Energy Technology Data Exchange (ETDEWEB)
Clark, M.E.; He, Q.; He, Z.; Huang, K.H.; Alm, E.J.; Wan, X.-F.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Zhou, J.-Z.; Fields, M.W.
2006-08-01
Desulfovibrio vulgaris was cultivated in a defined medium, and biomass was sampled for approximately 70 h to characterize the shifts in gene expression as cells transitioned from the exponential to the stationary phase during electron donor depletion. In addition to temporal transcriptomics, total protein, carbohydrate, lactate, acetate, and sulfate levels were measured. The microarray data were examined for statistically significant expression changes, hierarchical cluster analysis, and promoter element prediction and were validated by quantitative PCR. As the cells transitioned from the exponential phase to the stationary phase, a majority of the down-expressed genes were involved in translation and transcription, and this trend continued at the remaining times. There were general increases in relative expression for intracellular trafficking and secretion, ion transport, and coenzyme metabolism as the cells entered the stationary phase. As expected, the DNA replication machinery was down-expressed, and the expression of genes involved in DNA repair increased during the stationary phase. Genes involved in amino acid acquisition, carbohydrate metabolism, energy production, and cell envelope biogenesis did not exhibit uniform transcriptional responses. Interestingly, most phage-related genes were up-expressed at the onset of the stationary phase. This result suggested that nutrient depletion may affect community dynamics and DNA transfer mechanisms of sulfate-reducing bacteria via the phage cycle. The putative feoAB system (in addition to other presumptive iron metabolism genes) was significantly up-expressed, and this suggested the possible importance of Fe{sup 2+} acquisition under metal-reducing conditions. The expression of a large subset of carbohydrate-related genes was altered, and the total cellular carbohydrate levels declined during the growth phase transition. Interestingly, the D. vulgaris genome does not contain a putative rpoS gene, a common attribute
Salt Stress in Desulfovibrio vulgaris Hildenborough: An integratedgenomics approach
Energy Technology Data Exchange (ETDEWEB)
Mukhopadhyay, Aindrila; He, Zhili; Alm, Eric J.; Arkin, Adam P.; Baidoo, Edward E.; Borglin, Sharon C.; Chen, Wenqiong; Hazen, Terry C.; He, Qiang; Holman, Hoi-Ying; Huang, Katherine; Huang, Rick; Hoyner,Dominique C.; Katz, Natalie; Keller, Martin; Oeller, Paul; Redding,Alyssa; Sun, Jun; Wall, Judy; Wei, Jing; Yang, Zamin; Yen, Huei-Che; Zhou, Jizhong; Keasling Jay D.
2005-12-08
The ability of Desulfovibrio vulgaris Hildenborough to reduce, and therefore contain, toxic and radioactive metal waste has made all factors that affect the physiology of this organism of great interest. Increased salinity is an important and frequent fluctuation faced by D. vulgaris in its natural habitat. In liquid culture, exposure to excess salt resulted in striking elongation of D. vulgaris cells. Using data from transcriptomics, proteomics, metabolite assays, phospholipid fatty acid profiling, and electron microscopy, we used a systems approach to explore the effects of excess NaCl on D. vulgaris. In this study we demonstrated that import of osmoprotectants, such as glycine betaine and ectoine, is the primary mechanism used by D. vulgaris to counter hyperionic stress. Several efflux systems were also highly up-regulated, as was the ATP synthesis pathway. Increases in the levels of both RNA and DNA helicases suggested that salt stress affected the stability of nucleic acid base pairing. An overall increase in the level of branched fatty acids indicated that there were changes in cell wall fluidity. The immediate response to salt stress included up-regulation of chemotaxis genes, although flagellar biosynthesis was down-regulated. Other down-regulated systems included lactate uptake permeases and ABC transport systems. The results of an extensive NaCl stress analysis were compared with microarray data from a KCl stress analysis, and unlike many other bacteria, D. vulgaris responded similarly to the two stresses. Integration of data from multiple methods allowed us to develop a conceptual model for the salt stress response in D. vulgaris that can be compared to those in other microorganisms.
Energy metabolism in Desulfovibrio vulgaris Hildenborough: insights from transcriptome analysis
Energy Technology Data Exchange (ETDEWEB)
Pereira, Patricia M.; He, Qiang; Valente, Filipa M.A.; Xavier, Antonio V.; Zhou, Jizhong; Pereira, Ines A.C.; Louro, Ricardo O.
2007-11-01
Sulphate-reducing bacteria are important players in the global sulphur and carbon cycles, with considerable economical and ecological impact. However, the process of sulphate respiration is still incompletely understood. Several mechanisms of energy conservation have been proposed, but it is unclear how the different strategies contribute to the overall process. In order to obtain a deeper insight into the energy metabolism of sulphate-reducers whole-genome microarrays were used to compare the transcriptional response of Desulfovibrio vulgaris Hildenborough grown with hydrogen/sulphate, pyruvate/sulphate, pyruvate with limiting sulphate, and lactate/thiosulphate, relative to growth in lactate/sulphate. Growth with hydrogen/sulphate showed the largest number of differentially expressed genes and the largest changes in transcript levels. In this condition the most up-regulated energy metabolism genes were those coding for the periplasmic [NiFeSe]hydrogenase, followed by the Ech hydrogenase. The results also provide evidence for the involvement of formate cycling and the recently proposed ethanol pathway during growth in hydrogen. The pathway involving CO cycling is relevant during growth on lactate and pyruvate, but not during growth in hydrogen as the most down-regulated genes were those coding for the CO-induced hydrogenase. Growth on lactate/thiosulphate reveals a down-regulation of several energymetabolism genes similar to what was observed in the presence of nitrite. This study identifies the role of several proteins involved in the energy metabolism of D. vulgaris and highlights several novel genes related to this process, revealing a more complex bioenergetic metabolism than previously considered.
Global Analysis of Heat Shock Response in Desulfovibrio vulgaris Hildenborough.
Energy Technology Data Exchange (ETDEWEB)
Chhabra, S.R.; He, Q.; Huang, K.H.; Gaucher, S.P.; Alm, E.J.; He,Z.; Hadi, M.Z.; Hazen, T.C.; Wall, J.D.; Zhou, J.; Arkin, A.P.; Singh, A.K.
2005-09-16
Desulfovibrio vulgaris Hildenborough belongs to a class ofsulfate-reducing bacteria (SRB) and is found ubiquitously in nature.Given the importance of SRB-mediated reduction for bioremediation ofmetal ion contaminants, ongoing research on D. vulgaris has been in thedirection of elucidating regulatory mechanisms for this organism under avariety of stress conditions. This work presents a global view of thisorganism's response to elevated growth temperature using whole-celltranscriptomics and proteomics tools. Transcriptional response (1.7-foldchange or greater; Z>1.5) ranged from 1,135 genes at 15 min to 1,463genes at 120 min for a temperature up-shift of 13oC from a growthtemperature of 37oC for this organism and suggested both direct andindirect modes of heat sensing. Clusters of orthologous group categoriesthat were significantly affected included posttranslationalmodifications; protein turnover and chaperones (up-regulated); energyproduction and conversion (down-regulated), nucleotide transport,metabolism (down-regulated), and translation; ribosomal structure; andbiogenesis (down-regulated). Analysis of the genome sequence revealed thepresence of features of both negative and positive regulation whichincluded the CIRCE element and promoter sequences corresponding to thealternate sigma factors ?32 and ?54. While mechanisms of heat shockcontrol for some genes appeared to coincide with those established forEscherichia coli and Bacillus subtilis, the presence of unique controlschemes for several other genes was also evident. Analysis of proteinexpression levels using differential in-gel electrophoresis suggestedgood agreement with transcriptional profiles of several heat shockproteins, including DnaK (DVU0811), HtpG (DVU2643), HtrA (DVU1468), andAhpC (DVU2247). The proteomics study also suggested the possibility ofposttranslational modifications in the chaperones DnaK, AhpC, GroES(DVU1977), and GroEL (DVU1976) and also several periplasmic ABCtransporters.
