113.329 - Newcastle Disease Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...

9 CFR 113.106 - Clostridium Chauvoei Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...

9 CFR 113.107 - Clostridium Haemolyticum Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...

9 CFR 113.306 - Canine Distemper Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...

9 CFR 113.302 - Distemper Vaccine-Mink.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...

Contribution of type W human endogenous retroviruses to the human genome: characterization of HERV-W proviral insertions and processed pseudogenes.

Science.gov (United States)

Grandi, Nicole; Cadeddu, Marta; Blomberg, Jonas; Tramontano, Enzo

2016-09-09

Human endogenous retroviruses (HERVs) are ancient sequences integrated in the germ line cells and vertically transmitted through the offspring constituting about 8 % of our genome. In time, HERVs accumulated mutations that compromised their coding capacity. A prominent exception is HERV-W locus 7q21.2, producing a functional Env protein (Syncytin-1) coopted for placental syncytiotrophoblast formation. While expression of HERV-W sequences has been investigated for their correlation to disease, an exhaustive description of the group composition and characteristics is still not available and current HERV-W group information derive from studies published a few years ago that, of course, used the rough assemblies of the human genome available at that time. This hampers the comparison and correlation with current human genome assemblies. In the present work we identified and described in detail the distribution and genetic composition of 213 HERV-W elements. The bioinformatics analysis led to the characterization of several previously unreported features and provided a phylogenetic classification of two main subgroups with different age and structural characteristics. New facts on HERV-W genomic context of insertion and co-localization with sequences putatively involved in disease development are also reported. The present work is a detailed overview of the HERV-W contribution to the human genome and provides a robust genetic background useful to clarify HERV-W role in pathologies with poorly understood etiology, representing, to our knowledge, the most complete and exhaustive HERV-W dataset up to date.

Physics design of a 10 MeV, 6 kW travelling wave electron linac

Indian Academy of Sciences (India)

We present the physics design of a 10 MeV, 6 kW S-band (2856 MHz) electron linear accelerator (linac), which has been recently built and successfully operated at Raja Ramanna Centre for Advanced Technology, Indore. The accelerating structure is a 2 π / 3 mode constant impedance travelling wave structure, which ...

Design, Fabrication, and Performance Test of a 100-W Helical-Blade Vertical-Axis Wind Turbine at Low Tip-Speed Ratio

Directory of Open Access Journals (Sweden)

Dowon Han

2018-06-01

Full Text Available A 100-W helical-blade vertical-axis wind turbine was designed, manufactured, and tested in a wind tunnel. A relatively low tip-speed ratio of 1.1 was targeted for usage in an urban environment at a rated wind speed of 9 m/s and a rotational speed of 170 rpm. The basic dimensions were determined through a momentum-based design method according to the IEC 61400-2 protocol. The power output was estimated by a mathematical model that takes into account the aerodynamic performance of the NACA0018 blade shape. The lift and drag of the blade with respect to the angle of attack during rotation were calculated using 2D computational fluid dynamics (CFD simulation to take into account stall region. The average power output calculated by the model was 108.34 W, which satisfies the target output of 100 W. The manufactured wind turbine was tested in a large closed-circuit wind tunnel, and the power outputs were measured for given wind speeds. At the design condition, the measured power output was 114.7 W, which is 5.9% higher than that of the mathematical model. This result validates the proposed design method and power estimation by the mathematical model.

Detailed Design of Cooling Water System for Cold Neutron Source in HANARO

Energy Technology Data Exchange (ETDEWEB)

Kim, Bong Soo; Choi, Jung Woon; Kim, Y. K.; Wu, S. I.; Lee, Y. S

2007-04-15

To make cold neutron, a cryogenic refrigerator is necessary to transform moderator into cryogenic state so, thermal neutron is changed into cold neutron through heat transfer with moderator. A cryogenic refrigerator mainly consists of two apparatus, a helium compressor and a cold box which needs supply of cooling water. Therefore, cooling water system is essential to operate of cryogenic refrigerator normally. This report is mainly focused on the detailed design of the cooling water system for the HANARO cold neutron source, and describes design requirement, calculation, specification of equipment and water treatment method.

Detailed Design of Cooling Water System for Cold Neutron Source in HANARO

International Nuclear Information System (INIS)

Kim, Bong Soo; Choi, Jung Woon; Kim, Y. K.; Wu, S. I.; Lee, Y. S.

2007-04-01

To make cold neutron, a cryogenic refrigerator is necessary to transform moderator into cryogenic state so, thermal neutron is changed into cold neutron through heat transfer with moderator. A cryogenic refrigerator mainly consists of two apparatus, a helium compressor and a cold box which needs supply of cooling water. Therefore, cooling water system is essential to operate of cryogenic refrigerator normally. This report is mainly focused on the detailed design of the cooling water system for the HANARO cold neutron source, and describes design requirement, calculation, specification of equipment and water treatment method

kW-class direct diode laser for sheet metal cutting based on commercial pump modules

Science.gov (United States)

Witte, U.; Schneider, F.; Holly, C.; Di Meo, A.; Rubel, D.; Boergmann, F.; Traub, M.; Hoffmann, D.; Drovs, S.; Brand, T.; Unger, A.

2017-02-01

We present a direct diode laser with an optical output power of more than 800 W ex 100 μm with an NA of 0.17. The system is based on 6 commercial pump modules that are wavelength stabilized by use of VBGs. Dielectric filters are used for coarse and dense wavelength multiplexing. Metal sheet cutting tests were performed in order to prove system performance and reliability. Based on a detailed analysis of loss mechanisms, we show that the design can be easily scaled to output powers in the range of 2 kW and to an optical efficiency of 80%.

Design criteria document, Fire Protection Task, K Basin Essential Systems Recovery, Project W-405

International Nuclear Information System (INIS)

Johnson, B.H.

1994-01-01

The K Basin were constructed in the early 1950's with a 20 year design life. The K Basins are currently in their third design life and are serving as a near term storage facility for irradiated N Reactor fuel until an interim fuel storage solution can be implemented. In April 1994, Project W-405, K Basin Essential Systems Recovery, was established to address (among other things) the immediate fire protection needs of the 100K Area. A Fire Barrier Evaluation was performed for the wall between the active and inactive areas of the 105KE and 105KW buildings. This evaluation concludes that the wall is capable of being upgraded to provide an equivalent level of fire resistance as a qualified barrier having a fire resistance rating of 2 hours. The Fire Protection Task is one of four separate Tasks included within the scope of Project W405, K Basin Essential systems Recovery. The other three Tasks are the Water Distribution System Task, the Electrical System Task, and the Maintenance Shop/Support Facility Task. The purpose of Project W-405's Fire Protection Task is to correct Life Safety Code (NFPA 101) non-compliances and to provide fire protection features in Buildings 105KE, 105KW and 190KE that are essential for assuring the safe operation and storage of spent nuclear fuel at the 100K Area Facilities' Irradiated Fuel Storage Basins (K Basins)

Investigations on the indium-113m isotope generators

International Nuclear Information System (INIS)

Oniciu, L.; Veglia, A.

1975-01-01

Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)

A novel DWDM method to design a 100-kW Laser

Science.gov (United States)

Basu, Santanu

2010-02-01

In this paper, I will present the design analysis of a novel concept that may be used to generate a diffraction-limited beam from an aperture so that as much as 450 kW of laser power can be efficiently deposited on a diffraction-limited spot at a range. The laser beam will be comprised of many closely spaced wavelength channels as in a DWDM. The technique relies on the ability of an angular dispersion amplifier to multiplex a large number of high power narrow frequency lasers, wavelengths of which may be as close as 0.4 nm.

13 CFR 113.3-3 - Structural accommodations for handicapped clients.

Science.gov (United States)

2010-01-01

... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...

GIS-assisted spatial analysis for urban regulatory detailed planning: designer's dimension in the Chinese code system

Science.gov (United States)

Yu, Yang; Zeng, Zheng

2009-10-01

By discussing the causes behind the high amendments ratio in the implementation of urban regulatory detailed plans in China despite its law-ensured status, the study aims to reconcile conflict between the legal authority of regulatory detailed planning and the insufficient scientific support in its decision-making and compilation by introducing into the process spatial analysis based on GIS technology and 3D modeling thus present a more scientific and flexible approach to regulatory detailed planning in China. The study first points out that the current compilation process of urban regulatory detailed plan in China employs mainly an empirical approach which renders it constantly subjected to amendments; the study then discusses the need and current utilization of GIS in the Chinese system and proposes the framework of a GIS-assisted 3D spatial analysis process from the designer's perspective which can be regarded as an alternating processes between the descriptive codes and physical design in the compilation of regulatory detailed planning. With a case study of the processes and results from the application of the framework, the paper concludes that the proposed framework can be an effective instrument which provides more rationality, flexibility and thus more efficiency to the compilation and decision-making process of urban regulatory detailed plan in China.

Strong tW Scattering at the LHC

CERN Document Server

Dror, Jeff Asaf; Salvioni, Ennio; Serra, Javi

2016-01-01

Deviations of the top electroweak couplings from their Standard Model values imply that certain amplitudes for the scattering of third generation fermions and longitudinally polarized vector bosons or Higgses diverge quadratically with momenta. This high-energy growth is a genuine signal of models where the top quark is strongly coupled to the sector responsible for electroweak symmetry breaking. We propose to profit from the high energies accessible at the LHC to enhance the sensitivity to non-standard top-$Z$ couplings, which are currently very weakly constrained. To demonstrate the effectiveness of the approach, we perform a detailed analysis of $tW \\to tW$ scattering, which can be probed at the LHC via $pp\\to t\\bar{t}Wj$. By recasting a CMS analysis at 8 TeV, we derive the strongest direct bounds to date on the $Ztt$ couplings. We also design a dedicated search at 13 TeV that exploits the distinctive features of the $t\\bar{t}Wj$ signal. Finally, we present other scattering processes in the same class that...

75 FR 10026 - Proposed Collection; Comment Request for Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR...

Science.gov (United States)

2010-03-04

... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...

48 CFR 18.113 - Interagency acquisitions under the Economy Act.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...

40 CFR 63.113 - Process vent provisions-reference control technology.

Science.gov (United States)

2010-07-01

... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

9 CFR 113.64 - General requirements for live bacterial vaccines.

Science.gov (United States)

2010-01-01

... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...

Test result of 5 GHz, 500 kW CW prototype klystron for KSTAR LHCD system

Energy Technology Data Exchange (ETDEWEB)

Do, H., E-mail: heejindo@nfri.re.kr [Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Park, S. [Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Jeong, J.H.; Bae, Y.S.; Yang, H.L. [National Fusion Research Institute, Daejeon 350-333 (Korea, Republic of); Delpech, L.; Magne, R.; Hoang, G.T. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Park, H.; Cho, M.H.; Namkung, W. [Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of)

2011-10-15

A 5 GHz LHCD system is being designed for current drive and profile modification necessary for AT mode and steady-state operation of the KSTAR tokamak. A prototype 500 kW CW klystron operating at 5 GHz was developed for the steady-state RF source. In this klystron, a multi-cell cavity is introduced to reduce cavity voltage and ohmic power loss. The klystron is designed with a triode system for optimization of gain, efficiency and beam control. The high voltage for the cathode is turned by using a thyristor switching system at the low voltage transformer unit. For anode voltage control, a mod-anode voltage divider system is used which utilize the parallel-circuit of the FET switch and Zener diodes. The RF output power of the klystron was 300 kW for 800 s and 450 kW for 20 s. The maximal temperature at collector top surface was 83 deg. C and power loss at the tube body did not exceed 10 kW, the interlock level for the protection of the klystron. Detailed results of the klystron system test and commissioning are presented.

MOD-0A 200 kW wind turbine generator design and analysis report

Science.gov (United States)

Anderson, T. S.; Bodenschatz, C. A.; Eggers, A. G.; Hughes, P. S.; Lampe, R. F.; Lipner, M. H.; Schornhorst, J. R.

1980-01-01

The design, analysis, and initial performance of the MOD-OA 200 kW wind turbine generator at Clayton, NM is documented. The MOD-OA was designed and built to obtain operation and performance data and experience in utility environments. The project requirements, approach, system description, design requirements, design, analysis, system tests, installation, safety considerations, failure modes and effects analysis, data acquisition, and initial performance for the wind turbine are discussed. The design and analysis of the rotor, drive train, nacelle equipment, yaw drive mechanism and brake, tower, foundation, electricl system, and control systems are presented. The rotor includes the blades, hub, and pitch change mechanism. The drive train includes the low speed shaft, speed increaser, high speed shaft, and rotor brake. The electrical system includes the generator, switchgear, transformer, and utility connection. The control systems are the blade pitch, yaw, and generator control, and the safety system. Manual, automatic, and remote control are discussed. Systems analyses on dynamic loads and fatigue are presented.

High performance W-AIN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management

2004-01-25

High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)

32 CFR Appendix A to Part 113 - Certificate of Compliance

Science.gov (United States)

2010-07-01

... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...

46 CFR 113.35-9 - Mechanical engine order telegraph systems.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...

27 CFR 40.113 - Change in location to another region.

Science.gov (United States)

2010-04-01

... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...

9 CFR 113.300 - General requirements for live virus vaccines.

Science.gov (United States)

2010-01-01

... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...

13 CFR 113.520 - Job classification and structure.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...

Ocean Observing at Axial Seamount: Details of the Current OOI-RSN Design Within the Context of the April 2011 Eruption

Science.gov (United States)

Proskurowski, G.; Kelley, D. S.; Fundis, A. T.; Kawka, O.; Denny, G. F.; Delaney, J. R.

2011-12-01

In 2013, the NSF's Ocean Observatories Initiative (OOI) will deploy 22 instrument suites within the caldera of Axial Seamount as part of the cabled observatory component implemented by the Regional Scale Nodes (RSN) at the University of Washington. The cabled infrastructure will initially provide Axial caldera with a total of 8kW of power and 11Gbps of data bandwidth. Only an approximate 20% fraction will be used by "core instrumentation"-instrumentation supported and maintained by OOI-RSN. Thus, the OOI provided infrastructure is highly, and readily, expandable to include community-generated instrumention once the system is commissioned and begins operations in early 2015. Here we present the details of the current design of the cabled observatory at Axial Seamount, including locations of instruments, data products, and sampling rates placed in the context of meter scale resolution bathymetry and down-looking photomosaics of the experimental sites. The April 2011 Axial eruption is a demonstration of the importance of transmitting seismic, video, and vent fluid chemistry information in real-time. The eruptive event, or series of events, in April 2011 went undetected until a series of ROV/AUV cruises, planned separately and years in advance, made observations to discover, confirm, and detail the transformation to Axial (see Chadwick et al., this session). What transpired during, and shortly after, the eruption will remain largely unknown, as the initial extraordinary fluxes of heat, chemistry and biology will have decayed in the intervening three and a half months. Here we detail the response capabilities of the OOI-RSN cabled observatory to a future eruptive event under two scenarios-as built, and an expanded version using existing technology.

Measurement of the W mass at LEP

CERN Document Server

Przysiezniak, H

2000-01-01

The mass of the W boson is measured using W pair events collected with the ALEPH, DELPHI, L3 and OPAL detectors at LEP2. Three methods are used: the cross section method, the lepton energy spectrum method and the direct reconstruction method, where the latter is described more in detail. For data collected at E/sub cm/=161, 172 and 183 GeV, the following combined preliminary result is obtained: M/sub W//sup LEP/=80.37+or-0.08 GeV/c/sup 2/. (5 refs).

Design review report: AN valve pit upgrades for Project W-314, tank farm restoration and safe operations

International Nuclear Information System (INIS)

Boes, K.A.

1998-01-01

This Design Review Report (DRR) documents the contractor design verification methodology and records associated with project W-314's AN Valve Pit Upgrades design package. The DRR includes the documented comments and their respective dispositions for this design. Acceptance of the comment dispositions and closure of the review comments is indicated by the signatures of the participating reviewers. Project W-314, Tank Farm Restoration and Safe Operations, is a project within the Tank Waste Remediation System (TWRS) Tank Waste Retrieval Program. This project provides capital upgrades for the existing Hanford tank farms' waste transfer, instrumentation, ventilation, and electrical infrastructure systems. To support established TWRS programmatic objectives, the project is organized into two distinct phases. The initial focus of the project (i.e., Phase 1) is on waste transfer system upgrades needed to support the TWRS Privatization waste feed delivery system. Phase 2 of the project will provide upgrades to support resolution of regulatory compliance issues, improve tank infrastructure reliability, and reduce overall plant operating/maintenance costs. Within Phase 1 of the W-314 project, the waste transfer system upgrades are further broken down into six major packages which align with the project's work breakdown structure. Each of these six sub-elements includes the design, procurement, and construction activities necessary to accomplish the specific tank farm upgrades contained within the package. The first package to be performed is the AN Valve Pit Upgrades package. The scope of the modifications includes new pit cover blocks, valve manifolds, leak detectors, transfer line connections (for future planned transfer lines), and special protective coating for the 241-AN-A and 241-AN-B valve pits

9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...

21 CFR 211.113 - Control of microbiological contamination.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...

Performance of Fluidized bed Fenton process in Degrading Acid Blue 113

Science.gov (United States)

Bello, M. M.; Raman, A. A.

2017-06-01

The performance of a fluidized bed Fenton process in degrading Acid Blue 113 (AB 113) was investigated. Fluidized bed Fenton process is a modification of conventional Fenton oxidation, aimed at reducing sludge generation and improving process performance. Response surface methodology was used to study the effects of operational parameter on the color removal from the dye. Dimensionless factors, Dye/Fe2+, H2O2/Fe2+ and pH were used as the independent variables in Box-Behnken Design (BDD). Reduced quadratic model was developed to predict the color removal. The process could remove up to 99 % of the initial color. The most significant factor for color removal was found to be Dye/Fe2+, followed by H2O2/Fe2+. Unlike conventional Fenton, the initial pH of the solution does not have a significant effect on the color removal.

Design overview of the ITER core CXRS fast shutter and manufacturing implications during the detailed design work

Energy Technology Data Exchange (ETDEWEB)

Castaño Bardawil, David Antonio, E-mail: d.castano.bardawil@fz-juelich.de [Institute of Energy and Climate Research – Plasma Physics, Forschungszentrum Jülich GmbH (Germany); Mertens, Philippe [Institute of Energy and Climate Research – Plasma Physics, Forschungszentrum Jülich GmbH (Germany); Offermanns, Guido; Behr, Wilfried [Central Institute for Engineering, Electronics and Analytics, Forschungszentrum Jülich GmbH (Germany); Hawkes, Nick [Culham Centre for Fusion Energy (Germany); Krasikov, Yury [Institute of Energy and Climate Research – Plasma Physics, Forschungszentrum Jülich GmbH (Germany); Balboa, Itziar [Culham Centre for Fusion Energy (Germany); Biel, Wolfgang; Samm, Ulrich [Institute of Energy and Climate Research – Plasma Physics, Forschungszentrum Jülich GmbH (Germany)

2015-10-15

Highlights: • Keeping key parameters during design has facilitated quick iteration assessment. • Proper pipe bending and welding procedures were established for manufacturing. • Bellows assemblies and manufacturing were adequately defined for the actuator. • Successful cooperation between our in-house workshop and the industry. • Full shutter manufacturing drawings were successfully developed. - Abstract: At first a detailed fast shutter design was finalized for the ITER core charge exchange recombination spectroscopy (CXRS) diagnostic. The shutter has approximately 70 kg of mass and a length of 2.1 m. It operates in fractions of a second (0.7 s) protecting critical optical components against degradation and providing means of calibration for the optical system. The shutter structure is driven by a bidirectional frictionless helium actuator, with forces and axial strokes of 3.4 kN and 2 mm respectively. The shutter structure consists of: (a) two blades made of CuCrZr and stainless steel, calibration surfaces (currently Al{sub 2}O{sub 3}) on the top and on the bottom a protective TZM (Mo–0.5Ti–0.08Zr) screens, (b) two arms interconnected that form one cooling circuit including the blades, (c) a bumper system to limit the arms movement, and (d) a support. A description of these components and their functions are given in this paper, followed by some issues, and their corresponding solutions or ongoing investigations, encountered during the design work. Detailed manufacturing drawings have been developed as the deliverable final product of this design stage, and are used in the prototyping phase which includes testing, numerical benchmarking, and validation of the shutter concept.

9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...

9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...

9 CFR 113.206 - Wart Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...

40 CFR 600.113-78 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...

40 CFR 600.113-88 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...

40 CFR 600.113-93 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...

Prototypical spent nuclear fuel rod consolidation equipment: Phase 2, Final design report: Volume 1, Detailed design

International Nuclear Information System (INIS)

Blissell, W.H.; Ciez, A.P.; Goedicke, F.E.; Bessko, C.