Directory of Open Access Journals (Sweden)
Kara B. De León
2017-10-01
Full Text Available Biofilms of sulfate-reducing bacteria (SRB are of particular interest as members of this group are culprits in corrosion of industrial metal and concrete pipelines as well as being key players in subsurface metal cycling. Yet the mechanism of biofilm formation by these bacteria has not been determined. Here we show that two supposedly identical wild-type cultures of the SRB Desulfovibrio vulgaris Hildenborough maintained in different laboratories have diverged in biofilm formation. From genome resequencing and subsequent mutant analyses, we discovered that a single nucleotide change within DVU1017, the ABC transporter of a type I secretion system (T1SS, was sufficient to eliminate biofilm formation in D. vulgaris Hildenborough. Two T1SS cargo proteins were identified as likely biofilm structural proteins, and the presence of at least one (with either being sufficient was shown to be required for biofilm formation. Antibodies specific to these biofilm structural proteins confirmed that DVU1017, and thus the T1SS, is essential for localization of these adhesion proteins on the cell surface. We propose that DVU1017 is a member of the lapB category of microbial surface proteins because of its phenotypic similarity to the adhesin export system described for biofilm formation in the environmental pseudomonads. These findings have led to the identification of two functions required for biofilm formation in D. vulgaris Hildenborough and focus attention on the importance of monitoring laboratory-driven evolution, as phenotypes as fundamental as biofilm formation can be altered.
Identification and Characterization of the Major Porin of Desulfovibrio vulgaris Hildenborough
Zeng, Lucy; Wooton, Etsuko; Stahl, David A.
2017-01-01
ABSTRACT Due in large part to their ability to facilitate the diffusion of a diverse range of solutes across the outer membrane (OM) of Gram-negative bacteria, the porins represent one of the most prominent and important bacterial membrane protein superfamilies. Notably, for the Gram-negative bacterium Desulfovibrio vulgaris Hildenborough, a model organism for studies of sulfate-reducing bacteria, no genes for porins have been identified or proposed in its annotated genome. Results from initial biochemical studies suggested that the product of the DVU0799 gene, which is one of the most abundant proteins of the D. vulgaris Hildenborough OM and purified as a homotrimeric complex, was a strong porin candidate. To investigate this possibility, this protein was further characterized biochemically and biophysically. Structural analyses via electron microscopy of negatively stained protein identified trimeric particles with stain-filled depressions and structural modeling suggested a β-barrel structure for the monomer, motifs common among the known porins. Functional studies were performed in which crude OM preparations or purified DVU0799 was reconstituted into proteoliposomes and the proteoliposomes were examined for permeability against a series of test solutes. The results obtained establish DVU0799 to be a pore-forming protein with permeability properties similar to those observed for classical bacterial porins, such as those of Escherichia coli. Taken together, these findings identify this highly abundant OM protein to be the major porin of D. vulgaris Hildenborough. Classification of DVU0799 in this model organism expands the database of functionally characterized porins and may also extend the range over which sequence analysis strategies can be used to identify porins in other bacterial genomes. IMPORTANCE Porins are membrane proteins that form transmembrane pores for the passive transport of small molecules across the outer membranes of Gram-negative bacteria
Energy Technology Data Exchange (ETDEWEB)
He, Z.; Zhou, A.; Baidoo, E.; He, Q.; Joachimiak, M. P.; Benke, P.; Phan, R.; Mukhopadhyay, A.; Hemme, C.L.; Huang, K.; Alm, E.J.; Fields, M.W.; Wall, J.; Stahl, D.; Hazen, T.C.; Keasling, J.D.; Arkin, A.P.; Zhou, J.
2009-12-01
The response of Desulfovibrio vulgaris Hildenborough to salt adaptation (long-term NaCl exposure) was examined by physiological, global transcriptional, and metabolite analyses. The growth of D. vulgaris was inhibited by high levels of NaCl, and the growth inhibition could be relieved by the addition of exogenous amino acids (e.g., glutamate, alanine, tryptophan) or yeast extract. Salt adaptation induced the expression of genes involved in amino acid biosynthesis and transport, electron transfer, hydrogen oxidation, and general stress responses (e.g., heat shock proteins, phage shock proteins, and oxidative stress response proteins). Genes involved in carbon metabolism, cell motility, and phage structures were repressed. Comparison of transcriptomic profiles of D. vulgaris responses to salt adaptation with those of salt shock (short-term NaCl exposure) showed some similarity as well as a significant difference. Metabolite assays showed that glutamate and alanine were accumulated under salt adaptation, suggesting that they may be used as osmoprotectants in D. vulgaris. A conceptual model is proposed to link the observed results to currently available knowledge for further understanding the mechanisms of D. vulgaris adaptation to elevated NaCl.
Energy Technology Data Exchange (ETDEWEB)
Pereira, Patricia M.; He, Qiang; Xavier, Antonio V.; Zhou, Jizhong; Pereira, Ines A.C.; Louro, Ricardo O.
2008-03-12
Sulphate-reducing bacteria are anaerobes readily found in oxic-anoxic interfaces. Multiple defence pathways against oxidative conditions were identified in these organisms and proposed to be differentially expressed under different concentrations of oxygen, contributing to their ability to survive oxic conditions. In this study, Desulfovibrio vulgaris Hildenborough cells were exposed to the highest concentration of oxygen that sulphate-reducing bacteria are likely to encounter in natural habitats, and the global transcriptomic response was determined. 307 genes were responsive, with cellular roles in energy metabolism, protein fate, cell envelope and regulatory functions, including multiple genes encoding heat shock proteins, peptidases and proteins with heat shock promoters. Of the oxygen reducing mechanisms of D. vulgaris only the periplasmic hydrogen-dependent mechanism is up-regulated, involving the [NiFeSe]hydrogenase, formate dehydrogenase(s) and the Hmc membrane complex. The oxidative defence response concentrates on damage repair by metal-free enzymes. These data, together with the down regulation of the Fur operon, which restricts the availability of iron, and the lack of response of the PerR operon, suggest that a major effect of this oxygen stress is the inactivation and/or degradation of multiple metalloproteins present in D. vulgaris as a consequence of oxidative damage to their metal clusters.
Energy Technology Data Exchange (ETDEWEB)
Gaucher, S.P.; Redding, A.M.; Mukhopadhyay, A.; Keasling, J.D.; Singh, A.K.
2008-03-01
Recent developments in shotgun proteomics have enabled high-throughput studies of a variety of microorganisms at a proteome level and provide experimental validation for predicted open reading frames in the corresponding genome. More importantly, advances in mass spectrometric data analysis now allow mining of large proteomics data sets for the presence of post-translational modifications(PTMs). Although PTMs are a critical aspectof cellular activity, such information eludes cell-wide studies conducted at the transcript level. Here, we analyze several mass spectrometric data sets acquired using two-dimensional liquid chromatography tandem mass spectrometry, 2D-LC/MS/MS, for the sulfate reducing bacterium, Desulfovibrio vulgaris Hildenborough. Our searches of the raw spectra led us to discover several post-translationally modified peptides in D. vulgaris. Of these, several peptides containing a lysine with a +42 Da modification were found reproducibly across all data sets. Both acetylation and trimethylation have the same nominal +42 Da mass, and are therefore candidates for this modification. Several spectra were identified having markers for trimethylation, while one is consistent with an acetylation. Surprisingly, these modified peptides predominantly mapped to proteins involved in sulfate respiration. Other highly expressed proteins in D. vulgaris, such as enzymes involved in electron transport and other central metabolic processes, did not contain this modification. Decoy database searches were used to control for random spectrum/sequence matches. Additional validation for these modifications was provided by alternate workflows, for example, two-dimensional gel electrophoresis followed by mass spectrometry analysis of the dissimilatory sulfite reductase gamma-subunit(DsrC) protein. MS data for DsrC in this alternate workflow also contained the +42 Da modification at the same loci. Furthermore, the DsrC homologue in another sulfate reducing bacterium
Identification and Characterization of the Major Porin of Desulfovibrio vulgaris Hildenborough.
Zeng, L; Wooton, E; Stahl, D A; Walian, P J
2017-09-05
Due in large part to their ability to facilitate the diffusion of a diverse range of solutes across the outer membrane (OM) of Gram-negative bacteria, the porins represent one of the most prominent and important bacterial membrane protein superfamilies. Notably, for the Gram-negative bacterium Desulfovibrio vulgaris Hildenborough (DvH), a model organism for studies of sulfate-reducing bacteria, no porins have been identified or proposed in its annotated genome. Results from initial biochemical studies suggested that the product of gene DVU0799, one of the most abundant proteins of the DvH OM and purified as a homotrimeric complex, was a strong porin candidate. To investigate this possibility, this protein was further characterized biochemically and biophysically. Structural analyses via electron microscopy of negatively-stained protein identified trimeric particles with stain-filled depressions, and structural modeling suggested a β-barrel structure for the monomer, motifs common among the known porins. Functional studies were performed in which crude OM preparations or purified DVU0799 were reconstituted into proteoliposomes and examined for permeability against a series of test solutes. Results obtained establish DVU0799 as a pore forming protein with permeability properties similar to those observed for classical bacterial porins such as those of E. coli Taken together, these findings identify this highly abundant OM protein as the major porin of DvH. Classification of DVU0799 in this model organism expands the database of functionally characterized porins and may also extend the range over which sequence analysis strategies can be used to identify porins in other bacterial genomes.Importance Porins are membrane proteins that form transmembrane pores for the passive transport of small molecules across the outer membranes of Gram-negative bacteria. The present study has identified and characterized the major porin of the model sulfate-reducing bacterium
Morelli, X; Dolla, A; Toci, R; Guerlesquin, F
1999-04-01
When using heteronuclear NMR, 15N-labelling is necessary for structural analysis, dynamic studies and determination of complex formation. The problems that arise with isotopic labelling of metalloproteins are due to their complex maturation process, which involves a large number of factors. Cytochromes c are poorly expressed in Escherichia coli and the overexpression that is necessary for 15N-labelling, requires an investigation of the expression host and special attention to growth conditions. We have succeeded in the heterologous expression and the complete and uniform isotopic 15N-labelling of the cytochrome c553 from Desulfovibrio vulgaris Hildenborough, in a sulphate-reducing bacterium, D. desulfuricans G200, by using a growth medium combining 15N-ammonium chloride and 15N-Celtone. These conditions allowed us to obtain approximately 0.8 mg x L-1 of pure labelled cytochrome c553. 1H and 15N-assignments for both the oxidized and the reduced states of cytochrome c553 were obtained from two-dimensional heteronuclear experiments. Pseudocontact effects due to the haem Fe3+ have been analysed for the first time through 15N and 1H chemical shifts in a c-type cytochrome.
Energy Technology Data Exchange (ETDEWEB)
Chhabra, S.R.; Butland, G.; Elias, D.; Chandonia, J.-M.; Fok, V.; Juba, T.; Gorur, A.; Allen, S.; Leung, C.-M.; Keller, K.; Reveco, S.; Zane, G.; Semkiw, E.; Prathapam, R.; Gold, B.; Singer, M.; Ouellet, M.; Sazakal, E.; Jorgens, D.; Price, M.; Witkowska, E.; Beller, H.; Hazen, T.C.; Biggin, M.; Auer, M.; Wall, J.; Keasling, J.
2011-07-15
The ability to conduct advanced functional genomic studies of the thousands of sequenced bacteria has been hampered by the lack of available tools for making high- throughput chromosomal manipulations in a systematic manner that can be applied across diverse species. In this work, we highlight the use of synthetic biological tools to assemble custom suicide vectors with reusable and interchangeable DNA “parts” to facilitate chromosomal modification at designated loci. These constructs enable an array of downstream applications including gene replacement and creation of gene fusions with affinity purification or localization tags. We employed this approach to engineer chromosomal modifications in a bacterium that has previously proven difficult to manipulate genetically, Desulfovibrio vulgaris Hildenborough, to generate a library of over 700 strains. Furthermore, we demonstrate how these modifications can be used for examining metabolic pathways, protein-protein interactions, and protein localization. The ubiquity of suicide constructs in gene replacement throughout biology suggests that this approach can be applied to engineer a broad range of species for a diverse array of systems biological applications and is amenable to high-throughput implementation.
Study of Nitrate Stress in Desulfovibrio vulgaris Hildenborough Using iTRAQ Proteomics
Energy Technology Data Exchange (ETDEWEB)
Redding, A.M.; Mukhopadhyay, A.; Joyner, D.; Hazen, T.C.; Keasling, J.D.
2006-10-12
The response of Desulfovibrio vulgaris Hildenborough (DvH),a sulphate-reducing bacterium, to nitrate stress was examined usingquantitative proteomic analysis. DvH was stressed with 105 m M sodiumnitrate(NaNO3), a level that caused a 50 percent inhibition in growth.The protein profile of stressed cells was compared with that of cellsgrown in the absence of nitrate using the iTRAQ peptide labellingstrategy and tandem liquid chromatography separation coupled with massspectrometry (quadrupoletime-of-flight) detection. A total of 737 uniqueproteins were identified by two or more peptides, representing 22 percentof the total DvH proteome and spanning every functional category. Theresults indicate that this was a mild stress, as proteins involved incentral metabolism and the sulphate reduction pathway were unperturbed.Proteins involved in the nitrate reduction pathway increased. Increasesseen in transport systems for proline, glycine^ betaineandglutamateindicate that the NaNO3 exposure led to both salt stress and nitratestress.Up-regulation observed in oxidative stress response proteins (Rbr,RbO, etc.) and a large number of ABC transport systems as well as in iron^ sulphur -cluster-containing proteins, however, appear to be specific tonitrate exposure. Finally, a number of hypothetical proteins were amongthe most significant changers, indicating that there may be unknownmechanisms initiated upon nitrate stress in DvH.
Energy Technology Data Exchange (ETDEWEB)
He, Qiang; Huang, Katherine H.; He, Zhili; Alm, Eric J.; Fields,Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Wall, Judy D.; Zhou, Jizhong
2005-11-03
Many of the proteins that are candidates for bioenergetic pathways involved with sulfate respiration in Desulfovibrio spp. have been studied, but complete pathways and overall cell physiology remain to be resolved for many environmentally relevant conditions. In order to understand the metabolism of these microorganisms under adverse environmental conditions for improved bioremediation efforts, Desulfovibrio vulgaris Hildenborough was used as a model organism to study stress response to nitrite, an important intermediate in the nitrogen cycle. Previous physiological studies demonstrated that growth was inhibited by nitrite and that nitrite reduction was observed to be the primary mechanism of detoxification. Global transcriptional profiling with whole-genome microarrays revealed coordinated cascades of responses to nitrite in pathways of energy metabolism, nitrogen metabolism, oxidative stress response, and iron homeostasis. In agreement with previous observations, nitrite-stressed cells showed a decrease in the expression of genes encoding sulfate reduction functions in addition to respiratory oxidative phosphorylation and ATP synthase activity. Consequently, the stressed cells had decreased expression of the genes encoding ATP-dependent amino acid transporters and proteins involved in translation. Other genes up-regulated in response to nitrite include the genes in the Fur regulon, which is suggested to be involved in iron homeostasis, and genes in the Per regulon, which is predicted to be responsible for oxidative stress response.