1987-01-01

This document describes the Westinghouse Final Design for the Prototypical Spent Fuel Consolidation Equipment Demonstration Project. This design represents a fully qualified, licensable, cost effective spent fuel rod consolidation system. As a result of significant concerns raised by DOE and its Technical Review Committee during the 30% Design Review, significant changes were made to the original Preliminary Design resulting from Phase I activities. These changes focused on increased automation, end fitting removal, the rod pulling process and the need to maintain the consolidation canisters as clean as possible. As a result of these changes, the new system is greatly enhanced with a much greater probability of meeting or exceeding the project functional requirements. As a result of delays in resolving cost and contractual differences, additional bench testing was not conducted during Phase II. It is however our belief that the current design exceeds the 90% confidence level required by DOE because of the confidence gained from the Phase I tests, the additional engineering detail completed and the fact that our rod pulling tool has been demonstrated in a similar application at Oconee while our ID tube cutter is a modified (mounting method only) off-the-shelf design. 7 refs., 49 figs., 36 tabs

Detailed design of the RF source for the 1 MV neutral beam test facility

International Nuclear Information System (INIS)

Marcuzzi, D.; Palma, M. Dalla; Pavei, M.; Heinemann, B.; Kraus, W.; Riedl, R.

2009-01-01

In the framework of the EU activities for the development of the Neutral Beam Injector for ITER, the detailed design of the Radio Frequency (RF) driven negative ion source to be installed in the 1 MV ITER Neutral Beam Test Facility (NBTF) has been carried out. Results coming from ongoing R and D on IPP test beds [A. Staebler et al., Development of a RF-Driven Ion Source for the ITER NBI System, this conference] and the design of the new ELISE facility [B. Heinemann et al., Design of the Half-Size ITER Neutral Beam Source Test Facility ELISE, this conference] brought several modifications to the solution based on the previous design. An assessment was carried out regarding the Back-Streaming positive Ions (BSI+) that impinge on the back plates of the ion source and cause high and localized heat loads. This led to the redesign of most heated components to increase cooling, and to different choices for the plasma facing materials to reduce the effects of sputtering. The design of the electric circuit, gas supply and the other auxiliary systems has been optimized. Integration with other components of the beam source has been revised, with regards to the interfaces with the supporting structure, the plasma grid and the flexible connections. In the paper the design will be presented in detail, as well as the results of the analyses performed for the thermo-mechanical verification of the components.

A determination of the mass and width of the W boson at LEP2

CERN Document Server

Palacios, J P

2001-01-01

During 1998 and 1999 LEP produced electron-positron collisions at centre of mass energies ranging between 189 and 202 GeV. An integrated luminosity of 372 pb sup - sup 1 was collected by the DELPHI experiment during this period. From these data, samples of events with e nu-bar sub e qq-bar', mu nu-bar submu qq-bar' and tau nu-bar subtau qq-bar' final states were selected. These were analysed to obtain values for the mass and width of the W boson using the method of invariant mass direct reconstruction. Combining the results obtained for both running periods and the three l nu-bar sub l qq-bar' channels, the following values are obtained: M sub w = 80.308 +- 0.113 (stat) +- 0.038 (syst) GeV GAMMA sub w = 1.857 +- 0.298 (stat) +- 0.155 (syst) GeV

9 CFR 113.209 - Rabies Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...

9 CFR 202.113 - Rule 13: Written hearing.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...

13 CFR 113.455 - Textbooks and curricular material.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...

27 CFR 11.3 - Application.

Science.gov (United States)

2010-04-01

... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...

9 CFR 113.312 - Rabies Vaccine, Live Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...

9 CFR 113.38 - Guinea pig safety test.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...

Conceptual design report, 219-S secondary containment upgrade, Project W-178

International Nuclear Information System (INIS)

Beyer, J.J.

1993-05-01

The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000

Measurement of the Standard Model W+W- production cross-section using the ATLAS experiment on the LHC

International Nuclear Information System (INIS)

Zeman, Martin

2014-01-01

Measurements of di-boson production cross-sections are an important part of the physics programme at the CERN Large Hadron Collider. These physics analyses provide the opportunity to probe the electroweak sector of the Standard Model at the TeV scale and could also indicate the existence of new particles or probe beyond the Standard Model physics. The excellent performance of the LHC through years 2011 and 2012 allowed for very competitive measurements. This thesis provides a comprehensive overview of the experimental considerations and methods used in the measurement of the W + W - production cross-section in proton-proton collisions at √s = 7 TeV and 8 TeV. The treatise covers the material in great detail, starting with the introduction of the theoretical framework of the Standard Model and follows with an extensive discussion of the methods implemented in recording and reconstructing physics events in an experiment of this magnitude. The associated online and offline software tools are included in the discussion. The relevant experiments are covered, including a very detailed section about the ATLAS detector. The final chapter of this thesis contains a detailed description of the analysis of the W-pair production in the leptonic decay channels using the datasets recorded by the ATLAS experiment during 2011 and 2012 (Run I). The analyses use 4.60 fb -1 recorded at √s = 7 TeV and 20.28 fb -1 recorded at 8 TeV. The experimentally measured cross section for the production of W bosons at the ATLAS experiment is consistently enhanced compared to the predictions of the Standard Model at centre-of-mass energies of 7 TeV and 8 TeV. The thesis concludes with the presentation of differential cross-section measurement results. (author) [fr

Author Details

African Journals Online (AJOL)

Medugu, D W. Vol 18, No 2 (2006) - Articles Design and development of solar still for effectiveness in eliminating microbial contamination and salt in Mubi, Adamawa State, Nigeria Abstract PDF. ISSN: 1595-0611. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

Conceptual design of pellet charge eXchange (PCX) diagnostics for stellarator W7-X

International Nuclear Information System (INIS)

Sergeev, Y.Yu; Kuteev, B.V.; Bakhareva, O.A.; Kostrukov, A.Y.; Skokov, V.G.; Petrov, M.P.; Kislyakov, A.I.; Burhenn, R.; Kick, M.

2002-01-01

Pellet Charge eXchange diagnostic using Li pellets has been considered for the W7-X machine. Geometry of the experimental set-up and parameters of both lithium pellet injector (LPI) and neutral particle analyser (NPA) were evaluated. It was shown that this diagnostics can provide very well detectable H 0 signal in the range 50 - 1000 keV generated by RF driven H + minority ions in W7-X. The PCX diagnostics will be able to measure H + energy spectra and density profiles in wide range of W7-X plasma parameters. The proposed NPA can be designed on a basis of the NPA ISEP (Ioffe institute) installed now on JET. A pellet light-gas gun can be used to accelerate Li pellets of 2 - 3 mm in size up to 1 km/s velocities. That provides the required pellet penetration into the plasma core. Due to sticky problems with Li operation, a special technique of loading and keeping the pellets in a charger unit of LPI has to be developed. Development of PCX diagnostics for absolute measurements of the confined minority protons requires improvement of the pellet ablation model used. Knowledge of the cloud dimensions and density distributions of different charge states of ions is of special interest. It is necessary to improve predictions of pellet penetrations in non-Maxwellian plasmas as well. An optical system for measurements of pellet cloud density profiles should be foreseen on W7-X. (orig.)

Design, Construction and Operation of a Molten Carbonate Fuel Cell (MCFC) in the 100-kW-Class

International Nuclear Information System (INIS)

Heiming, Andreas; Huppmann, Gerhard; Aasberg-Petersen, Kim

1999-01-01

In fuel cells, the electrochemical energy of the fuel is converted directly into electricity and heat. The electrochemical conversion is inherently related to high electrical efficiencies and very low pollutant emissions. Fuel cells with sufficiently high operating temperatures such as (1) the phosphoric acid fuel cell (PAFC), operating temperature: 200 o C, (2) the molten carbonate fuel cell (MCFC), operating temperature: 650 o C and (3) the solid oxide fuel cell (SOFC), operating temperature: around 900 o C are best suited for decentralised combined heat and power (CHP) applications. This is due to the fact, that the heat of the exothermic reaction taking place in the fuel cell can be used in the domestic, commercial and industrial sector for heating and hot water or steam production. At the present time, gas-engines or gas-turbines are the preferred CHP-technologies for these applications. Nowadays, the PAFC is commercially available. More than 160 plants, each with a power of 200 kW, have been installed world-wide. Ruhrgas has investigated the behaviour of a 200 kW PAFC at its research centre in Dorsten, Germany, and at the site of a local utility. High temperature fuel cells such as MCFC or SOFC promise electrical efficiencies above 50 % in simple cycle mode. Up to now, MCFC-test plants have been built and operated in the 100 kW to 1 MW power range. The largest MCFC ever operated consisted of 16 identical stacks of 125 kW each, resulting in a plant power of 2 MW. The initial experience with SOFC in this power-range is currently gained from the operation of a 100 kW plant. In this paper, the result of the construction and operation of a highly innovatively designed 280 kW MCFC will be presented. This plant has been designed, built and operated by a European consortium for the development and market introduction of the MCFC. Members of the consortium are MTU-Friedrichshafen GmbH, Haldor Topsoee NS, Elkraft A.m.b.H., RWE Energie AG and Ruhrgas AG. (author)

High performance W-AlN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Zhang, Qi-Chu [School of Physics, The University of Sydney, Sydney, NSW 2006 (Australia); Shen, Y.G. [Department of Manufacturing Engineering and Engineering Management, City University of Hong Kong (Hong Kong)

2004-01-25

High solar performance W-AlN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric function and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80C have been achieved for deposited W-AlN cermet solar coatings.

Boosted W/Z Tagging at ATLAS

CERN Document Server

Dattagupta, Aparajita; The ATLAS collaboration

2016-01-01

A detailed study of the techniques for identifying boosted hadronically decaying W or Z bosons is presented. The best performing algorithm for reconstructing, grooming and tagging bosonic jets as seen in studies using 8 TeV data and simulation is validated for W bosons with a wide range of transverse momenta using 13 TeV data and MC simulations. The same is studied for Z bosons in 13 TeV MC simulation. Improvement in tagger performance using detector tracking information is also studied. In addition, given that a hadronic jet has been identified as resulting from the hadronic decay of a W or Z, a technique is developed to discriminate between W and Z bosons using 8 TeV data. The alternative of using variable-R jets for capturing the hadronic decay products compared to standard techniques is also discussed.

Physics design of a 10 MeV, 6 kW travelling wave electron linac for ...

Indian Academy of Sciences (India)

2016-10-11

Oct 11, 2016 ... We present the physics design of a 10 MeV, 6 kW S-band (2856 MHz) electron linear ... linac (in contrast with standing wave linac) is that it accepts the RF power over a band of frequencies. Three- ... structures are preferred for relatively higher energy ... klystron in a TW linac, which results in cost reduction.

49 CFR 215.113 - Defective plain bearing wedge.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...

19 CFR 113.55 - Cancellation of export bonds.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...

Design of a DC-AC Link Converter for 500W Residential Wind Generator

Directory of Open Access Journals (Sweden)

Riza Muhida

2012-12-01

Full Text Available  As one of alternative sources of renewable energy, wind energy has an excellence prospect in Indonesia, particularly in coastal and hilly areas which have potential wind to generate electricity for residential uses. There is urgent need to locally develop low cost inverter of wind generator system for residential use. Recent developments in power electronic converters and embedded computing allow improvement of power electronic converter devices that enable integration of microcontrollers in its design. In this project, an inverter circuit with suitable control scheme design was developed. The circuit was to be used with a selected topology of Wind Energy Conversion System (WECS to convert electricity generated by a 500W direct-drive permanent magnet type wind generator which is typical for residential use. From single phase AC output of the generator, a rectifier circuit is designed to convert AC to DC voltage. Then a DC-DC boost converter is used to step up the voltage to a nominal DC voltage suitable for domestic use. The proposed inverter then will convert the DC voltage to sinusoidal AC. The duty cycle of sinusoidal Pulse-Width Modulated (SPWM signal controlling switches in the inverter was generated by a microcontroller. The lab-scale experimental rig involves simulation of wind generator by running a geared DC motor coupled with 500W wind generator where the prototype circuit was connected at the generator output. The experimental circuit produced single phase 240V sinusoidal AC voltage with frequency of 50Hz. Measured total harmonics distortion (THD of the voltage across load was 4.0% which is within the limit of 5% as recommended by IEEE Standard 519-1992.

Design requirements document for Project W-465, immobilized low-activity waste interim storage

International Nuclear Information System (INIS)

Burbank, D.A.

1998-01-01

The scope of this Design Requirements Document (DRD) is to identify the functions and associated requirements that must be performed to accept, transport, handle, and store immobilized low-activity waste (ILAW) produced by the privatized Tank Waste Remediation System (TWRS) treatment contractors. The functional and performance requirements in this document provide the basis for the conceptual design of the TWRS ILAW Interim Storage facility project and provides traceability from the program level requirements to the project design activity. Technical and programmatic risk associated with the TWRS planning basis are discussed in the Tank Waste Remediation System Decisions and Risk Assessment (Johnson 1994). The design requirements provided in this document will be augmented by additional detailed design data documented by the project

Multi-kW single fiber laser based on an extra large mode area fiber design

Science.gov (United States)

Langner, Andreas; Such, Mario; Schötz, Gerhard; Just, Florian; Leich, Martin; Schwuchow, Anka; Grimm, Stephan; Zimer, Hagen; Kozak, Marcin; Wedel, Björn; Rehmann, Georg; Bachert, Charley; Krause, Volker

2012-02-01

The quality of Yb-doped fused bulk silica produced by sintering of Yb-doped fused silica granulates has improved greatly in the past five years [1 - 4]. In particular, the refractive index and doping level homogeneity of such materials are excellent and we achieved excellent background fiber attenuation of the active core material down to about 20 dB/km at 1200 nm. The improvement of the Yb-doped fused bulk silica has enabled the development of multi-kW fiber laser systems based on a single extra large multimode laser fiber (XLMA fiber). When a single active fiber is used in combination with the XLMA multimode fiber of 1200 μm diameter simple and robust high power fiber laser setups without complex fiber coupling and fiber combiner systems become possible. In this papper, we will discuss in detail the development of the core material based on Yb-doped bulk silica and the characterization of Yb-doped fibers with different core compositions. We will also report on the excellent performance of a 4 kW fiber laser based on a single XLMA-fiber and show the first experimental welding results of steel sheets achieved with such a laser.

9 CFR 113.6 - Animal and Plant Health Inspection Service testing.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing. A...

Compact Design of 10 kW Proton Exchange Membrane Fuel Cell Stack Systems with Microcontroller Units

Directory of Open Access Journals (Sweden)

Hsiaokang Ma

2014-04-01

Full Text Available In this study, fuel, oxidant supply and cooling systems with microcontroller units (MCU are developed in a compact design to fit two 5 kW proton exchange membrane fuel cell (PEMFC stacks. At the initial stage, the testing facility of the system has a large volume (2.0 m × 2.0 m × 1.5 m with a longer pipeline and excessive control sensors for safe testing. After recognizing the performance and stability of stack, the system is redesigned to fit in a limited space (0.4 m × 0.5 m × 0.8 m. Furthermore, the stack performance is studied under different hydrogen recycling modes. Then, two similar 5 kW stacks are directly coupled with diodes to obtain a higher power output and safe operation. The result shows that the efficiency of the 5 kW stack is 43.46% with a purge period of 2 min with hydrogen recycling and that the hydrogen utilization rate µf is 66.31%. In addition, the maximum power output of the twin-coupled module (a power module with two stacks in electrical cascade/parallel arrangement is 9.52 kW.

Design and cost analysis of 1 kW photovoltaic system based on actual performance in Indian scenario

Directory of Open Access Journals (Sweden)

Shahzad Ahsan

2016-09-01

Full Text Available The exhaustion of conventional resources and its effect on climate requires an urgent call for the substitute power resources to convene up the current power requirement. Solar energy is an endless, unsoiled and prospective energy source among all other nonconventional energy options. As more concentration is being done on focal point for the development of renewable energy capital globally. To ascertain their viability it is necessary to do the economic and technical assessments of these resources. This paper presents designing aspects and assessments of solar PV system based on field and actual performance. The study is based on design of solar PV system and a case study based on cost analysis of 1.0 kW off-grid photovoltaic energy system installed at Jamia Millia Islamia, New Delhi (28.5616° N, 77.2802° E, and about 293 m above sea level India. Both monthly and weekly costs of energy produced by the 1 kW PV system have been calculated. In addition, the solar PV 1 kW system can give internal rate of return of about 1.714% on investment. Based on assumptions used in this study, solar 1 kW PV system of Rs. 0.9724/kWh is estimated for a project with profitable life of 25 years with no other financial support. This translates to Rs. 80,000 payment over the livelier cost of energy of 1 kWh generated by the system. However, if the financial support is more than 50% of the initial investment cost, no further payment fee is necessary to support this type of system. Basically this system has been designed for small home located at the place of availability of grid power is rare. 1 kW PV solar system is also very useful in rural areas of India. India as a subcontinent receives great amounts of solar radiation annually.

Design criteria of the bolometer diagnostic for steady-state operation of the W7-X stellaratora

NARCIS (Netherlands)

Zhang, D.; Burhenn, R.; König, R.; Giannone, L.; Grodzki, P.A.; Klein, B.; Grosser, K.; Baldzuhn, J.; Ewert, K.; Erckmann, V.; Hirsch, M.; Laqua, H.P.; Oosterbeek, J.W.

2010-01-01

A bolometric diagnostic system with features necessary for steady-state operation in the superconducting stellarator W7-X was designed. During a pulse length of 1800 s with an ECRH (electron cyclotron resonance heating) power of 10 MW, the components suffer not only from a large thermal load but

Bovine serum albumin-catalyzed deprotonation of [1-(13)C]glycolaldehyde: protein reactivity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon.

Science.gov (United States)

Go, Maybelle K; Malabanan, M Merced; Amyes, Tina L; Richard, John P

2010-09-07

Bovine serum albumin (BSA) in D(2)O at 25 degrees C and pD 7.0 was found to catalyze the deuterium exchange reactions of [1-(13)C]glycolaldehyde ([1-(13)C]GA) to form [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA. The formation of [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA in a total yield of 51 +/- 3% was observed at early reaction times, and at later times, [1-(13)C,2-(2)H]GA was found to undergo BSA-catalyzed conversion to [1-(13)C,2,2-di-(2)H]GA. The overall second-order rate constant for these deuterium exchange reactions [(k(E))(P)] equals 0.25 M(-1) s(-1). By comparison, (k(E))(P) values of 0.04 M(-1) s(-1) [Go, M. K., Amyes, T. L., and Richard, J. P. (2009) Biochemistry 48, 5769-5778] and 0.06 M(-1) s(-1) [Go, M. K., Koudelka, A., Amyes, T. L., and Richard, J. P. (2010) Biochemistry 49, 5377-5389] have been determined for the wild-type- and K12G mutant TIM-catalyzed deuterium exchange reactions of [1-(13)C]GA, respectively, to form [1-(13)C,2,2-di-(2)H]GA. These data show that TIM and BSA exhibit a modest catalytic activity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon. We suggest that this activity is intrinsic to many globular proteins, and that it must be enhanced to demonstrate meaningful de novo design of protein catalysts of proton transfer at alpha-carbonyl carbon.

Design and experimental investigation of a second harmonic 20 kW class 28 GHz gyrotron for evaluation of new emitter technologies

Energy Technology Data Exchange (ETDEWEB)

Malygin, Anton

2016-07-01

Gyrotrons are high-power mm-wave tubes. Here, the design, construction and experimental investigation of a 20 kW, 28 GHz gyrotron (2nd harmonic) are reported. This tube was designed to evaluate new emitters for future highly efficient and reliable fusion gyrotrons and for material processing applications. Following experimental results have been achieved in CW operation: 22.5 kW output power at 23.4 kV electron beam voltage and 2.23 A beam current with the world record efficiency of 43 %.

Detail design of a 10.4-m stretched-membrane dish. Phase 2, Final report

Energy Technology Data Exchange (ETDEWEB)

1994-01-01

This report describes efforts conducted under Tasks 3 and 4 of the second phase of the project to develop a single-element stretched-membrane dish concept to reduce the cost of a high-performance concentrating solar collector. We completed the detailed design for such a collector suitable to drive a 25-kWe Stirling motor generator. The design includes the collectors, optical element, the drive, and support systems. The aperture of the optical element was sized to provide the required energy to the engine based on test data and analytical models of the concentrator receiver, and engine. The design of the optical element was improved based on experience gained from the design, fabrication, and testing of several prototypes.

Study of Flow Patterns in Radial and Back Swept Turbine Rotor under Design and Off-Design Conditions

OpenAIRE

Samip Shah; Salim Channiwala; Digvijay Kulshreshtha; Gaurang Chaudhari

2016-01-01

Paper details the numerical investigation of flow patterns in a conventional radial turbine compared with a back swept design for same application. The blade geometry of a designed turbine from a 25kW micro gas turbine was used as a baseline. A back swept blade was subsequently designed for the rotor, which departed from the conventional radial inlet blade angle to incorporate up to 25° inlet blade angle. A comparative numerical analysis between the two geometries is presented. While opera...