Directory of Open Access Journals (Sweden)
Anouchka eFievet
2015-12-01
Full Text Available Recent years have seen significant progress in understanding basic bacterial cell cycle properties such as cell growth and cell division. While characterization and regulation of bacterial cell cycle is quite well documented in the case of fast growing aerobic model organisms, no data has been so far reported for anaerobic bacteria. This lack of information in anaerobic microorganisms can mainly be explained by the absence of molecular and cellular tools such as single cell microscopy and fluorescent probes usable for anaerobes and essential to study cellular events and/or subcellular localization of the actors involved in cell cycle.In this study, single-cell microscopy has been adapted to study for the first time, in real time, the cell cycle of a bacterial anaerobe, Desulfovibrio vulgaris Hildenborough (DvH. This single-cell analysis provides mechanistic insights into the cell division cycle of DvH, which seems to be governed by the recently discussed so-called incremental model that generates remarkably homogeneous cell sizes. Furthermore, cell division was reversibly blocked during oxygen exposure. This may constitute a strategy for anaerobic cells to cope with transient exposure to oxygen that they may encounter in their natural environment, thereby contributing to their aerotolerance. This study lays the foundation for the first molecular, single-cell assay that will address factors that cannot otherwise be resolved in bulk assays and that will allow visualization of a wide range of molecular mechanisms within living anaerobic cells.
Genetic Adaptation to Salt Stress in Experimental Evolution of Desulfovibrio vulgaris Hildenborough
Energy Technology Data Exchange (ETDEWEB)
Zhou, Aifen; Hillesland, Kristina; He, Zhili; Joachimiak, Marcin; Zane, Grant; Dehal, Paramvir; Arkin, Adam; Stahl, David; Wall, Judy; Hazen, Terry; Zhou, Jizhong; Baidoo, Edward; Benke, Peter; Mukhopadhyay, Aindrila
2010-05-17
High salinity is one of the most common environmental stressors. In order to understand how environmental organisms adapt to salty environment, an experiment evolution with sulfate reducing bacteria Desulfovibrio vugaris Hildenborough was conducted. Control lines and salt-stressed lines (6 lines each) grown in minimal medium LS4D or LS4D + 100 mM NaCl were transferred for 1200 generations. The salt tolerance was tested with LS4D supplemented with 250 mM NaCl. Statistical analysis of the growth data suggested that all lines adapted to their evolutionary environment. In addition, the control lines performed better than the ancestor with faster growth rate, higher biomass yield and shorter lag phase under salty environment they did not evolve in. However, the salt-adapted lines performed better than the control lines on measures of growth rate and yield under salty environment, suggesting that the salt?evolved lines acquired mutations specific to having extra salt in LS4D. Growth data and gene transcription data suggested that populations tended to improve till 1000 generations and active mutations tended to be fixed at the stage of 1000 generations. Point mutations and insertion/deletions were identified in isolated colonies from salt-adapted and control lines via whole genome sequencing. Glu, Gln and Ala appears to be the major osmoprotectant in evolved salt-stressed line. Ongoing studies are now characterizing the contribution of specific mutations identified in the salt-evolved D. vulgaris.
Hydrogen-peroxide-induced oxidative stress responses in Desulfovibrio vulgaris Hildenborough
Energy Technology Data Exchange (ETDEWEB)
Zhou, A.; He, Z.; Redding-Johanson, A.M.; Mukhopadhyay, A.; Hemme, C.L.; Joachimiak, M.P.; Bender, K.S.; Keasling, J.D.; Stahl, D.A.; Fields, M.W.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Zhou, J.; Luo, F.; Deng, Y.; He, Q.
2010-07-01
To understand how sulphate-reducing bacteria respond to oxidative stresses, the responses of Desulfovibrio vulgaris Hildenborough to H{sub 2}O{sub 2}-induced stresses were investigated with transcriptomic, proteomic and genetic approaches. H{sub 2}O{sub 2} and induced chemical species (e.g. polysulfide, ROS) and redox potential shift increased the expressions of the genes involved in detoxification, thioredoxin-dependent reduction system, protein and DNA repair, and decreased those involved in sulfate reduction, lactate oxidation and protein synthesis. A gene coexpression network analysis revealed complicated network interactions among differentially expressed genes, and suggested possible importance of several hypothetical genes in H{sub 2}O{sub 2} stress. Also, most of the genes in PerR and Fur regulons were highly induced, and the abundance of a Fur regulon protein increased. Mutant analysis suggested that PerR and Fur are functionally overlapped in response to stresses induced by H{sub 2}O{sub 2} and reaction products, and the upregulation of thioredoxin-dependent reduction genes was independent of PerR or Fur. It appears that induction of those stress response genes could contribute to the increased resistance of deletion mutants to H{sub 2}O{sub 2}-induced stresses. In addition, a conceptual cellular model of D. vulgaris responses to H{sub 2}O{sub 2} stress was constructed to illustrate that this bacterium may employ a complicated molecular mechanism to defend against the H{sub 2}O{sub 2}-induced stresses.
Energy Technology Data Exchange (ETDEWEB)
Zhou, Aifen; He, Zhili; Redding, A.M.; Mukhopadhyay, Aindrila; Hemme, Christopher L.; Joachimiak, Marcin P.; Bender, Kelly S.; Keasling, Jay D.; Stahl, David A.; Fields, Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Wall, Judy D.; Zhou, Jizhong
2009-01-01
Response of Desulfovibrio vulgaris Hildenborough to hydrogen peroxide (H2O2, 1 mM) was investigated with transcriptomic, proteomic and genetic approaches. Microarray data demonstrated that gene expression was extensively affected by H2O2 with the response peaking at 120 min after H2O2 treatment. Genes affected include those involved with energy production, sulfate reduction, ribosomal structure and translation, H2O2 scavenging, posttranslational modification and DNA repair as evidenced by gene coexpression networks generated via a random matrix-theory based approach. Data from this study support the hypothesis that both PerR and Fur play important roles in H2O2-induced oxidative stress response. First, both PerR and Fur regulon genes were significantly up-regulated. Second, predicted PerR regulon genes ahpC and rbr2 were derepressedin Delta PerR and Delta Fur mutants and induction of neither gene was observed in both Delta PerR and Delta Fur when challenged with peroxide, suggesting possible overlap of these regulons. Third, both Delta PerR and Delta Fur appeared to be more tolerant of H2O2 as measured by optical density. Forth, proteomics data suggested de-repression of Fur during the oxidative stress response. In terms of the intracellular enzymatic H2O2 scavenging, gene expression data suggested that Rdl and Rbr2 may play major roles in the detoxification of H2O2. In addition, induction of thioredoxin reductase and thioredoxin appeared to be independent of PerR and Fur. Considering all data together, D. vulgaris employed a distinctive stress resistance mechanism to defend against increased cellular H2O2, and the temporal gene expression changes were consistent with the slowdown of cell growth at the onset of oxidative stress.
De León, Kara B; Zane, Grant M; Trotter, Valentine V; Krantz, Gregory P; Arkin, Adam P; Butland, Gareth P; Walian, Peter J; Fields, Matthew W; Wall, Judy D
2017-10-17
Biofilms of sulfate-reducing bacteria (SRB) are of particular interest as members of this group are culprits in corrosion of industrial metal and concrete pipelines as well as being key players in subsurface metal cycling. Yet the mechanism of biofilm formation by these bacteria has not been determined. Here we show that two supposedly identical wild-type cultures of the SRB Desulfovibrio vulgaris Hildenborough maintained in different laboratories have diverged in biofilm formation. From genome resequencing and subsequent mutant analyses, we discovered that a single nucleotide change within DVU1017, the ABC transporter of a type I secretion system (T1SS), was sufficient to eliminate biofilm formation in D. vulgaris Hildenborough. Two T1SS cargo proteins were identified as likely biofilm structural proteins, and the presence of at least one (with either being sufficient) was shown to be required for biofilm formation. Antibodies specific to these biofilm structural proteins confirmed that DVU1017, and thus the T1SS, is essential for localization of these adhesion proteins on the cell surface. We propose that DVU1017 is a member of the lapB category of microbial surface proteins because of its phenotypic similarity to the adhesin export system described for biofilm formation in the environmental pseudomonads. These findings have led to the identification of two functions required for biofilm formation in D. vulgaris Hildenborough and focus attention on the importance of monitoring laboratory-driven evolution, as phenotypes as fundamental as biofilm formation can be altered. IMPORTANCE The growth of bacteria attached to a surface (i.e., biofilm), specifically biofilms of sulfate-reducing bacteria, has a profound impact on the economy of developed nations due to steel and concrete corrosion in industrial pipelines and processing facilities. Furthermore, the presence of sulfate-reducing bacteria in oil wells causes oil souring from sulfide production, resulting in
Energy Technology Data Exchange (ETDEWEB)
Borglin, Sharon E; Joyner, Dominique; Jacobsen, Janet; Mukhopadhyay, Aindrila; Hazen, Terry C.
2008-10-04
Growing anaerobic microorganisms in phenotypic microarrays (PM) and 96-well microtiter plates is an emerging technology that allows high throughput survey of the growth and physiology and/or phenotype of cultivable microorganisms. For non-model bacteria, a method for phenotypic analysis is invaluable, not only to serve as a starting point for further evaluation, but also to provide a broad understanding of the physiology of an uncharacterized wild-type organism or the physiology/phenotype of a newly created mutant of that organism. Given recent advances in genetic characterization and targeted mutations to elucidate genetic networks and metabolic pathways, high-throughput methods for determining phenotypic differences are essential. Here we outline challenges presented in studying the physiology and phenotype of a sulfate reducing anaerobic delta proteobacterium, Desulfovibrio vulgaris Hildenborough. Modifications of the commercially available OmniLog(TM) system (Hayward, CA) for experimental setup, and configuration, as well as considerations in PM data analysis are presented. Also highlighted here is data viewing software that enables users to view and compare multiple PM data sets. The PM method promises to be a valuable strategy in our systems biology approach to D. vulgaris studies and is readily applicable to other anaerobic and aerobic bacteria.
Energy Technology Data Exchange (ETDEWEB)
Chhabra, S.R.; Joachimiak, M.P.; Petzold, C.J.; Zane, G.M.; Price, M.N.; Gaucher, S.; Reveco, S.A.; Fok, V.; Johanson, A.R.; Batth, T.S.; Singer, M.; Chandonia, J.M.; Joyner, D.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Singh, A.K.; Keasling, J.D.
2011-05-01
Protein–protein interactions offer an insight into cellular processes beyond what may be obtained by the quantitative functional genomics tools of proteomics and transcriptomics. The aforementioned tools have been extensively applied to study E. coli and other aerobes and more recently to study the stress response behavior of Desulfovibrio 5 vulgaris Hildenborough, a model anaerobe and sulfate reducer. In this paper we present the first attempt to identify protein-protein interactions in an obligate anaerobic bacterium. We used suicide vector-assisted chromosomal modification of 12 open reading frames encoded by this sulfate reducer to append an eight amino acid affinity tag to the carboxy-terminus of the chosen proteins. Three biological replicates of the 10 ‘pulled-down’ proteins were separated and analyzed using liquid chromatography-mass spectrometry. Replicate agreement ranged between 35% and 69%. An interaction network among 12 bait and 90 prey proteins was reconstructed based on 134 bait-prey interactions computationally identified to be of high confidence. We discuss the biological significance of several unique metabolic features of D. vulgaris revealed by this protein-protein interaction data 15 and protein modifications that were observed. These include the distinct role of the putative carbon monoxide-induced hydrogenase, unique electron transfer routes associated with different oxidoreductases, and the possible role of methylation in regulating sulfate reduction.
Analysis of a Ferric Uptake Regulator (Fur) Mutant ofDesulfovibrio vulgaris Hildenborough
Energy Technology Data Exchange (ETDEWEB)
Bender, Kelly S.; Yen, Huei-Che Bill; Hemme, Christopher L.; Yang, Zamin K.; He, Zhili; He, Qiang; Zhou, Jizhong; Huang, Katherine H.; Alm, Eric J.; Hazen, Terry C.; Arkin, Adam P.; Wall, Judy D.
2007-09-21
Previous experiments examining the transcriptional profileof the anaerobe Desulfovibrio vulgaris demonstrated up-regulation of theFur regulon in response to various environmental stressors. To test theinvolvement of Fur in the growth response and transcriptional regulationof D. vulgaris, a targeted mutagenesis procedure was used for deletingthe fur gene. Growth of the resulting ?fur mutant (JW707) was notaffected by iron availability, but the mutant did exhibit increasedsensitivity to nitrite and osmotic stresses compared to the wild type.Transcriptional profiling of JW707 indicated that iron-bound Fur acts asa traditional repressor for ferrous iron uptake genes (feoAB) and othergenes containing a predicted Fur binding site within their promoter.Despite the apparent lack of siderophore biosynthesis genes within the D.vulgaris genome, a large 12-gene operon encoding orthologs to TonB andTolQR also appeared to be repressed by iron-bound Fur. While other genespredicted to be involved in iron homeostasis were unaffected by thepresence or absence of Fur, alternative expression patterns that could beinterpreted as repression or activation by iron-free Fur were observed.Both the physiological and transcriptional data implicate a globalregulatory role for Fur in the sulfate-reducing bacterium D.vulgaris.
Energy Technology Data Exchange (ETDEWEB)
Men, Y.; Feil, H.; VerBerkmoes, N.C.; Shah, M.B.; Johnson, D.R.; Lee, P.K.H; West, K.A.; Zinder, S.H.; Andersen, G.L.; Alvarez-Cohen, L.
2011-03-01
Dehalococcoides ethenogenes strain 195 (DE195) was grown in a sustainable syntrophic association with Desulfovibrio vulgaris Hildenborough (DVH) as a co-culture, as well as with DVH and the hydrogenotrophic methanogen Methanobacterium congolense (MC) as a tri-culture using lactate as the sole energy and carbon source. In the co- and tri-cultures, maximum dechlorination rates of DE195 were enhanced by approximately three times (11.0±0.01 lmol per day for the co-culture and 10.1±0.3 lmol per day for the tri-culture) compared with DE195 grown alone (3.8±0.1 lmol per day). Cell yield of DE195 was enhanced in the co-culture (9.0±0.5 x 107 cells per lmol Cl{sup -} released, compared with 6.8±0.9x 107 cells per lmol Cl{sup -} released for the pure culture), whereas no further enhancement was observed in the tri-culture (7.3±1.8x 107 cells per lmol Cl{sup -} released). The transcriptome of DE195 grown in the co-culture was analyzed using a whole-genome microarray targeting DE195, which detected 102 significantly up- or down-regulated genes compared with DE195 grown in isolation, whereas no significant transcriptomic difference was observed between co- and tri-cultures. Proteomic analysis showed that 120 proteins were differentially expressed in the co-culture compared with DE195 grown in isolation. Physiological, transcriptomic and proteomic results indicate that the robust growth of DE195 in co- and tri-cultures is because of the advantages associated with the capabilities of DVH to ferment lactate to provide H2 and acetate for growth, along with potential benefits from proton translocation, cobalamin-salvaging and amino acid biosynthesis, whereas MC in the tri-culture provided no significant additional benefits beyond those of DVH.