Design of the 3.7 GHz, 500 kW CW circulator for the LHCD system of the SST-1 tokamak

Energy Technology Data Exchange (ETDEWEB)

Dixit, Harish V., E-mail: hvdixit48@yahoo.com [Veermata Jijabai Technological Institute, Mumbai, Maharashtra 400019 (India); Jadhav, Aviraj R. [Veermata Jijabai Technological Institute, Mumbai, Maharashtra 400019 (India); Jain, Yogesh M. [Institute for Plasma Research, Gandhinagar, Gujarat 382428 (India); Homi Bhabha National Institute, Training School Complex, Anushakti Nagar, Mumbai 400094 (India); Cheeran, Alice N. [Veermata Jijabai Technological Institute, Mumbai, Maharashtra 400019 (India); Gupta, Vikas [Vidyavardhini' s College of Engineering and Technology, Vasai, Maharashtra 401202 (India); Sharma, P.K. [Institute for Plasma Research, Gandhinagar, Gujarat 382428 (India); Homi Bhabha National Institute, Training School Complex, Anushakti Nagar, Mumbai 400094 (India)

2017-06-15

Highlights: • Design of a 500 kW CW circulator for LHCD system at 3.7 GHz. • Mechanism for thermal management of ferrite tile. • Scheme for uniform magnetisation of the ferrite tiles. • Design of high CW power CW quadrature and 180 ° hybrid coupler. - Abstract: Circulators are used in high power microwave systems to protect the vacuum source against reflection. The Lower Hybrid Current Drive (LHCD) system of SST-1 tokamak commissioned at IPR, Gandhinagar in India comprises of four high power circulators to protect klystrons (supplying 500 kW CW each at 3.7 GHz) which power the system. This paper presents the design of a Differential Phase Shift Circulator (DPSC) capable of handling 500 kW CW power at 3.7 GHz so that four circulators can be used to protect the four available klystrons. As the DPSC is composed by three main components, viz., magic tee, ferrite phase shifter and 3 dB hybrid coupler, the designing of each of the proposed components is described. The design of these components is carried out factoring various multiphysics aspects of RF, heating due to high CW power and magnetic field requirement of the ferrite phase shifter. The primary objective of this paper is to present the complete RF, magnetic and thermal design of a high CW power circulator. All the simulations have been carried out in COMSOL Multiphysics. The designed circulator exhibits an insertion loss of 0.13 dB with a worst case VSWR of 1.08:1. The total length of the circulator is 3 m.

40 CFR 745.113 - Certification and acknowledgment of disclosure.

Science.gov (United States)

2010-07-01

... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...

PC-based Multiple Information System Interface (PC/MISI) detailed design and implementation plan

Science.gov (United States)

Dominick, Wayne D. (Editor); Hall, Philip P.

1985-01-01

The design plan for the personal computer multiple information system interface (PC/MISI) project is discussed. The document is intended to be used as a blueprint for the implementation of the system. Each component is described in the detail necessary to allow programmers to implement the system. A description of the system data flow and system file structures is given.

Design, integration and demonstration of a 50 W JP8/kerosene fueled portable SOFC power generator

Science.gov (United States)

Cheekatamarla, Praveen K.; Finnerty, Caine M.; Robinson, Charles R.; Andrews, Stanley M.; Brodie, Jonathan A.; Lu, Y.; DeWald, Paul G.

A man-portable solid oxide fuel cell (SOFC) system integrated with desulfurized JP8 partial oxidation (POX) reformer was demonstrated to supply a continuous power output of 50 W. This paper discusses some of the design paths chosen and challenges faced during the thermal integration of the stack and reformer in aiding the system startup and shutdown along with balance of plant and power management solutions. The package design, system capabilities, and test results of the prototype unit are presented.

Preliminary design of a tangentially viewing imaging bolometer for NSTX-U

Energy Technology Data Exchange (ETDEWEB)

Peterson, B. J., E-mail: peterson@LHD.nifs.ac.jp; Mukai, K. [National Institute for Fusion Science, Toki 509-5292 (Japan); SOKENDAI (The Graduate University for Advance Studies), Toki 509-5292 (Japan); Sano, R. [National Institutes for Quantum and Radiological Science and Technology, Naka, Ibaraki 311-0193 (Japan); Reinke, M. L.; Canik, J. M.; Lore, J. D.; Gray, T. K. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Delgado-Aparicio, L. F.; Jaworski, M. A. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States); Eden, G. G. van [FOM Institute DIFFER, 5612 AJ Eindhoven (Netherlands)

2016-11-15

The infrared imaging video bolometer (IRVB) measures plasma radiated power images using a thin metal foil. Two different designs with a tangential view of NSTX-U are made assuming a 640 × 480 (1280 × 1024) pixel, 30 (105) fps, 50 (20) mK, IR camera imaging the 9 cm × 9 cm × 2 μm Pt foil. The foil is divided into 40 × 40 (64 × 64) IRVB channels. This gives a spatial resolution of 3.4 (2.2) cm on the machine mid-plane. The noise equivalent power density of the IRVB is given as 113 (46) μW/cm{sup 2} for a time resolution of 33 (20) ms. Synthetic images derived from Scrape Off Layer Plasma Simulation data using the IRVB geometry show peak signal levels ranging from ∼0.8 to ∼80 (∼0.36 to ∼26) mW/cm{sup 2}.

9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...

Rola leptyny w regulacji metabolizmu lipidów i węglowodanów

Directory of Open Access Journals (Sweden)

Patrycja Gogga*

2011-01-01

Full Text Available Leptyna jest białkiem wydzielanym głównie przez tkankę tłuszczową, a jej stężenie we krwi jest ściśle związane z ilością zapasów energetycznych zgromadzonych w adipocytach. Jako hormon leptyna ma niezwykle szeroki zakres działania. Białko to bezpośrednio lub za pośrednictwem układu współczulnego bierze udział w regulacji metabolizmu energetycznego. Leptyna hamuje biosyntezę triacylogliceroli w wątrobie i tkance tłuszczowej, a także w mięśniach szkieletowych, obniżając tym samym ilość odkładanych w nich lipidów. W adipocytach leptyna zmniejsza ekspresję genów kodujących syntazę kwasów tłuszczowych (FAS i karboksylazę acetylo-CoA (ACC – główne enzymy szlaku biosyntezy kwasów tłuszczowych. Zwiększa z kolei ekspresję genu kodującego lipazę zależną od hormonów (HSL, co stymuluje hydrolizę triacylogliceroli w tkance tłuszczowej. Ponadto leptyna wzmaga utlenianie kwasów tłuszczowych w adipocytach, mięśniach szkieletowych oraz w mięśniu sercowym, wywołując wzrost ekspresji genów kodujących podstawowe dla tego procesu enzymy, palmitoilotransferazę karnitynową 1 (CPT1 i dehydrogenazę acylo-CoA o średniej długości łańcucha (MCAD. Wykazano również, że hormon ten zwiększa wrażliwość tkanek na insulinę i poprawia tolerancję glukozy – pod wpływem leptyny wzrasta transport glukozy do komórek oraz intensywność glikolizy.Wiadomo, że leptyna bierze udział w długoterminowej regulacji pobierania pokarmu, jednak coraz więcej badań wskazuje, że ma ona również wpływ na przemiany substratów energetycznych w tkankach obwodowych. Leptyna może zatem kontrolować homeostaz�� energetyczną organizmu wywołując zmiany metabolizmu lipidów i węglowodanów, przede wszystkim w tkance tłuszczowej i w mięśniach.

9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.

Science.gov (United States)

2010-01-01

..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...

76 FR 10899 - Decision To Evaluate a Petition To Designate a Class of Employees From the W.R. Grace and Company...

Science.gov (United States)

2011-02-28

... Employees From the W.R. Grace and Company in Curtis, MD, To Be Included in the Special Exposure Cohort... evaluate a petition to designate a class of employees from the W.R. Grace and Company in Curtis, Maryland... Compensation Program Act of 2000. The initial proposed definition for the class being evaluated, subject to...

13 CFR 113.535 - Effect of state or local law or other requirements.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...

Solid solubility in 1:13 phase of doping element for La(Fe,Si13 alloys

Directory of Open Access Journals (Sweden)

S. T. Zong

2016-05-01

Full Text Available The influences of Ni, Cr and Nb as substitution elements for Fe were investigated. The change in microstructure and the magnetic properties have been discussed in detail. Substitution elements Ni, Cr and Nb not only have limited solubility in NaZn13-type (1:13 phase, but also hinder the peritectoid reaction. Ni element mainly enters into La-rich phase while Cr element mainly concentrates in α-Fe phase, which both have detriment effect on the peritectoid reaction, leading to a large residual of impurity phases after annealing and a decrease of magnetic entropy change. Besides, Ni and Cr participated in peritectoid reaction by entering parent phases but slightly entering 1:13 phase, which would cause the disappearance of first order magnetic phase transition. A new phase (Fe,Si2Nb was found when Nb element substitutes Fe in La(Fe,Si13, suggesting that Nb does not participate in peritectoid reaction and only exists in (Fe,Si2Nb phase after annealing. The alloy with Nb substitution maintains the first order magnetic phase transition character.

14 CFR 1221.113 - Use of the NASA Flags.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...

27 CFR 22.113 - Receipt of tax-free alcohol.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal and...

9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.

Science.gov (United States)

2010-01-01

... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...

Simultaneous genotyping of HPA-17w to -21w by PCR-SSP in Chinese Cantonese.

Science.gov (United States)

Zhou, Haojie; Ding, Haoqiang; Chen, Yangkai; Li, Xiaofan; Ye, Xin; Nie, Yongmei

2015-01-01

Studies have reported the polymorphism of human platelet antigen (HPA)-17w, -18w, -19w, -20w, and -21w. However, the distribution of these five antigens in Chinese Cantonese is still unknown. In this study, we designed new sequence-specific primers for HPA-19w to -21w and used published primers for HPA-17w and -18w to develop a polymerase chain reaction with the sequence-specific primers (PCR-SSP) method for simultaneously genotyping HPA-17w to -21w. A total of 820 unrelated Cantonese apheresis platelet donors in Guangzhou were involved in this study. Among the five HPAs, complete a/a homozygosity was observed for HPA-17w to -20w with an allele frequency of 1.0000. For HPA-21w, nine individuals (9/820, 1.10%) were found to be HPA-21a/bw heterozygous and the allele frequencies of HPA-21a and HPA-21bw were 0.9945 (1631/1640) and 0.0055 (9/1640), respectively. The reliability of the PCR-SSP method was determined by comparing with the genotyping results by DNA sequencing, and no inconsistencies were observed between the two methods. This study provides a reliable PCR-SSP method for simultaneously genotyping HPA-17w to -21w and could improve HPA-matched platelet transfusion in Chinese Cantonese.

14 CFR 135.113 - Passenger occupancy of pilot seat.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...

7 CFR 760.113 - Refunds; joint and several liability.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...

Development and experiment of a 60 kW horizontal-axis marine current power system

International Nuclear Information System (INIS)

Xu, Quan-kun; Liu, Hong-wei; Lin, Yong-gang; Yin, Xiu-xing; Li, Wei; Gu, Ya-jing

2015-01-01

A 60 kW horizontal-axis marine current power system is designed, built and tested to provide potentially cost-competitive electrical power for residents in remote islands. This power system mainly consists of a three-bladed marine current turbine, a drive-train system, power electronics and a control console. The turbine blade parameters are reasonably calculated and optimized based on the blade element momentum theory. The hydrodynamic performances of this turbine are predicted over a wide range of operating conditions. An adequate drive-train system is carefully designed to make the marine power system work smoothly and quietly even under harsh marine current conditions. The control console is also developed to facilitate the condition monitoring and generator power and speed regulations for this power system by adequately controlling the onshore power electronics. This power system has been tested under real marine current conditions to thoroughly evaluate its dynamic characteristics and effectiveness. - Highlights: • A 60°kW horizontal-axis marine current power system is designed, built and tested. • Detailed design procedure and experimental data are provided. • Experimental results demonstrate high power convention efficiency of the system

Design and development of a 6 MW peak, 24 kW average power S-band klystron

Energy Technology Data Exchange (ETDEWEB)

Joshi, L.M.; Meena, Rakesh; Nangru, Subhash; Kant, Deepender; Pal, Debashis; Lamba, O.S.; Jindal, Vishnu; Jangid, Sushil Kumar, E-mail: joslm@rediffmail.com [Central Electronics Engineering Research Institute, Council of Scientific and Industrial Research, Pilani (India); Chakravarthy, D.P.; Dixit, Kavita [Bhabha Atomic Research Centre, Mumbai (India)

2011-07-01

A 6 MW peak, 24 kW average power S-band Klystron is under development at CEERI, Pilani under an MoU between BARC and CEERI. The design of the klystron has been completed. The electron gun has been designed using TRAK and MAGIC codes. RF cavities have been designed using HFSS and CST Microwave Studio while the complete beam wave interaction simulation has been done using MAGIC code. The thermal design of collector and RF window has been done using ANSYS code. A Gun Collector Test Module (GCTM) was developed before making actual klystron to validate gun perveance and thermal design of collector. A high voltage solid state pulsed modulator has been installed for performance valuation of the tube. The paper will cover the design aspects of the tube and experimental test results of GCTM and klystron. (author)

Design and development of a 6 MW peak, 24 kW average power S-band klystron

International Nuclear Information System (INIS)

Joshi, L.M.; Meena, Rakesh; Nangru, Subhash; Kant, Deepender; Pal, Debashis; Lamba, O.S.; Jindal, Vishnu; Jangid, Sushil Kumar; Chakravarthy, D.P.; Dixit, Kavita

2011-01-01

A 6 MW peak, 24 kW average power S-band Klystron is under development at CEERI, Pilani under an MoU between BARC and CEERI. The design of the klystron has been completed. The electron gun has been designed using TRAK and MAGIC codes. RF cavities have been designed using HFSS and CST Microwave Studio while the complete beam wave interaction simulation has been done using MAGIC code. The thermal design of collector and RF window has been done using ANSYS code. A Gun Collector Test Module (GCTM) was developed before making actual klystron to validate gun perveance and thermal design of collector. A high voltage solid state pulsed modulator has been installed for performance valuation of the tube. The paper will cover the design aspects of the tube and experimental test results of GCTM and klystron. (author)

Effect of W content in solid solution on properties and microstructure of (Ti,W)C-Ni{sub 3}Al cermets

Energy Technology Data Exchange (ETDEWEB)

Huang, Bin; Xiong, Weihao, E-mail: whxiong@hust.edu.cn; Zhang, Man; Jing, Yong; Li, Baolong; Luo, Haifeng; Wang, Shengqing

2016-08-15

(Ti{sub 1-x}W{sub x})C solid solutions (x = 0.05, 0.15, 0.25, 0.35) were synthesized by carbothermal reduction and then were used as hard phases to prepare (Ti,W)C-Ni{sub 3}Al cermets by vacuum sintering. (Ti,W)C-Ni{sub 3}Al cermets showed weak core-rim structure carbide particles embedded in Ni{sub 3}Al binder. As W content in (Ti,W)C increased, core-rim structure of carbide particles got weaker and the contrast of particles lowered down in SEM-BSE morphologies. Furthermore, the densification of cermets was promoted with W content in solid solution increasing, meanwhile TRS and toughness of cermets were improved obviously. In this paper, the wettability of molten metal on different group transition metal carbides was discussed in detail based on valence-electron configurations (VECs) of carbides. - Highlights: • (Ti{sub 1-x}W{sub x})C solid solutions were synthesized by carbothermal reduction. • (Ti,W)C-Ni{sub 3}Al cermets were prepared through powder metallurgy route. • The increase of W can improve wetting and densification significantly. • (Ti,W)C-Ni{sub 3}Al cermets showed a weak core-rim structure particles embedded in binder. • Wetting behavior were discussed from valence-electron configurations of carbides.

Thermo-mechanical tests on W7-X current lead flanges

International Nuclear Information System (INIS)

Dhard, Chandra Prakash; Rummel, Thomas; Zacharias, Daniel; Bykov, Victor; Moennich, Thomas; Buscher, Klaus-Peter

2013-01-01

Highlights: • There are significant mechanical loads on the cryostat and radial flanges for W7-X current leads. • These are due to evacuation of W7-X cryostat, cool-down of cold mass, electro-magnetic forces and self weight of leads. • The actual mechanical loads were reduced to simplify the experimental set-up. • The tests were carried out on mock-up flanges test assembly at ambient temperature and at 77 K. • The thermo-mechanical tests on W7-X current lead flanges validate the design and joints of these flanges to the leads. -- Abstract: Fourteen pieces of high temperature superconducting current leads (CL) arranged in seven pairs, will be installed on the outer vessel of Wendelstein 7-X (W7-X) stellarator. In order to support the CL, it is provided with two glass fiber reinforce plastic (GFRP) flanges, namely, the lower cryostat flange (CF) remaining at room temperature and upper radial flange (RF) at about 5 K. Both the flanges i.e. CF and RF experience high mechanical loads with respect to the CL, due to the evacuation of W7-X cryostat, cool-down of cold mass including the CL, electro-magnetic forces due to current and plasma operations and self weight of CL. In order to check the integrity of these flanges for such mechanical loads, thermo-mechanical tests were carried out on these flanges at room temperatures and at liquid nitrogen (LN2) temperatures. The details of test set-up, results and modeling are described in the paper

Author Details

African Journals Online (AJOL)

Journal Home > Advanced Search > Author Details. Log in or Register ... (2013) - Articles Technical Note: Development of a Photobioreactor for Microalgae Culture ... Design, Construction and Evaluation of Motorized Okra Slicer Abstract PDF ...

113Cd NMR as a Probe of the Active Sites of Metalloenzymes

NARCIS (Netherlands)

Armitage, Ian M.; Schoot Uiterkamp, Antonius J.M.; Chlebowski, Jan F.; Coleman, Joseph E.

1978-01-01

113Cd NMR has been used to study the active site metal ion(s) of the 113Cd(II) derivatives of four Zn(II) metalloenzymes, carboxypeptidase A, carbonic anhydrases, alkaline phosphatase, and superoxide dismutase. The resonances of the enzyme-bound 113Cd(II) ions are extremely sensitive to ligand

13 CFR 113.425 - Counseling and use of appraisal and counseling materials.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A...

Preliminary design requirements document (DRD) for Project W-236B, ''Initial Pretreatment Module''

International Nuclear Information System (INIS)

Swanson, L.M.

1995-01-01

The scope of this Design Requirements Document (DRD) is to identify and define the functions, with associated requirements, which must be performed to separate Hanford Site tank waste supernatants into low-level and high-level fractions. This documents sets forth function requirements, performance requirements, and design constraints necessary to begin conceptual design for the Initial Pretreatment Module (IPM). System and physical interfaces between the IPM project and the Tank Waste Remediation System (TWRS) are identified. The constraints, performance requirements, and transfer of information and data across a technical interface will be documented in an Interface Control Document. Supplemental DRDs will be prepared to provide more detailed requirements specific to systems described in the DRD

Oil encapsulation in core-shell alginate capsules by inverse gelation II: comparison between dripping techniques using W/O or O/W emulsions.

Science.gov (United States)

Martins, Evandro; Poncelet, Denis; Rodrigues, Ramila Cristiane; Renard, Denis

2017-09-01

In the first part of this article, it was described an innovative method of oil encapsulation from dripping-inverse gelation using water-in-oil (W/O) emulsions. It was noticed that the method of oil encapsulation was quite different depending on the emulsion type (W/O or oil-in-water (O/W)) used and that the emulsion structure (W/O or O/W) had a high impact on the dripping technique and the capsules characteristics. The objective of this article was to elucidate the differences between the dripping techniques using both emulsions and compare the capsule properties (mechanical resistance and release of actives). The oil encapsulation using O/W emulsions was easier to perform and did not require the use of emulsion destabilisers. However, capsules produced from W/O emulsions were more resistant to compression and showed the slower release of actives over time. The findings detailed here widened the knowledge of the inverse gelation and gave opportunities to develop new techniques of oil encapsulation.

Design and Control of a 3 kW Wireless Power Transfer System for Electric Vehicles

Directory of Open Access Journals (Sweden)

Zhenshi Wang

2015-12-01

Full Text Available This paper aims to study a 3 kW wireless power transfer system for electric vehicles. First, the LCL-LCL topology and LC-LC series topology are analyzed, and their transfer efficiencies under the same transfer power are compared. The LC-LC series topology is validated to be more efficient than the LCL-LCL topology and thus is more suitable for the system design. Then a novel q-Zsource-based online power regulation method which employs a unique impedance network (two pairs of inductors and capacitors to couple the cascaded H Bridge to the power source is proposed. By controlling the shoot-through state of the H Bridge, the charging current can be adjusted, and hence, transfer power. Finally, a prototype is implemented, which can transfer 3 kW wirelessly with ~95% efficiency over a 20 cm transfer distance.

Design and operational experience and testing of 50 kW/120 kHz oscillator for 3 MeV, 30 kW DC accelerator

International Nuclear Information System (INIS)

Srivastava, S.K.; Bakhtsingh, R.I.; Saroj, P.C.