Energy Technology Data Exchange (ETDEWEB)
Tang, Yinjie; Pingitore, Francesco; Mukhopadhyay, Aindrila; Phan,Richard; Hazen, Terry C.; Keasling, Jay D.
2007-03-15
Flux distribution in central metabolic pathways ofDesulfovibrio vulgaris Hildenborough was examined using 13C tracerexperiments. Consistent with the current genome annotation andindependent evidence from enzyme activity assays, the isotopomer resultsfrom both GC-MS and Fourier Transform-Ion Cyclotron Resonance massspectrometry (FT-ICR MS) indicate the lack of oxidatively functional TCAcycle and an incomplete pentose phosphate pathway. Results from thisstudy suggest that fluxes through both pathways are limited tobiosynthesis. The data also indicate that>80 percent of the lactatewas converted to acetate and the reactions involved are the primary routeof energy production (NAD(P)H and ATP production). Independent of the TCAcycle, direct cleavage of acetyl-CoA to CO and 5,10-methyl-THF also leadsto production of NADH and ATP. Although the genome annotation implicatesa ferredoxin-dependentoxoglutarate synthase, isotopic evidence does notsupport flux through this reaction in either the oxidative or reductivemode; therefore, the TCA cycle is incomplete. FT-ICR MS was used tolocate the labeled carbon distribution in aspartate and glutamate andconfirmed the presence of an atypical enzyme for citrate formationsuggested in previous reports (the citrate synthesized by this enzyme isthe isotopic antipode of the citrate synthesized by the (S)-citratesynthase). These findings enable a better understanding of the relationbetween genome annotation and actual metabolic pathways in D. vulgaris,and also demonstrate FT-ICR MS as a powerful tool for isotopomeranalysis, overcoming problems in both GC-MS and NMRspectroscopy.
Energy Technology Data Exchange (ETDEWEB)
Keller, Kimberly L.; Bender, Kelly S.; Wall, Judy D.
2009-07-21
In recent years, the genetic manipulation of the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough has seen enormous progress. In spite of this progress, the current marker exchange deletion method does not allow for easy selection of multiple sequential gene deletions in a single strain because of the limited number of selectable markers available in D. vulgaris. To broaden the repertoire of genetic tools for manipulation, an in-frame, markerless deletion system has been developed. The counterselectable marker that makes this deletion system possible is the pyrimidine salvage enzyme, uracil phosphoribosyltransferase, encoded by upp. In wild-type D. vulgaris, growth was shown to be inhibited by the toxic pyrimidine analog 5-fluorouracil (5-FU); whereas, a mutant bearing a deletion of the upp gene was resistant to 5-FU. When a plasmid containing the wild-type upp gene expressed constitutively from the aph(3')-II promoter (promoter for the kanamycin resistance gene in Tn5) was introduced into the upp deletion strain, sensitivity to 5-FU was restored. This observation allowed us to develop a two-step integration and excision strategy for the deletion of genes of interest. Since this inframe deletion strategy does not retain an antibiotic cassette, multiple deletions can be generated in a single strain without the accumulation of genes conferring antibiotic resistances. We used this strategy to generate a deletion strain lacking the endonuclease (hsdR, DVU1703) of a type I restriction-modification system, that we designated JW7035. The transformation efficiency of the JW7035 strain was found to be 100 to 1000 times greater than that of the wild-type strain when stable plasmids were introduced via electroporation.
Energy Technology Data Exchange (ETDEWEB)
Zane, Grant M.; Yen, Huei-chi Bill; Wall, Judy D.
2010-03-18
The pathway of electrons required for the reduction of sulfate in sulfate-reducing bacteria (SRB) is not yet fully characterized. In order to determine the role of a transmembrane protein complex suggested to be involved in this process, a deletion of Desulfovibrio vulgaris Hildenborough was created by marker exchange mutagenesis that eliminated four genes putatively encoding the QmoABC complex and a hypothetical protein (DVU0851). The Qmo complex (quinone-interacting membrane-bound oxidoreductase) is proposed to be responsible for transporting electrons to the dissimilatory adenosine-5?phosphosulfate (APS) reductase in SRB. In support of the predicted role of this complex, the deletion mutant was unable to grow using sulfate as its sole electron acceptor with a range of electron donors. To explore a possible role for the hypothetical protein in sulfate reduction, a second mutant was constructed that had lost only the gene that codes for DVU0851. The second constructed mutant grew with sulfate as the sole electron acceptor; however, there was a lag that was not present with the wild-type or complemented strain. Neither deletion strain was significantly impaired for growth with sulfite or thiosulfate as terminal electron acceptor. Complementation of the D(qmoABC-DVU0851) mutant with all four genes or only the qmoABC genes restored its ability to grow by sulfate respiration. These results confirmed the prediction that the Qmo complex is in the electron pathway for sulfate-reduction and revealed that no other transmembrane complex could compensate when Qmo was lacking.
Directory of Open Access Journals (Sweden)
Mukaddes Kavala
2012-01-01
Full Text Available Background. Thyroid disorders may affect all of the organ systems of the body and they are also highly associated with a wide variety of skin disorders. The aim of this study was to investigate the prevalence of thyroid function abnormalities and thyroid autoimmunity in patients with pemphigus vulgaris (PV and to determine the association between thyroid disorders and clinical involvement and systemic corticosteroid treatment in patients with PV. Methods. The study consisted of eighty patients with PV and eighty healthy individuals. Thyroid functions (fT3, fT4, and TSH and thyroid autoimmunity (anti-thyroid peroxidase (anti-TPO, and anti-thyroglobulin (anti-Tg antibodies were investigated in both groups. Primary thyroid disease (PTD was diagnosed with one or more of the following diagnostic criteria: (i positive antithyroid antibodies, (ii primary thyroid function abnormalities. Results. Significant changes in the serum thyroid profile were found in 16% (13/80 of the PV group and 5% (4/80 of the control group. Positive titers of antithyroid antibodies (anti-TPO and anti-Tg were observed in 7 patients (9% with PV and one in the control group (1,2%. Hashimoto thyroiditis was diagnosed in 9% of PV patients and it was found to be more prevalent in the mucosal form of PV. PTD was found in 13 of (%16 PV patients which was significantly high compared to controls. PTD was not found to be associated with systemic corticosteroid use. Free T3 levels were significantly lower in PV group compared to the control group and free T4 levels were significantly higher in PV group compared to the controls. Conclusions. PV may exist together with autoimmune thyroid diseases especially Hashimoto thyroiditis and primer thyroid diseases. Laboratory work-up for thyroid function tests and thyroid autoantibodies should be performed to determine underlying thyroid diseases in patients with PV.
Cell wide responses to low oxygen exposure in Desulfovibriovulgaris Hildenborough
Energy Technology Data Exchange (ETDEWEB)
Mukhopadhyay, A.; Redding, A.; Joachimiak, M.; Arkin, A.; Borglin, S.; Dehal, P.; Chakraborty, R.; Geller, J.; Hazen, T.; He, Q.; Joyner, D.; Martin, V.; Wall, J.; Yang, Z.; Zhou, J.; Keasling, J.
2007-03-11
The responses of the anaerobic, sulfate-reducing Desulfovibrio vulgaris Hildenborough to low oxygen exposure (0.1% O{sub 2}) were monitored via transcriptomics and proteomics. Exposure to 0.1% O{sub 2} caused a decrease in growth rate without affecting viability. A concerted up regulation in the predicted peroxide stress response regulon (PerR) genes was observed in response to the 0.1% O{sub 2} exposure. Several of these candidates also showed increases in protein abundance. Among the remaining small number of transcript changes was the up regulation of the predicted transmembrane tetraheme cytochrome c3 complex. Other known oxidative stress response candidates remained unchanged during this low O{sub 2} exposure. To fully understand the results of the 0.1% O{sub 2} exposure, transcriptomics and proteomics data were collected for exposure to air using a similar experimental protocol. In contrast to the 0.1% O{sub 2} exposure, air exposure was detrimental to both the growth rate and viability and caused dramatic changes at both the transcriptome and proteome levels. Interestingly, the transcripts of the predicted PerR regulon genes were down regulated during air exposure. Our results highlight the differences in the cell wide response to low and high O{sub 2} levels of in D. vulgaris and suggest that while exposure to air is highly detrimental to D. vulgaris, this bacterium can successfully cope with periodic exposure to low O{sub 2} levels in its environment.
Response of Desulfovibrio vulgaris to Alkaline Stress
Energy Technology Data Exchange (ETDEWEB)
Stolyar, S.; He, Q.; He, Z.; Yang, Z.; Borglin, S.E.; Joyner, D.; Huang, K.; Alm, E.; Hazen, T.C.; Zhou, J.; Wall, J.D.; Arkin, A.P.; Stahl, D.A.
2007-11-30
The response of exponentially growing Desulfovibrio vulgarisHildenborough to pH 10 stress was studied using oligonucleotidemicroarrays and a study set of mutants with genes suggested by microarraydata to be involved in the alkaline stress response deleted. The datashowed that the response of D. vulgaris to increased pH is generallysimilar to that of Escherichia coli but is apparently controlled byunique regulatory circuits since the alternative sigma factors (sigma Sand sigma E) contributing to this stress response in E. coli appear to beabsent in D. vulgaris. Genes previously reported to be up-regulated in E.coli were up-regulated in D. vulgaris; these genes included three ATPasegenes and a tryptophan synthase gene. Transcription of chaperone andprotease genes (encoding ATP-dependent Clp and La proteases and DnaK) wasalso elevated in D. vulgaris. As in E. coli, genes involved in flagellumsynthesis were down-regulated. The transcriptional data also identifiedregulators, distinct from sigma S and sigma E, that are likely part of aD. vulgaris Hildenborough-specific stress response system.Characterization of a study set of mutants with genes implicated inalkaline stress response deleted confirmed that there was protectiveinvolvement of the sodium/proton antiporter NhaC-2, tryptophanase A, andtwo putative regulators/histidine kinases (DVU0331 andDVU2580).
Lee, Kyoung Ho; Park, Su Jung; Choi, Sun Ju; Park, Joo Young
2017-11-01
Candida albicans (C. albicans) and Proteus species are causative agents in a variety of opportunistic nosocomial infections, and their ability to form biofilms is known to be a virulence factor. In this study, the influence of co-cultivation with Proteus vulgaris (P. vulgaris) and Proteus mirabilis (P. mirabilis) on C. albicans biofilm formation and its underlying mechanisms were examined. XTT reduction assays were adopted to measure biofilm formation, and viable colony counts were performed to quantify yeast growth. Real-time reverse transcriptase polymerase chain reaction was used to evaluate the expression of yeast-specific genes (rhd1 and rbe1), filament formation inhibiting genes (tup1 and nrg1), and hyphae-related genes (als3, ece1, hwp1, and sap5). Candida biofilm formation was markedly inhibited by treatment with either living or heat-killed P. vulgaris and P. mirabilis. Proteus-cultured supernatant also inhibited Candida biofilm formation. Likewise, treatment with live P. vulgaris or P. mirabilis or with Proteus-cultured supernatant decreased expression of hyphae-related C. albicans genes, while the expression of yeast-specific genes and the filament formation inhibiting genes of C. albicans were increased. Heat-killed P. vulgaris and P. mirabilis treatment, however, did not affect the expression of C. albicans morphology-related genes. These results suggest that secretory products from P. vulgaris and P. mirabilis regulate the expression of genes related to morphologic changes in C. albicans such that transition from the yeast form to the hyphal form can be inhibited.
African Journals Online (AJOL)
Heat treated Beetroot have the highest value for ABTS scavenging ability. ... powdered sample was stored in a clean dry plastic container at room ..... Nutritional value and economic feasibility of red beetroot. (Beta vulgaris L. ssp. vulgaris Rote Kugel) from different production systems. African Journal of. Agricultural ...
Zouboulis, C C
2014-08-01
Acne vulgaris is worldwide the most common skin disease. Acne is an inflammatory disorder in whose emergence androgens, PPAR ligands, the IGF-1 signaling pathway, regulating neuropeptides and environmental factors are probably involved. These factors interrupt the natural cycling process in the sebaceous gland follicle and support the transition of microcomedones to comedones and inflammatory lesions. Proinflammatory lipids and cytokines are mediators for the development of acne lesions. Bacterial antigens can potentate the inflammatory phenomena. Acne is predominantly treated with combination therapy. Selecting a treatment regimen depends on the exact classification of acne type and severity. The development of scars is the main criterion for the choice of systemic therapy. Retinoids for mild comedonal acne and the combination of retinoids with antibiotics and/or benzoyl peroxide for mild to moderate papulopustular acne are the drugs of first choice for topical treatment. The use of topical antibiotics is not recommended any more because of the development of resistant bacterial strains. Systemic antibiotics, in combination with topical retinoids and/or benzoyl peroxide, for moderate papular/nodular acne and isotretinoin for severe nodular/conglobate acne are the columns of systemic acne treatment. Systemic anti-androgens are used in women against moderate papulopustular acne. Due to advances in the understanding of the underlying inflammatory mechanisms in recent years the development of new therapeutic agents with good efficacy and better side effect profile should be expected in the future.
DEFF Research Database (Denmark)
Thyssen, J P; Godoy-Gijon, E; Elias, P M
2013-01-01
Ichthyosis vulgaris is caused by loss-of-function mutations in the filaggrin gene (FLG) and is characterized clinically by xerosis, scaling, keratosis pilaris, palmar and plantar hyperlinearity, and a strong association with atopic disorders. According to the published studies presented in this r......Ichthyosis vulgaris is caused by loss-of-function mutations in the filaggrin gene (FLG) and is characterized clinically by xerosis, scaling, keratosis pilaris, palmar and plantar hyperlinearity, and a strong association with atopic disorders. According to the published studies presented...... or irritants. Moreover, with our current knowledge, individuals with ichthyosis vulgaris should be protected against neonatal exposure to cats to prevent atopic dermatitis and should abstain from smoking to prevent asthma. Finally, they should be advised against excessive exposure to factors that decrease skin...
Directory of Open Access Journals (Sweden)
Ashok Ghorpade
1982-01-01
Full Text Available Acne vulgaris causes much emotional trauma, social embarrassment and cosmetic disfiguration in teenage girls and boys. The multifactorial etiology, pathogenesis and clinical features of this condition are narrated. The mechanism of comedo formation is briefly discussed. Recent concepts in the management of this chronic malady are critically reviewed.