2011-01-01

A 3 MeV, 30 kW dc industrial electron beam Accelerator is being developed at EBC, Kharghar, Navi Mumbai. The 3 MV dc is generated by parallel coupled voltage multiplier operating at 120 kHz. This requires an input voltage of 150 kV-0-150 kV at 120 kHz. This is achieved by 50 kW/120 kHz power oscillator in conjunction with a tuned air-core step-up transformer. Input primary voltage of 6 kV-0-6 kV at 120 kHz is generated by an oscillator using BW1121J2 water cooled triodes in push-pull Colpitts configuration. The tank circuit for the oscillator is formed by the secondary winding inductance of the step-up transformer and capacitance formed by RF feeder electrodes of the voltage multiplier column. Grid feedback for the oscillator is derived by arranging a set of electrodes in the feeder assembly in a capacitive divider configuration. The oscillator is operated in class-C mode with grid leak bias for better efficiency which also has the advantages of self-adjustment with varying load conditions. High power test has been conducted in a simulated test set-up on dummy load up to 30kW. Subsequently, the power oscillator has been tested with HV multiplier at 1MeV level satisfactorily. This paper describes the design, test results and operational experiences of the oscillator. (author)

9 CFR 113.25 - Culture media for detection of bacteria and fungi.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi. (a...

Analytical Method of Designing and Selecting Take-Up Systems for Mining Belt Conveyors / Analityczna Metoda Projektowania i Doboru UKŁADÓW Napinania Dla GÓRNICZYCH PRZENOŚNIKÓW TAŚMOWYCH

Science.gov (United States)

Kulinowski, Piotr

2013-12-01

This article presents a method developed to design and select tensioning systems which makes use of standard calculations. It describes procedures for selecting and analysing the operation of devices tensioning the belt, which procedures are based on the static characteristics of these devices, and a proposal for introducing a substitute belt elasticity modulus that would make the calculations of the tensioning stroke length account for the value of the initial force tensioning the belt and for its sag between sets of idlers. Static characteristics of tensioning systems have been used to describe their operation and present the advantages and disadvantages of individual design solutions W artykule przedstawiono opracowaną metodę projektowania i doboru układów napinania taśmy wykorzystującą stosowane standardowe procedury obliczeniowe uzupełnione o zależności analityczne uwzględniające zwis taśmy między zestawami krążnikowymi i charakterystyki statyczne urządzeń napinających taśmę. W pierwszej części publikacji opisano analityczną metodę doboru układu napinania taśmy bazującą na wynikach obliczeń sił w taśmie i szacunkowych kalkulacjach drogi napinania taśmy stosowanych obecnie w standardowych procedurach obliczeniowych (Golka i in., 2007; Gładysiewicz, 2003; Żur i Hardygóra, 1996). Następnie przedstawiono propozycję uzupełnienia stosowanej metody analitycznej o wprowadzenie diagramu drogi napinania i uwzględnienie zastępczego modułu sprężystości taśmy (Kulinowski, 2012). W obliczeniach standardowych przyjmuje się, że długość odcinka taśmy pomiędzy zestawami krążnikowymi jest równa ich rozstawowi. W rzeczywistych warunkach może się zdarzyć, że na niektórych odcinkach złożonego profilu trasy przenośnika wartość zwisu taśmy przekracza wartości dopuszczalne, wtedy długość taśmy między zestawami krążnikowymi jest znacząco większa od rozstawu zestawów. W takich przypadkach wartość modułu spr

Beta-delayed proton emitter $^{113}Xe$

CERN Document Server

Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T

1973-01-01

The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).

Author Details

African Journals Online (AJOL)

Journal Home > Advanced Search > Author Details ... Design and Implementation of an M/M/1 Queuing Model Algorithm and its Applicability in ... Vehicle Identification Technology to Intercept Small Arms and Ammunition on Nigeria Roads

19 CFR 113.1 - Authority to require security or execution of bond.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...

Project W-314 specific test and evaluation plan for 241-AN-A valve pit

International Nuclear Information System (INIS)

Hays, W.H.

1997-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a ''lower tier'' document based on the W-314 Test and Evaluation Plan (TEP) This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the modifications of the AN-A valve pit. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the modifications to the 241-AN-A Valve Pit. The STEP will be utilized in conjunction with the TEP for verification and validation

Opto-Mechanical Design of FIR Diagnostic System for C-2W

Science.gov (United States)

Beall, Michael; Deng, B. H.; Settles, G.; Rouillard, M.; Schroeder, J.; Gota, H.; Thompson, M.; Snitchler, G.; Ziaei, S.; the TAE Team

2016-10-01

The goal of the C-2W far-infrared (FIR) diagnostic system is to provide highly accurate, simultaneous polarimetry and interferometry information about the generation, equilibrium and time evolution of the advanced beam-driven field-reversed configuration (FRC). Thorough spatial coverage of the confinement vessel will be provided by a set of 14 chords at the central plane, with half of the chords tilted at a 15°angle to provide additional polarimetry information. Due to the very low (<.5°) Faraday rotation expected in the field-reversed plasma, the system has a design goal of .25 μm maximum allowable vibration over the lifetime of the shot. Due to large eddy-current forces from simulation of magnetic-field ramp-up, a non-metallic canvas phenolic material has been selected for the primary breadboards, which are mounted on a rigid, sand-filled support structure. Given the size of the structure and the magnetic impact, the support structure does not use pneumatic or mechanical isolation. Dynamic vibration analysis with Ansys, based on measurements of local ground vibration and simulations of magnetic forces, predicts that the system will meet the design goal.

Effective field theory analysis of new physics in e{sup +}e{sup -}{yields}W{sup +}W{sup -} at a linear collider

Energy Technology Data Exchange (ETDEWEB)

Buchalla, G.; Cata, O.; Rahn, R. [Muenchen Univ. (Germany). Fakultaet fuer Physik; Schlaffer, M. [Muenchen Univ. (Germany). Fakultaet fuer Physik; Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

2013-02-15

We analyze new physics contributions to e{sup +}e{sup -}{yields}W{sup +}W{sup -} at the TeV energy scale, employing an effective field theory framework. A complete basis of next-to-leading order operators in the standard model effective Lagrangian is used, both for the nonlinear and the linear realization of the electroweak sector. The elimination of redundant operators via equations-of-motion constraints is discussed in detail. Polarized cross sections for e{sup +}e{sup -}{yields}W{sup +}W{sup -} (on-shell) are computed and the corrections to the standard model results are given in an expansion for large s/M{sup 2}{sub W}. The dominant relative corrections grow with s and can be fully expressed in terms of modified gauge-fermion couplings. These corrections are interpreted in the context of the Goldstone boson equivalence theorem. Explicit new physics models are considered to illustrate the generation and the potential size of the coefficients in the effective Lagrangian. Brief comments are made on the production of W{sup +}W{sup -} pairs at the LHC.

Chiral W-gravities for general extended conformal algebras

International Nuclear Information System (INIS)

Hull, C.M.

1991-01-01

The gauging of any chiral extended conformal symmetry of any two-dimensional field theory is achieved by coupling to the appropriate chiral W-gravity. Only a linear coupling to the W-gravity gauge fields is needed. The gauging of algebras with central charges requires the introduction of spin-zero gauge fields corresponding to the central charges. The example of Liouville theory is discussed in detail and a new way of coupling it to gravity is obtained. (orig.)

Tank 241-TX-113 rotary mode core sampling and analysis plan

International Nuclear Information System (INIS)

McCain, D.J.

1998-01-01

This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List

9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...

Measurement of the $W$ boson mass with the D0 detector

Energy Technology Data Exchange (ETDEWEB)

Abazov, Victor Mukhamedovich; et al.

2014-01-30

We give a detailed description of the measurement of the $W$ boson mass, $M_W$, performed on an integrated luminosity of 4.3 fb$^{-1}$, which is based on similar techniques as used for our previous measurement done on an independent data set of 1 fb$^{-1}$ of data. The data were collected using the D0 detector at the Fermilab Tevatron Collider. This data set yields $1.68\\times 10^6$ $W\\rightarrow e\

JLab High Efficiency Klystron Baseline Design for 12 GeV Upgrade

International Nuclear Information System (INIS)

Hovater, J.; Delayen, Jean; Harwood, Leigh; Nelson, Richard; Wang, Haipeng

2003-01-01

A computer design of a 13.5 kW, 1497 MHz, CW type, 55% efficiency, 0.8 microPv beam perveance, ∼40 dB gain, 5-cavity klystron has been developed for JLab 12 GeV Upgrade project.The design uses TRICOMP codes to simulate the gun, mod-anode section, solenoid focus channel and beam dump. The klystron tube was designed by JPNDISK (1D) code initially and then optimized by MASK (2D) code for the baseline parameters. All of these codes have been bunch marked by JLab 5 kW operational klystrons. The details of design parameters and the simulations by MAFIA (3D) for the cavity couplings tuners, and window are also going to be presented.

Design of a Novel W-Sinker RF LDMOS

Directory of Open Access Journals (Sweden)

Xiangming Xu

2015-01-01

Full Text Available A novel RF LDMOS device structure and corresponding manufacturing process are presented in this paper. Deep trench W-sinker (tungsten sinker is employed in this technology to replace the traditional heavily doped diffusion sinker which can shrink chip size of the LDMOS transistor by more than 30% and improve power density. Furthermore, the W-sinker structure reduces the parasitic resistance and inductance and improves thermal conductivity of the device as well. Combined with the adoption of the techniques, like grounded shield, step gate oxide, LDD optimization, and so forth, an advanced technology for RF LDMOS based on conventional 0.35 μm CMOS technology is well established. An F+A power amplifier product with frequency range of 1.8–2.1 GHz is developed for the application of 4G LTE base station and industry leading performance is achieved. The qualification results show that the device reliability and ruggedness can also meet requirement of the application.

Review of the International Thermonuclear Experimental Reactor (ITER) detailed design report

International Nuclear Information System (INIS)

1997-01-01

Dr. Martha Krebs, Director, Office of Energy Research at the US Department of Energy (DOE), wrote to the Fusion Energy Sciences Advisory Committee (FESAC), in letters dated September 23 and November 6, 1996, requesting that FESAC review the International Thermonuclear Experimental Reactor (ITER) Detailed Design Report (DDR) and provide its view of the adequacy of the DDR as part of the basis for the United States decision to enter negotiations with the other interested Parties regarding the terms and conditions for an agreement for the construction, operations, exploitation and decommissioning of ITER. The letter from Dr. Krebs, referred to as the Charge Letter, provided context for the review and a set of questions of specific interest

Review of the International Thermonuclear Experimental Reactor (ITER) detailed design report

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-04-18

Dr. Martha Krebs, Director, Office of Energy Research at the US Department of Energy (DOE), wrote to the Fusion Energy Sciences Advisory Committee (FESAC), in letters dated September 23 and November 6, 1996, requesting that FESAC review the International Thermonuclear Experimental Reactor (ITER) Detailed Design Report (DDR) and provide its view of the adequacy of the DDR as part of the basis for the United States decision to enter negotiations with the other interested Parties regarding the terms and conditions for an agreement for the construction, operations, exploitation and decommissioning of ITER. The letter from Dr. Krebs, referred to as the Charge Letter, provided context for the review and a set of questions of specific interest.

Design of current source DC/DC converter and inverter for 2kW fuel cell application

DEFF Research Database (Denmark)

Andreiciks, A.; Steiks, I.; Krievs, O.

2013-01-01

In order to use hydrogen fuel cell in domestic applications either as main power supply or backup power source, the low DC output voltage of the fuel cell has to be matched to the voltage level and frequency of the utility grid AC voltage. The interfacing power converter systems usually consist...... system is designed for interfacing a 2kW proton exchange membrane (PEM) fuel cell....

Use of Probabilistic Engineering Methods in the Detailed Design and Development Phases of the NASA Ares Launch Vehicle

Science.gov (United States)

Fayssal, Safie; Weldon, Danny

2008-01-01

The United States National Aeronautics and Space Administration (NASA) is in the midst of a space exploration program called Constellation to send crew and cargo to the international Space Station, to the moon, and beyond. As part of the Constellation program, a new launch vehicle, Ares I, is being developed by NASA Marshall Space Flight Center. Designing a launch vehicle with high reliability and increased safety requires a significant effort in understanding design variability and design uncertainty at the various levels of the design (system, element, subsystem, component, etc.) and throughout the various design phases (conceptual, preliminary design, etc.). In a previous paper [1] we discussed a probabilistic functional failure analysis approach intended mainly to support system requirements definition, system design, and element design during the early design phases. This paper provides an overview of the application of probabilistic engineering methods to support the detailed subsystem/component design and development as part of the "Design for Reliability and Safety" approach for the new Ares I Launch Vehicle. Specifically, the paper discusses probabilistic engineering design analysis cases that had major impact on the design and manufacturing of the Space Shuttle hardware. The cases represent important lessons learned from the Space Shuttle Program and clearly demonstrate the significance of probabilistic engineering analysis in better understanding design deficiencies and identifying potential design improvement for Ares I. The paper also discusses the probabilistic functional failure analysis approach applied during the early design phases of Ares I and the forward plans for probabilistic design analysis in the detailed design and development phases.

Study of new 113mIn-BAT complexes for myocardial imaging agents

International Nuclear Information System (INIS)

Zhu Lin; Liu Boli; Kojima, M.

1991-01-01

Some new BAT derivatives are designed and synthesized in order to find some ideal myocardial imaging agents. These ligands form pentacoordinated complexes with indium cation. The structures of ligand BAT-TE and complexes In-BAT-TE and In-BAT-ETE are determined by X-ray crystallography at first. Biodistribution shows that the higher lipophilicity of complex induces apparently higher myocardial accumulation. Up to date, complex B is the best 113m In-labeled myocardial imaging agent. It is also suited to 111 In

Detailed design and first tests of the application software for the instrument control unit of Euclid-NISP

Science.gov (United States)

Ligori, S.; Corcione, L.; Capobianco, V.; Bonino, D.; Sirri, G.; Fornari, F.; Giacomini, F.; Patrizii, L.; Valenziano, L.; Travaglini, R.; Colodro, C.; Bortoletto, F.; Bonoli, C.; Chiarusi, T.; Margiotta, A.; Mauri, N.; Pasqualini, L.; Spurio, M.; Tenti, M.; Dal Corso, F.; Dusini, S.; Laudisio, F.; Sirignano, C.; Stanco, L.; Ventura, S.; Auricchio, N.; Balestra, A.; Franceschi, E.; Morgante, G.; Trifoglio, M.; Medinaceli, E.; Guizzo, G. P.; Debei, S.; Stephen, J. B.

2016-07-01

In this paper we describe the detailed design of the application software (ASW) of the instrument control unit (ICU) of NISP, the Near-Infrared Spectro-Photometer of the Euclid mission. This software is based on a real-time operating system (RTEMS) and will interface with all the subunits of NISP, as well as the command and data management unit (CDMU) of the spacecraft for telecommand and housekeeping management. We briefly review the main requirements driving the design and the architecture of the software that is approaching the Critical Design Review level. The interaction with the data processing unit (DPU), which is the intelligent subunit controlling the detector system, is described in detail, as well as the concept for the implementation of the failure detection, isolation and recovery (FDIR) algorithms. The first version of the software is under development on a Breadboard model produced by AIRBUS/CRISA. We describe the results of the tests and the main performances and budgets.

HERV-W group evolutionary history in non-human primates: characterization of ERV-W orthologs in Catarrhini and related ERV groups in Platyrrhini.

Science.gov (United States)

Grandi, Nicole; Cadeddu, Marta; Blomberg, Jonas; Mayer, Jens; Tramontano, Enzo

2018-01-19

The genomes of all vertebrates harbor remnants of ancient retroviral infections, having affected the germ line cells during the last 100 million years. These sequences, named Endogenous Retroviruses (ERVs), have been transmitted to the offspring in a Mendelian way, being relatively stable components of the host genome even long after their exogenous counterparts went extinct. Among human ERVs (HERVs), the HERV-W group is of particular interest for our physiology and pathology. A HERV-W provirus in locus 7q21.2 has been coopted during evolution to exert an essential role in placenta, and the group expression has been tentatively linked to Multiple Sclerosis and other diseases. Following up on a detailed analysis of 213 HERV-W insertions in the human genome, we now investigated the ERV-W group genomic spread within primate lineages. We analyzed HERV-W orthologous loci in the genome sequences of 12 non-human primate species belonging to Simiiformes (parvorders Catarrhini and Platyrrhini), Tarsiiformes and to the most primitive Prosimians. Analysis of HERV-W orthologous loci in non-human Catarrhini primates revealed species-specific insertions in the genomes of Chimpanzee (3), Gorilla (4), Orangutan (6), Gibbon (2) and especially Rhesus Macaque (66). Such sequences were acquired in a retroviral fashion and, in the majority of cases, by L1-mediated formation of processed pseudogenes. There were also a number of LTR-LTR homologous recombination events that occurred subsequent to separation of Catarrhini sub-lineages. Moreover, we retrieved 130 sequences in Marmoset and Squirrel Monkeys (family Cebidae, Platyrrhini parvorder), identified as ERV1-1_CJa based on RepBase annotations, which appear closely related to the ERV-W group. Such sequences were also identified in Atelidae and Pitheciidae, representative of the other Platyrrhini families. In contrast, no ERV-W-related sequences were found in genome sequence assemblies of Tarsiiformes and Prosimians. Overall, our

The WIMS-E module W-FORTE

International Nuclear Information System (INIS)

Roth, M.J.

1983-09-01

There are three distinct versions of the WIMS lattice cell program. WIMS-E is the most general, WIMSD4 is restricted to clusters or to one dimensional slab or annular geometry, and LWRWIMS is designed principally for light water reactor geometries. W-FORTE is used to transfer data from WIMSD4 or LWRWIMS to WIMS-E. A description of the W-FORTE module is given, and includes the relevant data for WIMSD4, LWRWIMS and W-FORTE. (UK)

Project Design Concept - Primary Ventilation System

International Nuclear Information System (INIS)

MCGREW, D.L.

2000-01-01

Tank Farm Restoration and Safe Operation (TFRSO), Project W-3 14 was established to provide upgrades that would improve the reliability and extend the system life of portions of the waste transfer, electrical, ventilation, instrumentation and control systems for the Hanford Site Tank Farms. An assessment of the tank farm system was conducted and the results are documented in system assessment reports. Based on the deficiencies identified in the tank farm system assessment reports, and additional requirements analysis performed in support of the River Protection Project (RPP), an approved scope for the TFRSO effort was developed and documented in the Upgrade Scope Summary Report (USSR), WHC-SD-W314-RPT-003, Rev. 4. The USSR establishes the need for the upgrades and identifies the specific equipment to be addressed by this project. This Project Design Concept (PDC) is in support of the Phase 2 upgrades and provides an overall description of the operations concept for the W-314 Primary Ventilation Systems. Actual specifications, test requirements, and procedures are not included in this PDC. The PDC is a ''living'' document, which will be updated throughout the design development process to provide a progressively more detailed description of the W-314 Primary Ventilation Systems design. The Phase 2 upgrades to the Primary Ventilation Systems shall ensure that the applicable current requirements are met for: Regulatory Compliance; Safety; Mission Requirements; Reliability; and Operational Requirements

Project W-314 specific test and evaluation plan for AZ tank farm upgrades

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-631 transfer line from the AZ-O1A pit to the AZ-02A pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation P1 an (TEP). Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities, etc), Factory Tests and Inspections (FTIs), installation tests and inspections, Construction Tests and Inspections (CTIs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). The STEP will be utilized in conjunction with the TEP for verification and validation

G.W. Ritchey's Optical Work for the Army during WWI.

Science.gov (United States)

Abrahams, Peter

2015-01-01

During the first World War, the Mount Wilson optical shop was remodeled into a production facility, making lenses and prisms for military optics. G.W. Ritchey, H.S. Kinney, and J.S. Dalton managed the project, joined by Ritchey's son Willis and a large team of workers. Tens of thousands of lenses and prisms were produced, notably the exacting roof prisms needed for altimeters.This sizeable project is documented in correspondence and a 'Report on Technical Details of Optical Work', authored by G.W. Ritchey and reproduced in typewriter carbon copy with tipped-in photographs. The retrofitting of the MWO optical shop, and the complicated production methods, are detailed in the report.

A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds

Energy Technology Data Exchange (ETDEWEB)

Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)

1969-03-15

Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.

7 CFR 1221.113 - Financial statements.

Science.gov (United States)

2010-01-01

... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...

340 Facility Secondary Containment and Leak Detection Project W-302 Functional Design Criteria

Energy Technology Data Exchange (ETDEWEB)

Stordeur, R.T.

1995-03-01

This functional design criteria for the upgrade to the 340 radioactive liquid waste storage facility (Project W-302) specifically addresses the secondary containment issues at the current vault facility of the 340 Complex. This vault serves as the terminus for the Radioactive Liquid Waste System (RLWS). Project W-302 is necessary in order to bring this portion of the Complex into full regulatory compliance. The project title, ``340 Facility Secondary Containment and Leak Detection``, illustrates preliminary thoughts of taking corrective action directly upon the existing vault (such as removing the tanks, lining the vault, and replacing tanks). However, based on the conclusion of the engineering study, ``Engineering Study of the 300 Area Process Wastewater Handling System``, WHC-SD-WM-ER-277 (as well as numerous follow-up meetings with cognizant staff), this FDC prescribes a complete replacement of the current tank/vault system. This offers a greater array of tanks, and provides greater operating flexibility and ease of maintenance. This approach also minimizes disruption to RLWS services during ``tie-in``, as compared to the alternative of trying to renovate the old vault. The proposed site is within the current Complex area, and maintains the receipt of RLWS solutions through gravity flow.

Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate

Science.gov (United States)

Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.

2014-01-01

This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197

CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.

Science.gov (United States)

Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo

2015-10-13

Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.

Simpler criterion on W state for perfect quantumstate splitting and quantum teleportation

Institute of Scientific and Technical Information of China (English)

无

2009-01-01

A simpler criterion is presented to judge whether a W state can be taken as quantum channel forperfectly splitting or teleporting an arbitrary single-qubit state. If the W state is usable,the detailed manipulations in the two quantum information processes are amply shown. Moreover,some relevant discussions are made.

TED Study of Si(113) Surfaces

Science.gov (United States)

Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.

A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.

Miejsce muzeów w turystyce kulturowej w Polsce

OpenAIRE

Krakowiak, Beata

2013-01-01

The article presents the museums, their potential and their significance for cultural tourism in Poland. Its aims are achieved through a presentation of registered national museums, ‘monuments of history’, museum buildings and the cultural activities undertaken by these institutions Artykuł dotyczy potencjału muzealnego oraz jego znaczenia dla turystyki kulturowej w Polsce. Zamierzone cele pracy realizowane są poprzez prezentację muzeów rejestrowanych, narodowych, muzeów-pomników histor...

13 CFR 113.110 - Remedial and affirmative action and self-evaluation.

Science.gov (United States)

2010-01-01

... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...

Report of the working group on precision measurements. - Measurement of the W boson mass and width

International Nuclear Information System (INIS)

Brock, R.; Erler, J.; Kim, Y.-K.; Marciano, W.; Ashmanskas, W.; Baur, U.; Ellison, J.; Lancaster, M.; Nodulman, L.; Rha, J.; Waters, D.; Womersley, J.

2000-01-01

We discuss the prospects for measuring the W mass and width in Run II. The basic techniques used to measure M W are described and the statistical, theoretical and detector-related uncertainties are discussed in detail. Alternative methods of measuring the W mass at the Tevatron and the prospects for M W measurements at other colliders are also described

Discovery of the charged vector bosons (W+-) conveying weak interaction

International Nuclear Information System (INIS)

Kiss, D.

1983-01-01

The unified Weinberg-Salam-Glashow theory of weak and electromagnetic interactions assumes the existence of two charged (W) and one neutral (Z) intermediate vector bosons of the unified electroweak interaction. These particles were discovered at the end of 1982 with the CERN's SPS proton-antiproton colliding beams. Technical aspects of the production and detection of W and Z bosons, the first results and their importance are described in detail. (D.Gy.)

9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine...

9 CFR 3.113 - Primary enclosures used to transport marine mammals.

Science.gov (United States)

2010-01-01

... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... the animals, their handlers, or other persons. (d) Marine mammals transported in the same primary... used. Within the primary enclosures used to transport marine mammals, the animals will be maintained on...

Field dependence of T1 for hyperpolarized [1-13C]pyruvate

DEFF Research Database (Denmark)

Chattergoon, N.; Martnez-Santiesteban, F.; Handler, W. B.

2013-01-01

conformation and properties of the dissolution media such as buffer composition, solution pH, temperature and magnetic field. We have measured the magnetic field dependence of the spin–lattice relaxation time of hyperpolarized [1-13C]pyruvate using field-cycled relaxometry. [1-13C]pyruvate was hyperpolarized...

Angiogeneza w reumatoidalnym zapaleniu stawów

Directory of Open Access Journals (Sweden)

Anna Kotulska

2011-02-01

Full Text Available Angiogeneza jest procesem powstawania nowych włosowatychnaczyń krwionośnych z uprzednio istniejących włośniczek. Angiogenezawystępuje w życiu pozapłodowym i jest regulowana przezzespół czynników proangiogennych i antyangiogennych (tab. I.Zwiększona angiogeneza towarzyszy kilku stanom chorobowym. Jestniezbędna dla wzrostu nowotworów złośliwych. Choroby nienowotworowe,w tym reumatoidalne zapalenie stawów, są także związanez nasiloną angiogenezą. Wykazano tworzenie nowych naczyńw zmienionej zapalnie błonie maziowej stawów, co jest najważniejszązmianą patologiczną u chorych na reumatoidalne zapalenie stawów.U chorych stwierdzono zaburzoną regulację czynników proangiogennychi hamujących ten proces. Leki hamujące zapalenie błonymaziowej bezpośrednio lub pośrednio ograniczają angiogenezę.Możliwe jest, że oddziaływanie na proces angiogenezy będzie stanowićjeden z mechanizmów terapeutycznych leków stosowanychu chorych na reumatoidalne zapalenie stawów.

Detail design and manufacturing result of the HANARO cold neutron source moderator cell

International Nuclear Information System (INIS)

Hwang, Dong Gil; Han, Young Soo; Kim, Soo Sung; Lee, Kye Hong; Kim, Young Jin

2005-01-01

Moderator cell which is on the process of developing is the core of the Cold Neutron Source(CNS) and operates at cryogenic of 20K and made of aluminum. When infer from experience in all nuclear reactors that use moderator cell, Aluminum has a proper nature to use at cryogenic that use hydrogen. And a lot of data was already published for the Aluminum characters which are in the investigative state. Because performance of moderator cell is getting better when thickness is thinner, moderator was designed to double cylinder type of thin plate style. Aluminum is excellent both manufacturing and welding. If the plate is less than 3.0mm, manufacturing and welding are difficult. Because of this, after making a moderator cell, manufacture and integrity are evaluated. In this paper, detailed design of moderator cell and manufacturing result are described

Scintigraphy of the Placenta With {sup 113m}In

Energy Technology Data Exchange (ETDEWEB)

Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)

1969-05-15

The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)

Monte Carlo methods beyond detailed balance

NARCIS (Netherlands)

Schram, Raoul D.; Barkema, Gerard T.|info:eu-repo/dai/nl/101275080

2015-01-01

Monte Carlo algorithms are nearly always based on the concept of detailed balance and ergodicity. In this paper we focus on algorithms that do not satisfy detailed balance. We introduce a general method for designing non-detailed balance algorithms, starting from a conventional algorithm satisfying

7 CFR 1463.113 - Issuance of payments in event of death.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...

Army-NASA aircrew/aircraft integration program (A3I) software detailed design document, phase 3

Science.gov (United States)

Banda, Carolyn; Chiu, Alex; Helms, Gretchen; Hsieh, Tehming; Lui, Andrew; Murray, Jerry; Shankar, Renuka

1990-01-01

The capabilities and design approach of the MIDAS (Man-machine Integration Design and Analysis System) computer-aided engineering (CAE) workstation under development by the Army-NASA Aircrew/Aircraft Integration Program is detailed. This workstation uses graphic, symbolic, and numeric prototyping tools and human performance models as part of an integrated design/analysis environment for crewstation human engineering. Developed incrementally, the requirements and design for Phase 3 (Dec. 1987 to Jun. 1989) are described. Software tools/models developed or significantly modified during this phase included: an interactive 3-D graphic cockpit design editor; multiple-perspective graphic views to observe simulation scenarios; symbolic methods to model the mission decomposition, equipment functions, pilot tasking and loading, as well as control the simulation; a 3-D dynamic anthropometric model; an intermachine communications package; and a training assessment component. These components were successfully used during Phase 3 to demonstrate the complex interactions and human engineering findings involved with a proposed cockpit communications design change in a simulated AH-64A Apache helicopter/mission that maps to empirical data from a similar study and AH-1 Cobra flight test.

Strain, magnetic anisotropy, and anisotropic magnetoresistance in (Ga,Mn)As on high-index substrates: Application to (113)A -oriented layers

Science.gov (United States)

Dreher, L.; Donhauser, D.; Daeubler, J.; Glunk, M.; Rapp, C.; Schoch, W.; Sauer, R.; Limmer, W.

2010-06-01

Based on a detailed theoretical examination of the lattice distortion in high-index epilayers in terms of continuum mechanics, expressions are deduced that allow the calculation and experimental determination of the strain tensor for (hhl) -oriented (Ga,Mn)As layers. Analytical expressions are derived for the strain-dependent free-energy density and for the resistivity tensor for monoclinic and orthorhombic crystal symmetries, phenomenologically describing the magnetic anisotropy and anisotropic magnetoresistance by appropriate anisotropy and resistivity parameters, respectively. Applying the results to (113)A orientation with monoclinic crystal symmetry, the expressions are used to determine the strain tensor and the shear angle of a series of (113)A -oriented (Ga,Mn)As layers by high-resolution x-ray diffraction and to probe the magnetic anisotropy and anisotropic magnetoresistance at 4.2 K by means of angle-dependent magnetotransport. Whereas the transverse-resistivity parameters are nearly unaffected by the magnetic field, the parameters describing the longitudinal resistivity are strongly field dependent.

13 CFR 113.525 - Fringe benefits.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...

W-band power amplifier MMIC with 400 mW output power in 0.1 μm AlGaN/GaN technology

NARCIS (Netherlands)

Heijningen,M. van; Rodenburg, M.; Vliet, F.E. van; Massler, M.; Tessmann, A.; Brückner, F.; Müller, S.; Schwantuschke, D.; Quay; Narhi, T.

2012-01-01

The 0.1 μm AlGaN/GaN technology and design of two W-band power amplifiers in this technology are described. The dual-stage amplifier reaches an output power of 400 mW at 90 GHz at an operation bias of 20 V. Two designs with different driver to final stage gate width ratio are discussed. More than 10

Design, testing, and economics of a 430 W sub p photovoltaic concentrator array for non grid-connected applications

Science.gov (United States)

Maish, A. B.; Rios, M., Jr.; Togami, H.

A stand-alone 430 W/sub p/ photovoltaic (PV) concentrating system for low power, non grid-connected applications has been designed, fabricated, and tested at Sandia National Laboratories. The array consists of four passively cooled Fresnel lens concentrating modules on a newly developed polar axis tracking structure. Two axis tracking is provided using a self powered clock drive unit mounted on a single post foundation. Test results of tracking accuracy, array output power, parasitic power, performance in winds and array reliability are discussed. using a range of estimated production costs for small production volumes, the life-cycle energy costs have been calculated and compared to the equivalent energy costs of a 3 kW diesel electric generator set and of an equivalent flat panel PV system.

78 FR 63570 - Proposed Collection; Comment Request for Forms W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2013-10-24

... W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8BEN-E, Certificate of Status of Beneficial Owner for...

Firmy rodzinne w Polsce w dobie globalizacji

OpenAIRE

Zalewska, Agnieszka

2016-01-01

Celem publikacji jest ukazanie dorobku naukowego, głównie polskich i ukraińskich uczonych, w zakresie uwarunkowań procesów i rezultatów internacjonalizacji przedsiębiorstw oraz jej wpływu na funkcjonowanie biznesu w dobie globalizacji. Opracowanie stanowi istotny wkład w zakresie teorii i praktyki w proces restrukturyzacji przedsiębiorstw w kierunku ich internacjonalizacji. Może posłużyć jako inspiracja do stworzenia strategii opartej na poszukiwaniach (prospector strategy), co będzie sprzyja...

36 CFR 11.3 - Power to revoke.

Science.gov (United States)

2010-07-01

... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...

Lectures on W algebras and W gravity

International Nuclear Information System (INIS)

Pope, C.N.

1992-01-01

We give a review of the extended conformal algebras, known as W algebras, which contain currents of spins higher than 2 in addition to the energy-momentum tensor. These include the non-linear W N algebras; the linear W ∞ and W 1+∞ algebras; and their super-extensions. We discuss their applications to the construction of W-gravity and W-string theories. (author). 46 refs

Modelling and Design of a 3 kW Permanent Magnet Synchronous Generator suitable for Variable Speed Small Wind Turbines

Directory of Open Access Journals (Sweden)

Acharya Parash

2016-01-01

Full Text Available This paper presents the modeling and design of a 3 kW Permanent Magnet Synchronous Generator (PMSG used for a variable speed wind turbine. Initially, the PMSG is modeled in the d-q reference frame. Different optimized parameters of the generator are extracted from the design and used in simulation of the PMSG. The generator output power is matched with the power of the turbine such that the generator is not either over-sized or under-sized.

29 CFR Appendix A to Subpart W to... - Figures W-14 through W-28

Science.gov (United States)

2010-07-01

... 29 Labor 8 2010-07-01 2010-07-01 false Figures W-14 through W-28 A Appendix A to Subpart W to part 1926 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION...; Overhead Protection Pt. 1926, Subpt. W, App. A Appendix A to Subpart W to part 1926—Figures W-14 through W...

Integrated Design of Undepressed Collector for Low Power Gyrotron

Science.gov (United States)

Kumar, Anil; Goswami, Uttam K.; Poonia, Sunita; Singh, Udaybir; Kumar, Nitin; Alaria, M. K.; Bera, A.; Khatun, Hasina; Sinha, A. K.

2011-06-01

A 42 GHz, 200 kW continuous wave (CW) gyrotron, operating at TE03 mode is under development for the electron cyclotron resonance plasma heating of the Indian TOKAMAK system. The gyrotron is made up of an undepressed collector. The undepressed collector is simple to design and cost effective. In this paper, a detailed design study of the undepressed collector for the 42 GHz gyrotron is presented. The EGUN code is used to analyze the spent electron beam trajectory for the maximum spread to reduce the power loading on the collector surface. To achieve wall loading ≤1 kW/cm2, a collector with a length of 800 mm and a radius of 42.5 mm is designed. The design also includes the three magnet systems around the collector for maximum and uniform beam spread. The thermal and the structural analyses are done using the ANSYS code to optimize the collector structure and dimensions with tolerance.

Research cooperation project on environmentally friendly technology for highly efficient mineral resources extraction and treatment. Detail design for pilot plant

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-03-01

Photographs and drawings were edited into a book in relation with a joint project for environment preservation technologies in high-efficiency extraction and treatment of mineral resources, and detail design for a pilot plant. The book classified the related devices into fabricated devices, purchased devices and electrical devices, and contains detailed drawings and photographs thereof. (NEDO)

14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND...

47 CFR 74.113 - Supplementary reports with application for renewal of license.

Science.gov (United States)

2010-10-01

... renewal of license. 74.113 Section 74.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... covered. (4) Power employed, field intensity measurements and visual and aural observations and the types... respective types of transmissions. (5) Estimated degree of public participation in reception and the results...

Detail in architecture: Between arts & crafts

Science.gov (United States)

Dulencin, Juraj

2016-06-01

Architectural detail represents an important part of architecture. Not only can it be used as an identifier of a specific building but at the same time enhances the experience of the realized project. Within it lie the signs of a great architect and clues to understanding his or her way of thinking. It is therefore the central topic of a seminar offered to architecture students at the Brno University of Technology. During the course of the semester-long class the students acquaint themselves with atypical architectural details of domestic and international architects by learning to read them, understand them and subsequently draw them by creating architectural blueprints. In other words, by general analysis of a detail the students learn theoretical thinking of its architect who, depending on the nature of the design, had to incorporate a variety of techniques and crafts. Students apply this analytical part to their own architectural detail design. The methodology of the seminar consists of experiential learning by project management and is complemented by a series of lectures discussing a diversity of details as well as materials and technologies required to implement it. The architectural detail design is also part of students' bachelors thesis, therefore, the realistic nature of their blueprints can be verified in the production process of its physical counterpart. Based on their own documentation the students choose the most suitable manufacturing process whether it is supplied by a specific technology or a craftsman. Students actively participate in the production and correct their design proposals in real scale with the actual material. A student, as a future architect, stands somewhere between a client and an artisan, materializes his or her idea and adjusts the manufacturing process so that the final detail fulfills aesthetic consistency and is in harmony with its initial concept. One of the very important aspects of the design is its economic cost, an

Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113

Science.gov (United States)

Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta

2012-01-01

Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765

Development of actively cooled windows for plasma observation during quasi-continuous operation of the W7-X stellarator

International Nuclear Information System (INIS)

Konig, R.; Grosser, K.; Hildebrandt, D.; Pasch, E.; Werner, T.; Klinger, T.; Ogorodnikova, O.

2005-01-01

With the stellarator W7-X a step to quasi-continuous plasma operation will be made. The cooling system of the machine is designed such that two 30 min discharges can be run per day. Right from the start of operation 10 MW of ECRH heating power will be available for quasi-continuous operation. A working group 'Plasma Facing Optical Components' has been formed which presently concentrates on the development of water cooled windows for UV/VR/IR periscopes which can withstand the expected maximum heat loads of up to 50 kW/m 2 which due to the predominantly short wavelength nature of the radiation emitted by the plasma will be absorbed within the first millimeter of any window. We will report on the detailed Finite Element (ANSYS R ) calculations of the heat and stress distribution across the windows. Calculations have been undertaken for a large number of different window materials which are required for the various spectral regions covered by the miscellaneous diagnostics, so that the most suitable material for each application can easily be identified. Also the dependence of the cooling rate on the window diameter and thickness has been studied. The calculations show that at a power load of 50 kW/m 2 cooled sapphire windows can be used for window sizes up to ∼200 mm diameter but that for many of the other materials like ZnSe, ZnS, CaF 2 , MgF 2 and quartz window sizes need to be limited to considerably smaller sizes. Detailed simulations of the local radiation power load distribution demonstrate that by careful design the load on individual optical components can be considerably reduced. A vacuum test chamber, equipped with a vacuum compatible IR heater has been build. In this chamber a low cost, easily exchangeable window design using Helicoflex gaskets on either side of a 60 mm exposed diameter quartz window have been successfully tested over 70 heat cycles up to a maximum temperature of 450 o C at power loads of 15 kW/m 2 . The design proved to be water and

Control system design for the MOD-5A 7.3 mW wind turbine generator

Science.gov (United States)

Barton, Robert S.; Hosp, Theodore J.; Schanzenbach, George P.

1995-01-01

This paper provides descriptions of the requirements analysis, hardware development and software development phases of the Control System design for the MOD-5A 7.3 mW Wind Turbine Generator. The system, designed by General Electric Company, Advanced Energy Programs Department, under contract DEN 3-153 with NASA Lewis Research Center and DOE, provides real time regulation of rotor speed by control of both generator torque and rotor torque. A variable speed generator system is used to provide both airgap torque control and reactive power control. The wind rotor is designed with segmented ailerons which are positioned to control blade torque. The central component of the control system, selected early in the design process, is a programmable controller used for sequencing, alarm monitoring, communication, and real time control. Development of requirements for use of aileron controlled blades and a variable speed generator required an analytical simulation that combined drivetrain, tower and blade elastic modes with wind disturbances and control behavior. An orderly two phase plan was used for controller software development. A microcomputer based turbine simulator was used to facilitate hardware and software integration and test.

Hafty w sztambuchach Biblioteki Uniwersyteckiej w Poznaniu

Directory of Open Access Journals (Sweden)

Karolina Nowaczyk

2011-01-01

Full Text Available W artykule przedstawiono hafty znajdujące się w sztambuchach z XVIII i XIX wieku pochodzących ze zbiorów Biblioteki Uniwersyteckiej w Poznaniu. Omówione zostały zarówno technika wykonania haftów, jak i ich wartość artystyczna, a także znaczenie wskazanych przykładów dla historii hafciarstwa amatorskiego na ziemiach polskich. Artykuł jest jednocześnie próbą zwrócenia uwagi na istniejącą w tamtym okresie sztukę hafciarską o wyłącznie amatorskim charakterze oraz na kopiowanie i powtarzalność wzorów, co pozwala na określenie ich jako typowych dla danej epoki.

Project W-320 ALARA Plan

International Nuclear Information System (INIS)

Harty, W.M.

1995-01-01

This supporting document establishes the As Low As Reasonable Achievable (ALARA) Plan to be followed during Sluicing Project W-320 design and construction activities to minimize personnel exposure to radiation and hazardous materials

Project W-320 ALARA Plan

Energy Technology Data Exchange (ETDEWEB)

Harty, W.M.

1995-06-06

This supporting document establishes the As Low As Reasonable Achievable (ALARA) Plan to be followed during Sluicing Project W-320 design and construction activities to minimize personnel exposure to radiation and hazardous materials.

Distributions in four-fermion processes for W-physics at LEP 2

International Nuclear Information System (INIS)

Accomando, E.; Ballestrero, A.; Passarino, G.

1996-01-01

The programs WPHACT and WTO, which are designed for computing cross sections and other relevant observables in the e + e - annihilation into four fermions, are used to make detailed and complete predictions for the semi-leptonic and fully hadronic channels e + e - →qqlν, qqqq. Both the total cross sections in the LEP 2 energy range and some of the most relevant distributions are analyzed. Particular algorithms are introduced for the fully hadronic channels in order to analyze the WW physics and to properly define the signal versus the background. With appropriate kinematical cuts it has been shown that the neutral-current background can be made vanishingly small when the problem of determining the W-boson mass is addressed. The remaining background from the complete charge-current and mixed processes is again small but not completely negligible. A detailed discussion is performed on the validity of the most relevant approximations such as the double-resonant one. The inclusion of a final state QCD correction, in its naive form (NQCD), is discussed and various implementations are examined. (orig.)

48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

Science.gov (United States)

2010-10-01

... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...

High Level Expression and Purification of the Clinically Active Antimicrobial Peptide P-113 in Escherichia coli

Directory of Open Access Journals (Sweden)

Kuang-Ting Cheng

2018-03-01

Full Text Available P-113, which was originally derived from the human saliva protein histatin 5, is a histidine-rich antimicrobial peptide with the sequence AKRHHGYKRKFH. P-113 is currently undergoing phase II clinical trial as a pharmaceutical agent to fight against fungal infections in HIV patients with oral candidiasis. Previously, we developed a new procedure for the high-yield expression and purification of hG31P, an analogue and antagonist of human CXCL8. Moreover, we have successfully removed lipopolysaccharide (LPS, endotoxin associated with hG31P in the expression with Escherichia coli. In this paper, we have used hG31P as a novel fusion protein for the expression and purification of P-113. The purity of the expressed P-113 is more than 95% and the yield is 4 mg P-113 per liter of E. coli cell culture in Luria-Bertani (LB medium. The antimicrobial activity of the purified P-113 was tested. Furthermore, we used circular dichroism (CD and nuclear magnetic resonance (NMR spectroscopy to study the structural properties of P-113. Our results indicate that using hG31P as a fusion protein to obtain large quantities of P-113 is feasible and is easy to scale up for commercial production. An effective way of producing enough P-113 for future clinical studies is evident in this study.

9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...

A summary of the conclusions of generic issue 113: Dynamic qualification and testing of large bore hydraulic snubbers

International Nuclear Information System (INIS)

Ware, A.G.; Nitzel, M.E.

1993-01-01

The Nuclear Regulatory Commission (NRC) developed Generic Issue 113, Dynamic Qualification and Testing of Large Bore Hydraulic Snubbers (LBHSs), with the objective of evaluating the reliability of LBHSs in operating commercial nuclear power plants. For the purposes of this research, LBHSs were defined as those hydraulic snubbers with rated load capacities ≥50 kips. Relatively high LBHS failure rates were common during the early 1980s; however, industry actions taken during the last several years in response to increased inspection and testing requirements have resulted in lower LBHS failure rates. To address the issue of LBHS adequacy, the NRC developed Generic Issue 113 (GI-113). This paper provides a summary of the important findings of the GI-113 research program and a discussion of the recommendations that were made in NUREG/CR-5416. Fifteen potential improvements in LBHS reliability were identified, covering the areas of design, environmental (including dynamic) qualification, functional testing, visual inspection, and personnel training. Probabilistic risk assessment studies were used to perform a cost/benefit analysis for each. There were five potential improvements in functional testing and visual inspections with low cost/benefit ratios for both existing and future nuclear plants, and an additional six potential improvements that were determined to be cost beneficial only for future plants. Further investigations of the single failure of snubbers that could damage critical components or systems were recommended in NUREG/CR-5416

Project W-211 Initial Tank Retrieval Systems (ITRS) Description of Operations for 241-AZ-102

Energy Technology Data Exchange (ETDEWEB)

BRIGGS, S.R.

2000-02-25

The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTs) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operation (DOO) defines the control philosophy for the waste retrieval system for Tank 241-AZ-102 (AZ-102). This DOO provides a basis for the detailed design of the Project W-211 Retrieval Control System (RCS) for AZ-102 and also establishes test criteria for the RCS.

Project W-211 Initial Tank Retrieval Systems (ITRS) Description of Operations for 241-AZ-102

International Nuclear Information System (INIS)

BRIGGS, S.R.

2000-01-01

The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTs) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operation (DOO) defines the control philosophy for the waste retrieval system for Tank 241-AZ-102 (AZ-102). This DOO provides a basis for the detailed design of the Project W-211 Retrieval Control System (RCS) for AZ-102 and also establishes test criteria for the RCS

Localization of the placenta on gamma chamber with 113m In-lambratene

International Nuclear Information System (INIS)

Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.

1977-01-01

The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)

Application of aeroacoustic models to design of wind turbine rotors

Energy Technology Data Exchange (ETDEWEB)

Fuglsang, P.; Madsen, H.A. [Risoe National Lab., Wind Energy and Atmospheric Physics Dept., Roskilde (Denmark)

1997-12-31

A design method is presented for wind turbine rotors. The design process is split into overall design of the rotor and detailed design of the blade tip. A numerical optimization tool is used together with a semi-empirical noise prediction code for overall rotor design. The noise prediction code is validated with measurements and good agreement is obtained both on the total noise emission and on the sensitivity to wind speed, tip pitch angle and tip speed. A design study for minimum noise emission for a 300 kW rotor shows that the total sound power level can be reduced by 3 dB(A) without loss in energy production and the energy production can be increased by 2% without increase in the total noise. Detailed CFD calculations are subsequently done to resolve the blade tip flow. The characteristics of the general flow and the tip vortex are found, and the relevant parameters for the aeroacoustic models are derived for a sharp rectangular tip. (au) 16 refs.

Supplemental design requirements document, Multifunction Waste Tank Facility, Project W-236A. Revision 1

International Nuclear Information System (INIS)

Groth, B.D.

1995-01-01

The Multi-Function Waste Tank Facility (MWTF) consists of four, nominal 1 million gallon, underground double-shell tanks, located in the 200-East area, and two tanks of the same capacity in the 200-West area. MWTF will provide environmentally safe storage capacity for wastes generated during remediation/retrieval activities of existing waste storage tanks. This document delineates in detail the information to be used for effective implementation of the Functional Design Criteria requirements

Ekspansja muzeów w Europie Środkowej?

Directory of Open Access Journals (Sweden)

Jagodzińska, Katarzyna

2015-06-01

Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.

9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...

Simulation of neutron fluxes around the W7-X Stellarator

International Nuclear Information System (INIS)

Andersson, Jenny

1999-12-01

A new fusion experiment, the WENDELSTEIN 7-X Stellarator (W7-X), will be undertaken in Greifswald in Germany. Measurements of the neutron flux will provide information on fusion reaction rates and possibly also on ion temperatures as function of time. For this purpose moderating neutron counters will be designed, tested, calibrated and eventually used at W7-X. Extensive Monte-Carlo simulations have been performed in order to select the most suitable detector and moderator combination with a flat response function and highest achievable efficiency. Different detector configurations with different moderating materials have been tried out, showing that a 32 cm thick graphite moderating BF 3 -counter gives the desired flat response and sufficient efficiency. Neutron spectra calculations have been made for different torus models and the influence of floor, walls and ceiling (i.e. reactor hall) have been investigated. Presented results suggest that a more detailed torus model significantly reduces the number of neutron counts at the detector. Calculations including the reactor hall indicate a tendency of shifting the neutron spectra towards the thermal region. The main part of the scattered neutrons are back-scattered from the floor. Finally, calculations on the graphite moderating BF 3 -counter in the detailed torus environment were performed in order to assess the absolute response function under the influence of the reactor hall. The results show that the detector count rate will increase by only 5-7 % when the reactor hall is taken into account. With a stellarator generating 10 12 to 10 16 neutrons per second the detector count rate will be 2x10 5 to 2x10 9 neutrons per second

Simulation of neutron fluxes around the W7-X Stellarator

Energy Technology Data Exchange (ETDEWEB)

Andersson, Jenny

1999-12-01

A new fusion experiment, the WENDELSTEIN 7-X Stellarator (W7-X), will be undertaken in Greifswald in Germany. Measurements of the neutron flux will provide information on fusion reaction rates and possibly also on ion temperatures as function of time. For this purpose moderating neutron counters will be designed, tested, calibrated and eventually used at W7-X. Extensive Monte-Carlo simulations have been performed in order to select the most suitable detector and moderator combination with a flat response function and highest achievable efficiency. Different detector configurations with different moderating materials have been tried out, showing that a 32 cm thick graphite moderating BF{sub 3} -counter gives the desired flat response and sufficient efficiency. Neutron spectra calculations have been made for different torus models and the influence of floor, walls and ceiling (i.e. reactor hall) have been investigated. Presented results suggest that a more detailed torus model significantly reduces the number of neutron counts at the detector. Calculations including the reactor hall indicate a tendency of shifting the neutron spectra towards the thermal region. The main part of the scattered neutrons are back-scattered from the floor. Finally, calculations on the graphite moderating BF{sub 3} -counter in the detailed torus environment were performed in order to assess the absolute response function under the influence of the reactor hall. The results show that the detector count rate will increase by only 5-7 % when the reactor hall is taken into account. With a stellarator generating 10{sup 12} to 10{sup 16} neutrons per second the detector count rate will be 2x10{sup 5} to 2x10{sup 9} neutrons per second.

Packaging design criteria (onsite) project W-520 immobilized low-activity waste transportation system

International Nuclear Information System (INIS)

BOEHNKE, W.M.

2001-01-01

A plan is currently in place to process the high-level radioactive wastes that resulted from uranium and plutonium recovery operations from Spent Nuclear Fuel at the Hanford Site, Richland, Washington. Currently, millions of gallons of high-level radioactive waste in the form of liquids, sludges, and saltcake are stored in many large underground tanks onsite. This waste will be processed and separated into high-level and low-activity fractions. Both fractions will then be vitrified (i.e., blended with molten borosilicate glass) in order to encapsulate the toxic radionuclides. The immobilized low-activity waste (ILAW) glass will be poured into LAW canisters, allowed to cool and harden to solid form, sealed by welding, and then transported to a double-lined trench in the 200 East Area for permanent disposal. This document presents the packaging design criteria (PDC) for an onsite LAW transportation system, which includes the ILAW canister, ILAW package, and transport vehicle and defines normal and accident conditions. This PDC provides the basis for the ILAW onsite transportation system design and fabrication and establishes the transportation safety criteria that the design will be evaluated against in the Package Specific Safety Document (PSSD). It provides the criteria for the ILAW canister, cask and transport vehicles and defines normal and accident conditions. The LAW transportation system is designed to transport stabilized waste from the vitrification facility to the ILAW disposal facility developed by Project W-520. All ILAW transport will take place within the 200 East Area (all within the Hanford Site)

The 400W at 1.8K Test Facility at CEA-Grenoble

Science.gov (United States)

Roussel, P.; Girard, A.; Jager, B.; Rousset, B.; Bonnay, P.; Millet, F.; Gully, P.

2006-04-01

A new test facility with a cooling capacity respectively of 400W at 1.8K or 800W at 4.5K, is now under nominal operation in SBT (Low Temperature Department) at CEA Grenoble. It has been recently used for thermohydraulic studies of two phase superfluid helium in autumn 2004. In the near future, this test bench will allow: - to test industrial components at 1.8K (magnets, cavities of accelerators) - to continue the present studies on thermohydraulics of two phase superfluid helium - to develop and simulate new cooling loops for ITER Cryogenics, and other applications such as high Reynolds number flows This new facility consists of a cold box connected to a warm compressor station (one subatmospheric oil ring pump in series with two screw compressors). The cold box, designed by AIR LIQUIDE, comprises two centrifugal cold compressors, a cold turbine, a wet piston expander, counter flow heat exchangers and two phase separators at 4.5K and 1.8K. The new facility uses a Programmable Logic Controller (PLC) connected to a bus for the measurements. The design is modular and will allow the use of saturated fluid flow (two phase flow at 1.8K or 4.5K) or single phase fluid forced flow. Experimental results and cooling capacity in different operation modes are detailed.

Review of the Properties of the W Boson at LEP, and the Precision Determination of its Mass

CERN Document Server

Ströhmer, R

2003-01-01

We review the precision measurement of the mass and couplings of the W Boson at LEP. The total and differential W+W- cross section is used to extract the WWZ and WWgamma couplings. We discuss the techniques used by the four LEP experiments to determine the W mass in different decay channels, and present the details of methods used to evaluate the sources of systematic uncertainty.

113Cd-NMR investigation of a cadmium-substituted copper, zinc-containing superoxide dismutase from yeast

DEFF Research Database (Denmark)

Kofod, Pauli; Bauer, Rogert; Danielsen, Eva

1991-01-01

113Cd nuclear magnetic resonance spectroscopy has been used to investigate the metal binding sites of cadmium-substituted copper,zinc-containing superoxide dismutase from baker's yeast. NMR signals were obtained for 113Cd(II) at the Cu site as well as for 113Cd(II) at the Zn site. The two subunits...

The Plasmodium protein P113 supports efficient sporozoite to liver stage conversion in vivo.

Science.gov (United States)

Offeddu, Vittoria; Rauch, Manuel; Silvie, Olivier; Matuschewski, Kai

2014-02-01

Invasive stages of Plasmodium parasites possess distinct integral and peripheral membrane proteins that mediate host cell attachment and invasion. P113 is an abundant protein in detergent-resistant high molecular weight complexes in Plasmodium schizonts, but is unusual since expression extends to gametocytes and sporozoites. In this study, we tested whether P113 performs important functions for parasite propagation in Plasmodium berghei. We show that pre-erythrocytic expression of P113 displays key signatures of upregulated in infectious sporozoites (UIS) genes, including control by the liver stage master regulator SLARP. Targeted gene deletion resulted in viable blood stage parasites that displayed no signs of blood stage growth defects. p113(-) parasites propagated normally through the life cycle until mature sporozoites, but displayed defects during natural sporozoite transmission, leading to a delay to patency in infected animals. By comparative in vitro and in vivo analysis of pre-erythrocytic development and using a xeno-diagnostic test we show that ablation of P113 results in lower sporozoite to liver stage conversion and, as a consequence, reduced merozoite output in vivo, without delaying liver stage development. We conclude that p113 is dispensable for Plasmodium life cycle progression and plays auxiliary roles during pre-erythrocytic development. Copyright © 2014 Elsevier B.V. All rights reserved.

Project W-314 specific test and evaluation plan for SN-633 transfer line (241-AX-B to 241-AY-02A)

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-633 transfer line by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP). This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the addition of transfer line SN-633. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the transfer line addition. The STEP will be utilized in conjunction with the TEP for verification and validation

Higher-spin extended conformal algebras and W-gravities

International Nuclear Information System (INIS)

Hull, C.M.

1991-01-01

The construction of classical W 3 gravity is reviewed. It is suggested that the hidden symmetry for quantum W 3 gravity in the chiral gauge is not SL(3, R) but a group contraction of this, ISL(2, R). This is extended to W N gravity, and the case of W 4 gravity is presented in detail. The gauge transformations are realized on D free bosons, with the spin-n conserved current (2 ≤ n ≤ N) taking the form d sub(i i ...i n ) δ + Φ sup(i 1 ) δ + Φ sup(i n ) for some constant tensor d sub(i i ...i n ). The d-tensors must satisfy N-2 non-linear algebraic constraints and these constraints are shown to be satisfied if the d-tensors are taken to be the structure-tensors of an Nth degree Jordan algebra. The relation with Jordan algebras is used to give solutions of the d-tensor constraints for any value of D, N. The free-boson construction of the W N algebras is generalized to give a Sugaware-type construction of a large class of classical extended conformal algebras. The chiral gauging of any classical extended conformal algebra is shown to require only a linear Noether coupling to world-sheet gauge-fields, while gauging a non-chiral algebra in general leads to a non-polynomial action. A number of examples are examined, including W ∞ W-supergravity, Knizhnik-Berschadsky supergravity and 'W N/M ' algebras. Theories of higher-spin W-gravity of the type described are only possible in one and two space-time dimensions, and the one-dimensional cases is briefly discussed. The covariant formulation of W-gravity is briefly discussed and the relation between classical and quantum extended conformal algebras is analyzed. (orig.)

Design of an HTS motor

Energy Technology Data Exchange (ETDEWEB)

Jiang, Y; Pei, R; Hong, Z; Jiang, Q; Coombs, T A [Cambridge University engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)], E-mail: yj222@cam.ac.uk

2008-02-01

This paper gives a detailed description of the design of a high temperature superconducting (HTS) motor. The stator of the motor consists of six air cored HTS racetrack windings, together with an iron shield. The rotor is made of 80 superconducting YBCO pucks, which can be magnetized and equates to a four-pole permanent magnet. The whole HTS motor is cooled by liquid nitrogen to 77K, and acts as a permanent magnet synchronous motor with the power rate of 15.7 kW.

Non-local matrix generalizations of W-algebras

International Nuclear Information System (INIS)

Bilal, A.

1995-01-01

There is a standard way to define two symplectic (hamiltonian) structures, the first and second Gelfand-Dikii brackets, on the space of ordinary m th -order linear differential operators L=-d m +U 1 d m-1 +U 2 d m-2 +..+U m . In this paper, I consider in detail the case where the U k are nxn-matrix-valued functions, with particular emphasis on the (more interesting) second Gelfand-Dikii bracket. Of particular interest is the reduction to the symplectic submanifold U 1 =0. This reduction gives rise to matrix generalizations of (the classical version of) the non-linear W m -algebras, called V n,m -algebras. The non-commutativity of the matrices leads to non-local terms in these V n,m -algebras. I show that these algebras contain a conformal Virasoro subalgebra and that combinations W k of the U k can be formed that are nxn-matrices of conformally primary fields of spin k, in analogy with the scalar case n=1. In general however, the V m,n -algebras have a much richer structure than the W m -algebras as can be seen on the examples of the non-linear and non-local Poisson brackets {(U 2 ) ab (σ),(U 2 ) cd (σ')}, {(U 2 ) ab (σ),(W 3 ) cd (σ')} and {(W 3 ) ab (σ),(W 3 ) cd (σ')} which I work out explicitly for all m and n. A matrix Miura transformation is derived, mapping these complicated (second Gelfand-Dikii) brackets of the U k to a set of much simpler Poisson brackets, providing the analogue of the free-field representation of the W m -algebras. (orig.)

Production of W + W - pairs via γ * γ * → W + W - subprocess with photon transverse momenta

Science.gov (United States)

Łuszczak, Marta; Schäfer, Wolfgang; Szczurek, Antoni

2018-05-01

We discuss production of W + W - pairs in proton-proton collisions induced by two-photon fusion including, for a first time, transverse momenta of incoming photons. The unintegrated inelastic fluxes (related to proton dissociation) of photons are calculated based on modern parametrizations of deep inelastic structure functions in a broad range of their arguments ( x and Q 2). In our approach we can get separate contributions of different W helicities states. Several one- and two-dimensional differential distributions are shown and discussed. The present results are compared to the results of previous calculations within collinear factorization approach. Similar results are found except of some observables such as e.g. transverse momentum of the pair of W + and W -. We find large contributions to the cross section from the region of large photon virtualities. We show decomposition of the total cross section as well as invariant mass distribution into the polarisation states of both W bosons. The role of the longitudinal F L structure function is quantified. Its inclusion leads to a 4-5% decrease of the cross section, almost independent of M WW .

Zmienność zasobów termicznych w Polsce w aspekcie obserwowanych zmian klimatu

Directory of Open Access Journals (Sweden)

Agnieszka Sulikowska

2016-06-01

Full Text Available Obserwowany wzrost temperatury powietrza na półkuli północnej, zwłaszcza w Europie, może prowadzić do znacznych zmian w fenologii roślin, a w konsekwencji także w produkcji rolnej. Celem pracy jest ocena zróżnicowania przestrzennego zasobów termicznych na obszarze Polski oraz ich zmienności w okresie 1951–2010 w obliczu zmieniających się warunków termicznych. Analizę przeprowadzono z wykorzystaniem dobowych wartości temperatury powietrza. Zasoby termiczne zdefiniowane zostały za pomocą sum temperatur efektywnych (Growing Degree Days – GDD obliczonych dla wartości progowych temperatury powietrza: 0°C, 5°C i 10°C. Następstwem analizy zróżnicowania przestrzennego zasobów termicznych była ocena ich zmienności wieloletniej oraz tendencji zmian. Badania objęły w szczególności regiony sadownicze odznaczające się największą powierzchnią upraw drzew owocowych oraz wielkością zbiorów jabłek, śliw i wiśni. Uzyskane wyniki potwierdzają zwiększenie zasobów termicznych na obszarze kraju, będące konsekwencją wydłużającego się okresu wegetacyjnego.

Obituary Dr A. W. Kloos (1880—1952)

NARCIS (Netherlands)

Ooststroom, van S.J.

1952-01-01

At the end of the previous number of “Blumea” could just be inserted the death notice of one of the honorary collaborators of the Rijksherbarium, Dr Ir A. W. Kloos, who passed away in his home at Dordrecht on June 3rd, 1952. A more detailed obituary may follow here. Abraham Willem Kloos was born at

21 CFR 56.113 - Suspension or termination of IRB approval of research.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Suspension or termination of IRB approval of research. 56.113 Section 56.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... termination of IRB approval of research. An IRB shall have authority to suspend or terminate approval of...

21 CFR 113.83 - Establishing scheduled processes.

Science.gov (United States)

2010-04-01

... commercial production runs should be determined on the basis of recognized scientific methods to be of a size... CONTAINERS Production and Process Controls § 113.83 Establishing scheduled processes. Scheduled processes for... production shall be adequately provided for in establishing the scheduled process. Critical factors, e.g...

9 CFR 113.328 - Fowl Laryngotracheitis Vaccine.

Science.gov (United States)

2010-01-01

... REQUIREMENTS Live Virus Vaccines § 113.328 Fowl Laryngotracheitis Vaccine. Fowl Laryngotracheitis Vaccine shall be prepared from virus-bearing cell culture fluids or embryonated chicken eggs. Only Master Seed... each serial of modified live virus vaccine shall be tested for safety as provided in this paragraph...

Doświadczalna analiza współczynników oporów lokalnych na kolankach w systemach przewodów wielowarstwowych

Directory of Open Access Journals (Sweden)

Natalia Krystyna Gietka

2015-03-01

Full Text Available Zastosowanie tworzyw sztucznych jako materiału do budowy instalacji wymusiło konieczność weryfikacji dostępnych obecnie informacji dotyczących wartości współczynników oporów lokalnych, które stanowią niezbędną wiedzę potrzebną do obliczania wartości strat energii mechanicznej, jakie powstają w trakcie przepływu. Współczynniki te mają duże znaczenie w obliczeniach hydraulicznych wymiarowanej instalacji. Wpływają one na końcowy wynik w istotny sposób, dlatego nieprawidłowe ich przyjęcie może prowadzić do poważnych w skutkach błędów. Niestety wartości podawane przez producentów, normy czy też literaturę są inne w porównaniu z wartościami uzyskiwanymi metodą doświadczalnych badań. W artykule zaprezentowane zostały wyniki badań doświadczalnych, mających na celu wyznaczenie wartości współczynników oporów lokalnych na kolankach 90° trzech określonych średnic, pochodzących od czterech wybranych producentów systemów instalacyjnych. Otrzymane wartości współczynników oporów lokalnych porównano z wartościami, jakie podawane są przez producenta złączek, wyznaczonymi według normy PN-76/M-34034: 1976 oraz dostępnymi w literaturze przedmiotu.

W-band accelerator study in KEK

International Nuclear Information System (INIS)

Zhu Xiongwei; Nakajima, Kazuhisa

2001-01-01

In this paper, we summarize the W-band accelerator study in KEK. We present a design study on W-Band photocathode RF gun which is capable of generating and accelerating 300 pC electron bunch. The design system is made up of 91.392 GHz photocathode RF gun and 91.392 GHz traveling wave linac cells. Based on the numerical simulation using SUPERFISH and PARMELA and the conventional RF linac scaling law, the design will produce 300 pC at 1.74 MeV with bunch length 0.72 ps and normalized transverse emittance 0.55 mm mrad. We study the beam dynamics in high frequency and high gradient; due to the high gradient, the pondermotive effect plays an important role in beam dynamics; we found the pondermotive effect still exist with only the fundamental space harmonics (synchrotron mode) due to the coupling of the transverse and longitudinal motion

Design and comparison of a 10-kW interleaved boost converter for PV application using Si and SiC devices

NARCIS (Netherlands)

Chandra Mouli, G.R.; Schijffelen, Jos H.; Bauer, P.; Zeman, M.

2017-01-01

Grid-connected photovoltaic (PV) inverters have a dc/dc converter connected to the PV for executing the maximum power point tracking. The design of an interleaved boost converter (IBC) with three switching legs for a 10-kW PV inverter is presented in this paper. This paper shows how the use of

Project W-314 specific test and evaluation plan for SN-635 transfer line (241-AY-01A to 241-AY-02A) and SN-633 transfer line tie in

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the installation of the SN-635 transfer line for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-635 transfer line and the tie in of SN-633 to the AY-02A pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

Design, fabrication, and testing of a sodium evaporator for the STM4-120 kinematic Stirling engine

Energy Technology Data Exchange (ETDEWEB)

Rawlinson, K.S.; Adkins, D.R.

1995-05-01

This report describes the development and testing of a compact heat-pipe heat exchanger kW(e) designed to transfer thermal energy from hot combustion gases to the heater tubes of a 25-kW(e) Stirling engine. In this system, sodium evaporates from a surface that is heated by a stream of hot gases. The liquid metal then condenses on the heater tubes of a Stirling engine, where energy is transferred to the engine`s helium working fluid. Tests on a prototype unit illustrated that a compact (8 cm {times} 13 cm {times} 16 cm) sodium evaporator can routinely transfer 15 kW(t) of energy at an operating vapor temperature of 760 C. Four of these prototype units were eventually used to power a 25-kW(e) Stirling engine system. Design details and test results from the prototype unit are presented in this report.

Immobilized low-activity waste interim storage facility, Project W-465 conceptual design report

International Nuclear Information System (INIS)

Pickett, W.W.

1997-01-01

This report outlines the design and Total Estimated Cost to modify the four unused grout vaults for the remote handling and interim storage of immobilized low-activity waste (ILAW). The grout vault facilities in the 200 East Area of the Hanford Site were constructed in the 1980s to support Tank Waste disposal activities. The facilities were to serve project B-714 which was intended to store grouted low-activity waste. The existing 4 unused grout vaults, with modifications for remote handling capability, will provide sufficient capacity for approximately three years of immobilized low activity waste (ILAW) production from the Tank Waste Remediation System-Privatization Vendors (TWRS-PV). These retrofit modifications to the grout vaults will result in an ILAW interim storage facility (Project W465) that will comply with applicable DOE directives, and state and federal regulations

Immobilized low-activity waste interim storage facility, Project W-465 conceptual design report

Energy Technology Data Exchange (ETDEWEB)

Pickett, W.W.

1997-12-30

This report outlines the design and Total Estimated Cost to modify the four unused grout vaults for the remote handling and interim storage of immobilized low-activity waste (ILAW). The grout vault facilities in the 200 East Area of the Hanford Site were constructed in the 1980s to support Tank Waste disposal activities. The facilities were to serve project B-714 which was intended to store grouted low-activity waste. The existing 4 unused grout vaults, with modifications for remote handling capability, will provide sufficient capacity for approximately three years of immobilized low activity waste (ILAW) production from the Tank Waste Remediation System-Privatization Vendors (TWRS-PV). These retrofit modifications to the grout vaults will result in an ILAW interim storage facility (Project W465) that will comply with applicable DOE directives, and state and federal regulations.

75 FR 38179 - Proposed Collection; Comment Request for Forms W-8BEN, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2010-07-01

... W-8BEN, W-8ECI, W- 8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice... soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8ECI, Certificate of Foreign Person's Claim for Exemption From Withholding...

Cohesion strength and atomic structure of W-Cu graded interfaces

Energy Technology Data Exchange (ETDEWEB)

Liang, C.P.; Fan, J.L.; Gong, H.R., E-mail: gonghr@csu.edu.cn

2017-04-15

W-Cu graded interface is a solution to big differences of properties between W and Cu, while the number and composition of graded layers in the literature are quite different. The present first principles calculation reveals that W-rich graded interfaces possess higher strength and lower interface energy than Cu-rich counterparts. It shows that the differences of thermal expansion and Young’s modulus between overlayer and substrate are decisive factors in the design of Cu-rich and W-rich graded interfaces, respectively. A graded structure of W{sub 8}Cu{sub 1}/W{sub 7}Cu{sub 2}/W{sub 6}Cu{sub 3}/Cu{sub 6}W{sub 3}/Cu{sub 8}W{sub 1} is therefore suggested theoretically.

W-025, acceptance test report

International Nuclear Information System (INIS)

Roscha, V.

1994-01-01

This acceptance test report (ATR) has been prepared to establish the results of the field testing conducted on W-025 to demonstrate that the electrical/instrumentation systems functioned as intended by design. This is part of the RMW Land Disposal Facility

A Study of $W^{+}W^{-}\\gamma$ Events at LEP

CERN Document Server

Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Kramer, T; Krieger, P; Von Krogh, J; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

2004-01-01

A study of W+W- events accomanied by hard photon radiation produced in e+e- collisions at LEP is presented. Events consistent with being two on-shell W bosons and an isolated photon are selected from 681 pb^-1 of data recorded at 180 GeV < sqrt(s) < 209 GeV. For these data , 187 W+W- candidates are selected with photon energies greater than 2.5 GeV. The selected events are used to determine the W+ W- gamma cross section at five values of sqrt(s). The results are consistent with the Standard Model expectation. These data provide constraints on the related O(alpha) systematic uncertainties on the measurement of the W boson mass at LEP. Finally, the data are used to derive 95% C.L. upper limits on possible anomalous contributions to the W+ W- gamma gamma and W+ W- Z0 gamma vertices.

Design of the 50 kW neutron converter for SPIRAL2 facility

Energy Technology Data Exchange (ETDEWEB)

Avilov, M.S. [Budker Institute of Nuclear Physics, 630090 Novosibirsk, SB RAS (Russian Federation); Tecchio, L.B., E-mail: tecchio@lnl.infn.i [Laboratori Nazionali di Legnaro, 35020 Legnaro (Italy); Titov, A.T. [Boreskov Institute of Catalysis, 630090 Novosibirsk, SB RAS (Russian Federation); Tsybulya, V.S. [Trofimuk Institute of Geology, 630090 Novosibirsk, SB RAS (Russian Federation); Zhmurikov, E.I. [Budker Institute of Nuclear Physics, 630090 Novosibirsk, SB RAS (Russian Federation)

2010-06-21

SPIRAL2 is a facility for the study of fundamental nuclear physics and multidisciplinary research. SPIRAL2 represents a major advance for research on exotic nuclei. The radioactive ion beam (RIB) production system is comprised of a neutron converter, a target and an ion source. This paper is dedicated to the designing of the 50 kW neutron converter for the SPIRAL2 facility. Among the different variants of the neutron converter, the one based on a rotating solid disk seems quite attractive due to its safety, ease in production and relatively low cost. Dense graphite used as the converter's material allows the production of high-intensity neutron flux and, at the same time, the heat removal from the converter by means of radiation cooling. Thermo-mechanical simulations performed in order to determine the basic geometry and physical characteristics of the neutron production target for SPIRAL2 facility, to define the appropriate beam power distribution, and to predict the target behaviour under the deuteron beam of nominal parameters (40 MeV, 1.2 mA, 50 kW) are presented. To study the main physical and mechanical properties and serviceability under operating conditions, several kinds of graphite have been analyzed and tested. The paper reports the results of such measurements. Radiation damage is the most important issue for the application of graphite as neutron converter. It is well known that the thermal conductivity of the neutron-irradiated graphite is reduced by a factor of 10 from the initial value after irradiation. Difference in volume expansions between the matrix and the fiber results in serious damage of neutron-irradiated C/C composites. Calculations showed that at high temperature the effect of neutron radiation is not so critical and that the change in thermal conductivity does not prevent the use of graphite as neutron converter.

Design of the 50 kW neutron converter for SPIRAL2 facility

International Nuclear Information System (INIS)

Avilov, M.S.; Tecchio, L.B.; Titov, A.T.; Tsybulya, V.S.; Zhmurikov, E.I.

2010-01-01

SPIRAL2 is a facility for the study of fundamental nuclear physics and multidisciplinary research. SPIRAL2 represents a major advance for research on exotic nuclei. The radioactive ion beam (RIB) production system is comprised of a neutron converter, a target and an ion source. This paper is dedicated to the designing of the 50 kW neutron converter for the SPIRAL2 facility. Among the different variants of the neutron converter, the one based on a rotating solid disk seems quite attractive due to its safety, ease in production and relatively low cost. Dense graphite used as the converter's material allows the production of high-intensity neutron flux and, at the same time, the heat removal from the converter by means of radiation cooling. Thermo-mechanical simulations performed in order to determine the basic geometry and physical characteristics of the neutron production target for SPIRAL2 facility, to define the appropriate beam power distribution, and to predict the target behaviour under the deuteron beam of nominal parameters (40 MeV, 1.2 mA, 50 kW) are presented. To study the main physical and mechanical properties and serviceability under operating conditions, several kinds of graphite have been analyzed and tested. The paper reports the results of such measurements. Radiation damage is the most important issue for the application of graphite as neutron converter. It is well known that the thermal conductivity of the neutron-irradiated graphite is reduced by a factor of 10 from the initial value after irradiation. Difference in volume expansions between the matrix and the fiber results in serious damage of neutron-irradiated C/C composites. Calculations showed that at high temperature the effect of neutron radiation is not so critical and that the change in thermal conductivity does not prevent the use of graphite as neutron converter.

Conceptual design of a three-pole wiggler for the APS upgrade

Energy Technology Data Exchange (ETDEWEB)

Abliz, M., E-mail: mabliz@aps.anl.gov; Grimmer, J., E-mail: grimmer@aps.anl.gov; Dejus, R.; Ramanathan, M., E-mail: mohan@aps.anl.gov [The Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States)

2016-07-27

The current design of the Advanced Photon Source Upgrade (APS-U) project is a multi-bend achromat (MBA) lattice, which incorporates three-pole wigglers as radiation sources for the bending magnet beamlines. They are located in the short section between the M4 dipole and Q8 quadrupole magnets. Due to space constraints, a hybrid permanent magnet design is necessary to provide the required magnetic field strength. A three-pole wiggler with a flat peak field profile along the beam axis was designed to enhance the photon flux and flatten the transverse flux density distributions. The magnetic peak field at the center pole reached 1.08 Tesla for a magnetic gap of 26 mm. The maximum power density, integrated over all vertical angles, is 3.1 W/mm{sup 2}, which is substantially higher than that of the existing bending magnets at the APS (0.86 W/mm{sup 2}). Detailed designs of the three-pole wiggler is presented, including calculated spectral-angular flux distributions.

W-320 Project thermal modeling

Energy Technology Data Exchange (ETDEWEB)

Sathyanarayana, K., Fluor Daniel Hanford

1997-03-18

This report summarizes the results of thermal analysis performed to provide a technical basis in support of Project W-320 to retrieve by sluicing the sludge in Tank 241-C-106 and to transfer into Tank 241-AY-102. Prior theraml evaluations in support of Project W-320 safety analysis assumed the availability of 2000 to 3000 CFM, as provided by Tank Farm Operations, for tank floor cooling channels from the secondary ventilation system. As this flow availability has no technical basis, a detailed Tank 241-AY-102 secondary ventilation and floor coating channel flow model was developed and analysis was performed. The results of the analysis show that only about 150 cfm flow is in floor cooLing channels. Tank 241-AY-102 thermal evaluation was performed to determine the necessary cooling flow for floor cooling channels using W-030 primary ventilation system for different quantities of Tank 241-C-106 sludge transfer into Tank 241-AY-102. These sludge transfers meet different options for the project along with minimum required modification of the ventilation system. Also the results of analysis for the amount of sludge transfer using the current system is presented. The effect of sludge fluffing factor, heat generation rate and its distribution between supernatant and sludge in Tank 241-AY-102 on the amount of sludge transfer from Tank 241-C-106 were evaluated and the results are discussed. Also transient thermal analysis was performed to estimate the time to reach the steady state. For a 2 feet sludge transfer, about 3 months time will be requirad to reach steady state. Therefore, for the purpose of process control, a detailed transient thermal analysis using GOTH Computer Code will be required to determine transient response of the sludge in Tank 241-AY-102. Process control considerations are also discussed to eliminate the potential for a steam bump during retrieval and storage in Tanks 241-C-106 and 241-AY-102 respectively.

Do cosmological data rule out f (R ) with w ≠-1 ?

Science.gov (United States)

Battye, Richard A.; Bolliet, Boris; Pace, Francesco

2018-05-01

We review the equation of state (EoS) approach to dark sector perturbations and apply it to f (R ) gravity models of dark energy. We show that the EoS approach is numerically stable and use it to set observational constraints on designer models. Within the EoS approach we build an analytical understanding of the dynamics of cosmological perturbations for the designer class of f (R ) gravity models, characterized by the parameter B0 and the background equation of state of dark energy w . When we use the Planck cosmic microwave background temperature anisotropy, polarization, and lensing data as well as the baryonic acoustic oscillation data from SDSS and WiggleZ, we find B0<0.006 (95% C.L.) for the designer models with w =-1 . Furthermore, we find B0<0.0045 and |w +1 |<0.002 (95% C.L.) for the designer models with w ≠-1 . Previous analyses found similar results for designer and Hu-Sawicki f (R ) gravity models using the effective field theory approach [Raveri et al., Phys. Rev. D 90, 043513 (2014), 10.1103/PhysRevD.90.043513; Hu et al., Mon. Not. R. Astron. Soc. 459, 3880 (2016), 10.1093/mnras/stw775]; therefore this hints for the fact that generic f (R ) models with w ≠-1 can be tightly constrained by current cosmological data, complementary to solar system tests [Brax et al., Phys. Rev. D 78, 104021 (2008), 10.1103/PhysRevD.78.104021; Faulkner et al., Phys. Rev. D 76, 063505 (2007), 10.1103/PhysRevD.76.063505]. When compared to a w CDM fluid with the same sound speed, we find that the equation of state for f (R ) models is better constrained to be close to -1 by about an order of magnitude, due to the strong dependence of the perturbations on w .

Spinor Field Realizations of Non-critical $W_{2,s}$ Strings

OpenAIRE

Duan, Yi-Shi; Liu, Yu-Xiao; Zhang, Li-Jie

2005-01-01

In this paper, we construct the nilpotent Becchi-Rouet-Stora-Tyutin($BRST$) charges of spinor non-critical $W_{2,s}$ strings. The cases of $s=3,4$ are discussed in detail, and spinor realization for $s=4$ is given explicitly. The $BRST$ charges are graded.

Spinor field realizations of non-critical W2,s strings

International Nuclear Information System (INIS)

Duan, Y.S.; Liu, Y.X.; Zhang, L.J.

2004-01-01

In this paper, we construct the nilpotent Becchi-Rouet-Stora-Tyutin (BRST) charges of spinor non-critical W2,s strings. The cases of s=3,4 are discussed in detail, and spinor realization for s=4 is given explicitly. The BRST charges are graded

25 CFR 39.113 - What are the special accountability requirements for the gifted and talented program?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false What are the special accountability requirements for the gifted and talented program? 39.113 Section 39.113 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE... Talented Programs § 39.113 What are the special accountability requirements for the gifted and talented...

7 CFR 4287.113 - Release of collateral.

Science.gov (United States)

2010-01-01

... Loans § 4287.113 Release of collateral. (a) All releases of collateral with a value exceeding $100,000... loan. The Agency may, at its discretion, require an appraisal of the remaining collateral in cases... (a) of this section, lenders may, over the life of the loan, release collateral (other than personal...

An automated system for selective fission product separations; decays of 113-115Pd

International Nuclear Information System (INIS)

Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.

1981-01-01

A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)

Use of Cad Systems in Testing the Collision of Underground Transportation Means / Zastosowanie systemów Cad w badaniach kolizyjności środków transportu podziemnego

Science.gov (United States)

Dudek, Marek

2013-06-01

A concept of use of CAD systems in testing collision of underground transportation means is presented. Reasons for undertaking this problem are given with end users identified. The concept of the system for collision analyses of transported loads is described. Examples of collision analysis during transportation of powered roof support are given. Presented system is designed to aid planning, organizational and training activities undertaken in management of transportation safety in mines. It will be also possible to use software resources, developed within the system as the didactic material as regards safe transportation process, which include hazards to the employees working in the area of transportation operations. Developed prototype of a system for testing the collision of underground transportation means was positively assessed by employees of the Coal Company, JSC - industrial partner of KOMAG. This prototype is continuously improved and adapted for commercial implementation in the selected coal mines. W pracy przedstawiono koncepcję zastosowania systemów CAD w badaniach kolizyjności środków transportu podziemnego. Określono przyczyny podjęcia tematu oraz zidentyfikowano końcowych użytkowników. Zaprezentowano koncepcję systemu do analiz kolizyjności transportowanych ładunków. Pokazano przykłady analizy kolizyjności podczas transportu sekcji obudowy zmechanizowanej. Przedstawiony system przeznaczony jest do wspomagania działań planistycznych, organizacyjnych i szkoleniowych podejmowanych w zarządzaniu bezpieczeństwem transportu w zakładach górniczych. Opracowane w ramach systemu zasoby programowe będzie można również wykorzystać jako materiał dydaktyczny z zakresu bezpieczeństwa pracy w transporcie, uwzględniający zagrożenia dla pracowników pracujących w bezpośredniej strefie prac transportowych. Opracowany prototyp systemu do badania kolizyjności środków transportu podziemnego został pozytywnie oceniony przez pracowników

Reactivity of solvent alcohol on degradation of CFC113

International Nuclear Information System (INIS)

Nakagawa, Seiko

2003-01-01

1,1,2-Trichloro-trifluoroethane (CFC113) was dissolved in alkaline 1-butanol, 2-butanol, iso-butyl alcohol, and phenyl ethyl alcohol and irradiated with 60 Co gamma rays after purged with pure nitrogen gas. In all these solvents, the concentration of CFC113 and hydroxide ion decreased and that of chloride ion increased with a dose observed in 2-propanol solution. The reaction efficiency increases in order of 1-butanol< iso-butyl alcohol< phenyl ethyl alcohol<2-butanol<2-propanol. The solvent effect will depend on the binding energy of the αC-H of the alcohol molecule and electron affinity and dipole moment of the ketones or aldehydes produced from the alcohols

Physical properties of W gravities and W strings

International Nuclear Information System (INIS)

Das, S.R.; Dhar, A.; Rama, S.K.

1991-01-01

This paper investigates some basic physical properties of W gravities and W strings, using a free field realization. The authors argue that the configuration space of W gravities have global characteristics in addition to the Euler characteristic. The authors identify one such global quantity to be a monopole charge and show how this charge appears in the exponents. The free energy would then involve a θ parameter. Using a BRST procedure the authors find all the physical states of W 3 and W 4 gravities, and show that physical operators are nonsingular composites of the screening charge operators. (The latter are not physical operators for N ≥ 3.) For W strings we show how the W constraints lead to the emergence of a single (and not many) extra dimension coming from the W-gravity sector. By analyzing the resulting dispersion relations the authors find that both the lower and upper critical dimensions are lowered compared to ordinary two-dimensional gravity. The pure W gravity spectrum reveals an intriguing numerological connection with unitary minimal models coupled to ordinary gravity

Spuścizny konserwatorów zbiorów, kierowników i dyrektorów Biblioteki Poznańskiego Towarzystwa Przyjaciół Nauk

Directory of Open Access Journals (Sweden)

Michał Boksa

2011-01-01

Full Text Available Artykuł prezentuje sylwetki konserwatorów zbiorów, kierowników i dyrektorów Biblioteki Poznańskiego Towarzystwa Przyjaciół Nauk (PTPN oraz to, co po nich pozostało w postaci archiwaliów. Od momentu powstania Biblioteka PTPN gromadziła rękopisy lub całe spuścizny wybitnych osób, w tym kierujących tą placówką. Również inne biblioteki i archiwa zakładowe instytucji, z którymi byli oni związani, włączały do swych zbiorów ich materiały archiwalne. Spuścizny Ludwiki Dobrzyńskiej-Rybickiej i Ryszarda Marciniaka znajdują się zarówno w Bibliotece PTPN, jak i w Polskiej Akademii Nauk Archiwum w Warszawie Oddział w Poznaniu. Znaczna część materiałów archiwalnych Bolesława Erzepkiego trafiła natomiast do Działu Zbiorów Specjalnych Biblioteki Raczyńskich w Poznaniu. Szczątkowe materiały archiwalne można też znaleźć w Archiwum Uniwersytetu im. Adama Mickiewicza w Poznaniu (Ludwika Dobrzyńska-Rybicka oraz w Archiwum Biblioteki Uniwersyteckiej w Poznaniu (Ludwika Dobrzyńska-Rybicka, Jan Baumgart, Aniela Koehlerówna.

Numerical and experimental investigation on the performance of three newly designed 100 kW-class tidal current turbines

Directory of Open Access Journals (Sweden)

Museok Song

2012-09-01

Full Text Available Three types of 100 kW-class tidal stream turbines are proposed and their performance is studied both numerically and experimentally. Following a wind turbine design procedure, a base blade is derived and two additional blades are newly designed focusing more on efficiency and cavitation. For the three designed turbines, a CFD is performed by using FLUENT. The calculations predict that the newly designed turbines perform better than the base turbine and the tip vortex can be reduced with additional efficiency increase by adopting a tip rake. The performance of the turbines is tested in a towing tank with 700 mm models. The scale problem is carefully investigated and the measurements are compared with the CFD results. All the prediction from the CFD is supported by the model experiment with some quantitative discrepancy. The maximum efficiencies are 0.49 (CFD and 0.45 (experiment at TSR 5.17 for the turbine with a tip rake.

Ground state properties of new element Z=113 and its alpha decay chain

International Nuclear Information System (INIS)

Tai Fei; Chen Dinghan; Xu Chang; Ren Zhongzhou

2005-01-01

The authors investigate the ground state properties of the new element 278 113 and of the α-decay chain with different models, where the new element Z=113 has been produced at RIKEN in Japan by cold-fusion reaction. The experimental decay energies are reproduced by the deformed relativistic mean-field model, by the Skyrme-Hartree-Fock (SHF) model, and by the macroscopic-microscopic model. Theoretical half-lives also reasonably agree with the data. Calculations further show that prolate deformation is important for the ground states of the nuclei in the α-decay chain of 278 113. The common points and differences among different models are compared and discussed. (author)

Advanced conceptual design report: T Plant secondary containment and leak detection upgrades. Project W-259

International Nuclear Information System (INIS)

Hookfin, J.D.

1995-01-01

The T Plant facilities in the 200-West Area of the Hanford site were constructed in the early 1940s to produce nuclear materials in support of national defense activities. T Plant includes the 271-T facility, the 221-T facility, and several support facilities (eg, 2706-T), utilities, and tanks/piping systems. T Plant has been recommended as the primary interim decontamination facility for the Hanford site. Project W-259 will provide capital upgrades to the T Plant facilities to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. This document provides an advanced conceptual design concept that complies with functional requirements for the T Plant Secondary Containment and Leak Detection upgrades

A Sub-µW Tuneable Switched-Capacitor Amplifier-Filter for Neural Recording Using a Class-C Inverter

Directory of Open Access Journals (Sweden)

A Ghorbani-Nejad

2013-12-01

Full Text Available A two stage sub-µW Inverter-based switched-capacitor amplifier-filter is presented which is capable of amplifying both spikes and local field potentials (LFP signals. Here we employ a switched capacitor technique for frequency tuning and reducing of 1/f noise of two stages. The reduction of power consumption is very necessary for neural recording devices however, in switched capacitor (SC circuits OTA is a major building block that consumes most of the power. Therefore an OTA-less technique utilizing a class-C inverter is employed that significantly reduces the power consumption. A detailed analysis of noise performance for the inverter-based SC circuits is presented. A mathematical model useful for analysis of such SC integrators is derived and a good comparison is obtained between simulation and analytical technique. With a supply voltage of 0.7V and using 0.18 µm CMOS technology, this design can achieves a power consumption of about 538 nW. The designed amplifier-filter has the gains 18.6 dB and 28.2 dB for low pass only and cascaded filter, respectively. By applying different sampling frequencies, the filter attains a reconfigurable bandwidth.

Design considerations for a 10-kW integrated hydrogen-oxygen regenerative fuel cell system

Science.gov (United States)

Hoberecht, M. A.; Miller, T. B.; Rieker, L. L.; Gonzalez-Sanabria, O. D.

1984-01-01

Integration of an alkaline fuel cell subsystem with an alkaline electrolysis subsystem to form a regenerative fuel cell (RFC) system for low earth orbit (LEO) applications characterized by relatively high overall round trip electrical efficiency, long life, and high reliability is possible with present state of the art technology. A hypothetical 10 kW system computer modeled and studied based on data from ongoing contractual efforts in both the alkaline fuel cell and alkaline water electrolysis areas. The alkaline fuel cell technology is under development utilizing advanced cell components and standard Shuttle Orbiter system hardware. The alkaline electrolysis technology uses a static water vapor feed technique and scaled up cell hardware is developed. The computer aided study of the performance, operating, and design parameters of the hypothetical system is addressed.

Characterization of the genome of the dairy Lactobacillus helveticus bacteriophage {Phi}AQ113.

Science.gov (United States)

Zago, Miriam; Scaltriti, Erika; Rossetti, Lia; Guffanti, Alessandro; Armiento, Angelarita; Fornasari, Maria Emanuela; Grolli, Stefano; Carminati, Domenico; Brini, Elena; Pavan, Paolo; Felsani, Armando; D'Urzo, Annalisa; Moles, Anna; Claude, Jean-Baptiste; Grandori, Rita; Ramoni, Roberto; Giraffa, Giorgio

2013-08-01

The complete genomic sequence of the dairy Lactobacillus helveticus bacteriophage ΦAQ113 was determined. Phage ΦAQ113 is a Myoviridae bacteriophage with an isometric capsid and a contractile tail. The final assembled consensus sequence revealed a linear, circularly permuted, double-stranded DNA genome with a size of 36,566 bp and a G+C content of 37%. Fifty-six open reading frames (ORFs) were predicted, and a putative function was assigned to approximately 90% of them. The ΦAQ113 genome shows functionally related genes clustered together in a genome structure composed of modules for DNA replication/regulation, DNA packaging, head and tail morphogenesis, cell lysis, and lysogeny. The identification of genes involved in the establishment of lysogeny indicates that it may have originated as a temperate phage, even if it was isolated from natural cheese whey starters as a virulent phage, because it is able to propagate in a sensitive host strain. Additionally, we discovered that the ΦAQ113 phage genome is closely related to Lactobacillus gasseri phage KC5a and Lactobacillus johnsonii phage Lj771 genomes. The phylogenetic similarities between L. helveticus phage ΦAQ113 and two phages that belong to gut species confirm a possible common ancestral origin and support the increasing consideration of L. helveticus as a health-promoting organism.

ARP/wARP and molecular replacement: the next generation

International Nuclear Information System (INIS)

Cohen, Serge X.; Ben Jelloul, Marouane; Long, Fei; Vagin, Alexei; Knipscheer, Puck; Lebbink, Joyce; Sixma, Titia K.; Lamzin, Victor S.; Murshudov, Garib N.; Perrakis, Anastassis

2008-01-01

A systematic test shows how ARP/wARP deals with automated model building for structures that have been solved by molecular replacement. A description of protocols in the flex-wARP control system and studies of two specific cases are also presented. Automatic iterative model (re-)building, as implemented in ARP/wARP and its new control system flex-wARP, is particularly well suited to follow structure solution by molecular replacement. More than 100 molecular-replacement solutions automatically solved by the BALBES software were submitted to three standard protocols in flex-wARP and the results were compared with final models from the PDB. Standard metrics were gathered in a systematic way and enabled the drawing of statistical conclusions on the advantages of each protocol. Based on this analysis, an empirical estimator was proposed that predicts how good the final model produced by flex-wARP is likely to be based on the experimental data and the quality of the molecular-replacement solution. To introduce the differences between the three flex-wARP protocols (keeping the complete search model, converting it to atomic coordinates but ignoring atom identities or using the electron-density map calculated from the molecular-replacement solution), two examples are also discussed in detail, focusing on the evolution of the models during iterative rebuilding. This highlights the diversity of paths that the flex-wARP control system can employ to reach a nearly complete and accurate model while actually starting from the same initial information

Reagent' sets for the concentration of sup(99m)Tc and sup(113m)In

International Nuclear Information System (INIS)

Bianco de Salas, G.N.; Arciprete, J.; Mitta, A.E.A.

1976-10-01

A simple technique for the concentration of the eluates from 99 Mo/sup(99m)Tc and 113 Sn/sup(113m)In generators is described. The reagents' sets provided by the C.N.E.A. for the labelling of different radiopharmaceuticals can be used by only reducing their volumes proportionally. Both concentration techniques for Tc-99m and In-113m will be supplied to users as reagents' sets. (author) [es

Aspekt formalnoprawny stosowania systemów ustalania lokalizacji w czasie rzeczywistym do eliminacji marnotrawstwa w procesie budowlanym

Directory of Open Access Journals (Sweden)

Piotr Nowotarski

2017-06-01

Full Text Available W artykule przedstawiono ideę systemów typu RTLS pod kątem wykorzystania ich w celu eliminacji marnotrawstwa w procesie budowlanym. Opisywane systemy z punktu widzenia strumienia wartości są pomocne w wykrywaniu czynności niedodających wartości. Autorzy przedstawili temat w aspekcie formalno-prawnym związanym z monitorowaniem i śledzeniem pracowników podczas pracy. Zwrócono uwagę na niezbędne dokumenty, pozwolenia, zgłoszenia i zgody pracowników, które zgodnie z obowiązującym w Polsce prawem należy posiadać, aby móc wykorzystywać tego typu systemy do zbierania i przetwarzania danych o lokalizacji pracowników w trakcie wykonywania prac.

Dynamic simulation of 10 kW Brayton cryocooler for HTS cable

Science.gov (United States)

Chang, Ho-Myung; Park, Chan Woo; Yang, Hyung Suk; Hwang, Si Dole

2014-01-01

Dynamic simulation of a Brayton cryocooler is presented as a partial effort of a Korean governmental project to develop 1˜3 km HTS cable systems at transmission level in Jeju Island. Thermodynamic design of a 10 kW Brayton cryocooler was completed, and a prototype construction is underway with a basis of steady-state operation. This study is the next step to investigate the transient behavior of cryocooler for two purposes. The first is to simulate and design the cool-down process after scheduled or unscheduled stoppage. The second is to predict the transient behavior following the variation of external conditions such as cryogenic load or outdoor temperature. The detailed specifications of key components, including plate-fin heat exchangers and cryogenic turbo-expanders are incorporated into a commercial software (Aspen HYSYS) to estimate the temporal change of temperature and flow rate over the cryocooler. An initial cool-down scenario and some examples on daily variation of cryocooler are presented and discussed, aiming at stable control schemes of a long cable system.

Dynamic simulation of 10 kW Brayton cryocooler for HTS cable

International Nuclear Information System (INIS)

Chang, Ho-Myung; Park, Chan Woo; Yang, Hyung Suk; Hwang, Si Dole

2014-01-01

Dynamic simulation of a Brayton cryocooler is presented as a partial effort of a Korean governmental project to develop 1∼3 km HTS cable systems at transmission level in Jeju Island. Thermodynamic design of a 10 kW Brayton cryocooler was completed, and a prototype construction is underway with a basis of steady-state operation. This study is the next step to investigate the transient behavior of cryocooler for two purposes. The first is to simulate and design the cool-down process after scheduled or unscheduled stoppage. The second is to predict the transient behavior following the variation of external conditions such as cryogenic load or outdoor temperature. The detailed specifications of key components, including plate-fin heat exchangers and cryogenic turbo-expanders are incorporated into a commercial software (Aspen HYSYS) to estimate the temporal change of temperature and flow rate over the cryocooler. An initial cool-down scenario and some examples on daily variation of cryocooler are presented and discussed, aiming at stable control schemes of a long cable system

Dynamic simulation of 10 kW Brayton cryocooler for HTS cable

Energy Technology Data Exchange (ETDEWEB)

Chang, Ho-Myung; Park, Chan Woo [Hong Ik University, Department of Mechanical Engineering, Seoul, 121-791 (Korea, Republic of); Yang, Hyung Suk; Hwang, Si Dole [KEPCO Research Institute, Daejeon, 305-760 (Korea, Republic of)

2014-01-29

Dynamic simulation of a Brayton cryocooler is presented as a partial effort of a Korean governmental project to develop 1∼3 km HTS cable systems at transmission level in Jeju Island. Thermodynamic design of a 10 kW Brayton cryocooler was completed, and a prototype construction is underway with a basis of steady-state operation. This study is the next step to investigate the transient behavior of cryocooler for two purposes. The first is to simulate and design the cool-down process after scheduled or unscheduled stoppage. The second is to predict the transient behavior following the variation of external conditions such as cryogenic load or outdoor temperature. The detailed specifications of key components, including plate-fin heat exchangers and cryogenic turbo-expanders are incorporated into a commercial software (Aspen HYSYS) to estimate the temporal change of temperature and flow rate over the cryocooler. An initial cool-down scenario and some examples on daily variation of cryocooler are presented and discussed, aiming at stable control schemes of a long cable system.

Design and tailoring of Ni-Sn-W composites for bonded abrasive applications

Energy Technology Data Exchange (ETDEWEB)

Kourtoukova, G.L.; Demetry, C.; Biederman, R.R. [Worcester Polytechnic Inst., MA (United States). Materials Science and Engineering Program; Ramanath, S.; Andrews, R.M.; Jacobs, D.S. [Saint-Gobain/Norton Company, Worcester, MA (United States)

2000-01-15

The combination of properties ideal for metal bonds in abrasive products can rarely be achieved in a monolithic material. This research demonstrates a successful approach for producing a composite bond with higher elastic modulus without a significant increase in wear resistance, by taking advantage of the reaction between matrix and reinforcement to produce intermetallics. Composites comprised of a Ni-Sn matrix with continuous W fiber and/or W powder dispersoid were prepared by powder metallurgy methods. Composite specimens densified by hot pressing were characterized with a combination of scanning electron microscopy (SEM) and energy dispersive X-ray (EDX) analyses, measurements of wear resistance, and measurements of Young's modulus and hardness by both bulk and nanoindentation methods. A significant stiffening effect was observed; the elastic modulus of the composites was up to 30% greater than that predicted by a rule of mixtures based on the moduli of the unreacted fiber and matrix constituents alone. As desired, the wear resistance of the composite was approximately equal to that of the Ni-Sn matrix. One contribution to this combination of properties is believed to be the high elastic moduli and likely low fracture toughness of the Ni-W and Ni-Sn intermetallics that are formed. Properties of the Ni-Sn-W composites are contrasted with those of a Ni-Sn matrix reinforced with WC particulate, where no reaction occurs at the interface. (orig.)

In vivo red blood cell compatibility testing using indium-113m tropolone-labeled red blood cells

International Nuclear Information System (INIS)

Morrissey, G.J.; Gravelle, D.; Dietz, G.; Driedger, A.A.; King, M.; Cradduck, T.D.

1988-01-01

In vivo radionuclide crossmatch is a method for identifying compatible blood for transfusion when allo- or autoantibodies preclude the use of conventional crossmatching techniques. A technique for labeling small volumes of donor red blood cells with [/sup 113m/In]tropolone is reported. The use of /sup 113m/In minimizes the accumulation of background radioactivity and the radiation dose especially so when multiple crossmatches are performed. Labeling red cells with [/sup 113m/In]tropolone is faster and easier to perform than with other radionuclides. Consistently high labeling efficiencies are obtained and minimal /sup 113m/In activity elutes from the labeled red blood cells. A case study involving 22 crossmatches is presented to demonstrate the technique. The radiation dose equivalent from /sup 113m/In is significantly less than with other radionuclides that may be used to label red cells

Baseline design of an OTEC pilot plantship. Volume A. Detailed report. [Performance analysis of OTEC power plant

Energy Technology Data Exchange (ETDEWEB)

George, J. F.; Richards, D.; Perini, L. L.

1979-05-01

The Applied Physics Laboratory (APL) of the Johns Hopkins University has engineered a baseline design of an Ocean Thermal Energy Conversion (OTEC) pilot plantship. The work was sponsored jointly by the Department of Energy and the US Maritime Administration of the Department of Commerce. The design, drawings, specifications, supporting calculations, and narrative documentation are available through APL for use by the Government and industry for the acquisition of a pilot OTEC system. The baseline design features a platform that is configured to produce up to 20 MW(e) (net) power, using low-cost folded-tube aluminum heat exchangers, while it grazes slowly in tropical waters where the thermal gradient is greatest and the ocean environment is least severe. The design was developed by a team of contractors whose capabilities provided a systems approach to the design process. The work is documented in three volumes. Volume A is the Detailed report, which develops the design rationale, summarizes important calculations, outlines areas for future work, and presents a study of system costs. Volumes B and C, respectively, contain the engineering drawings and specifications.

MIV project: Simulator detailed design and integration for the EUROSIM

DEFF Research Database (Denmark)

Thuesen, Gøsta; Parisch, Manlio; Jørgensen, John Leif

1997-01-01

Under the ESA contract #11453/95/NL/JG(SC), aiming at assessing the feasibility of Rendez-vous and docking of unmanned spacecrafts, a reference mission scenario was defined. This report describes the detailed code developed for the contract, the code module interface and the interface to the EURO......Under the ESA contract #11453/95/NL/JG(SC), aiming at assessing the feasibility of Rendez-vous and docking of unmanned spacecrafts, a reference mission scenario was defined. This report describes the detailed code developed for the contract, the code module interface and the interface...

Bose-Einstein correlations in W+ W- events at LEP2

CERN Document Server

van Dalen, Jorn A

2000-01-01

Analyses of Bose-Einstein Correlations in w+w- events at LEP2 by the four LEP collaborations are presented. In particular, Bose-Einstein correlations in w+w- overlap are investigated and the possible existence of these correlations between particles coming from different W's, which may influence the W mass measurements in the fully-hadronic channel e+e- --+ w+w- --+ qiihq3ij<. No evidence for such an inter-W Bose-Einstein correlation is found by L3 and ALEPH. Possible indication of these correlations by DELPHI is mentioned.

Akcentuacja zapożyczonych leksemów czasownikowych w gwarze staroobrzędowców mieszkających w regionie suwalsko-augustowskim