Purdy, Sarah; de Berker, David
2011-01-05
Acne vulgaris affects over 80% of teenagers, and persists beyond the age of 25 years in 3% of men and 12% of women. Typical lesions of acne include comedones, inflammatory papules, and pustules. Nodules and cysts occur in more severe acne and can cause scarring and psychological distress. We conducted a systematic review and aimed to answer the following clinical question: What are the effects of topical and oral treatments in people with acne vulgaris? We searched: Medline, Embase, The Cochrane Library, and other important databases up to February 2010 (Clinical Evidence reviews are updated periodically; please check our website for the most up-to-date version of this review). We included harms alerts from relevant organisations such as the US Food and Drug Administration (FDA) and the UK Medicines and Healthcare products Regulatory Agency (MHRA). We found 69 systematic reviews, RCTs, or observational studies that met our inclusion criteria. We performed a GRADE evaluation of the quality of evidence for interventions. In this systematic review we present information relating to the effectiveness and safety of the following interventions: topical treatments (adapalene, azelaic acid, benzoyl peroxide, clindamycin, erythromycin [alone or plus zinc]; isotretinoin, tetracycline, tretinoin); and oral treatments (doxycycline, isotretinoin, lymecycline, minocycline, oxytetracycline, tetracycline).
The electron transfer system of syntrophically grown Desulfovibrio vulgaris
Energy Technology Data Exchange (ETDEWEB)
Walker, C.B.; He, Z.; Yang, Z.K.; Ringbauer, Jr., J.A.; He, Q.; Zhou, J.; Voordouw, G.; Wall, J.D.; Arkin, A.P.; Hazen, T.C.; Stolyar, S.; Stahl, D.A.
2009-05-01
Interspecies hydrogen transfer between organisms producing and consuming hydrogen promotes the decomposition of organic matter in most anoxic environments. Although syntrophic couplings between hydrogen producers and consumers are a major feature of the carbon cycle, mechanisms for energy recovery at the extremely low free energies of reactions typical of these anaerobic communities have not been established. In this study, comparative transcriptional analysis of a model sulfate-reducing microbe, Desulfovibrio vulgaris Hildenborough, suggested the use of alternative electron transfer systems dependent upon growth modality. During syntrophic growth on lactate with a hydrogenotrophic methanogen, D. vulgaris up-regulated numerous genes involved in electron transfer and energy generation when compared with sulfate-limited monocultures. In particular, genes coding for the putative membrane-bound Coo hydrogenase, two periplasmic hydrogenases (Hyd and Hyn) and the well-characterized high-molecular weight cytochrome (Hmc) were among the most highly expressed and up-regulated. Additionally, a predicted operon coding for genes involved in lactate transport and oxidation exhibited up-regulation, further suggesting an alternative pathway for electrons derived from lactate oxidation during syntrophic growth. Mutations in a subset of genes coding for Coo, Hmc, Hyd and Hyn impaired or severely limited syntrophic growth but had little affect on growth via sulfate-respiration. These results demonstrate that syntrophic growth and sulfate-respiration use largely independent energy generation pathways and imply that understanding of microbial processes sustaining nutrient cycling must consider lifestyles not captured in pure culture.
The Electron Transfer System of Syntrophically Grown Desulfovibrio vulgaris
Energy Technology Data Exchange (ETDEWEB)
PBD; ENIGMA; GTL; VIMSS; Walker, Christopher B.; He, Zhili; Yang, Zamin K.; Ringbauer Jr., Joseph A.; He, Qiang; Zhou, Jizhong; Voordouw, Gerrit; Wall, Judy D.; Arkin, Adam P.; Hazen, Terry C.; Stolyar, Sergey; Stahl, David A.
2009-06-22
Interspecies hydrogen transfer between organisms producing and consuming hydrogen promotes the decomposition of organic matter in most anoxic environments. Although syntrophic couplings between hydrogen producers and consumers are a major feature of the carbon cycle, mechanisms for energy recovery at the extremely low free energies of reactions typical of these anaerobic communities have not been established. In this study, comparative transcriptional analysis of a model sulfate-reducing microbe, Desulfovibrio vulgaris Hildenborough, suggested the use of alternative electron transfer systems dependent upon growth modality. During syntrophic growth on lactate with a hydrogenotrophic methanogen, D. vulgaris up-regulated numerous genes involved in electron transfer and energy generation when compared with sulfate-limited monocultures. In particular, genes coding for the putative membrane-bound Coo hydrogenase, two periplasmic hydrogenases (Hyd and Hyn) and the well-characterized high-molecular weight cytochrome (Hmc) were among the most highly expressed and up-regulated. Additionally, a predicted operon coding for genes involved in lactate transport and oxidation exhibited up-regulation, further suggesting an alternative pathway for electrons derived from lactate oxidation during syntrophic growth. Mutations in a subset of genes coding for Coo, Hmc, Hyd and Hyn impaired or severely limited syntrophic growth but had little affect on growth via sulfate-respiration. These results demonstrate that syntrophic growth and sulfate-respiration use largely independent energy generation pathways and imply that understanding of microbial processes sustaining nutrient cycling must consider lifestyles not captured in pure culture.
Energy Technology Data Exchange (ETDEWEB)
Judy D. Wall
2011-06-09
Our findings demonstrated that D. vulgaris surface-adhered populations produce extracellular structures, and that that the cells have altered carbon and energy flux compared to planktonic cells. Biofilms did not have greatly increased carbohydrate accumulation. Interestingly genes present on the native plasmid found in D. vulgaris Hildenborough were necessary for wild type biofilm formation. In addition, extracellular appendages dependent on functions or proteins encoded by flaG or fliA also contributed to biofilm formation. Studies with SRB biofilms have indicated that the reduction and precipitation of metals can occur within the biofilm matrix; however, little work has been done to elucidate the physiological state of surface-adhered cells during metal reduction (Cr6+, U6+) and how this process is affected by nutrient feed levels (i.e., the stimulant).
Directory of Open Access Journals (Sweden)
Ramachandra S
1995-01-01
Full Text Available A 60 year old female patient presented with disseminated tuberculosis. She had multicentric lupus vulgaris and her joints, bones, lymph nodes and lungs were also affected. Haematogenous dissemination was because of her poor health.
Lupus vulgaris of external nose.
Bhandary, Satheesh Kumar; Ranganna, B Usha
2008-12-01
Lupus vulgaris is the commonest form of cutaneous tuberculosis which commonly involve trunk and buttocks. Lupus vulgaris affecting nose and face, are rarely reported in India. This study reports an unusual case of lupus vulgaris involving the external nose that showed dramatic outcome after six months of anti- tubercular treatment.
Padmavathy, L; Rao, L Lakshmana; Ethirajan, N; Dhanlaklshmi, M
2008-04-01
Tuberculosis is a major public health problem in both developing and developed countries. Cutaneous Tuberculosis constitutes a minor proportion of extra-pulmonary manifestations of Tuberculosis. Lupus Vulgaris (LV) is one of the clinical variants of Cutaneous Tuberculosis. A case of a large plaque type psoriasiform lesion of lupus vulgaris on the thigh, of 15 years' duration, in an 18-year-old girl is reported. This case highlights the ignorance level among the patients and consequent failure to avail proper anti-tuberculous treatment despite campaign in print and audio visual media.
Sim, Min Sub; Wang, David T.; Zane, Grant M.; Wall, Judy D.; Bosak, Tanja; Ono, Shuhei
2013-01-01
The sulfur isotope effect produced by sulfate reducing microbes is commonly used to trace biogeochemical cycles of sulfur and carbon in aquatic and sedimentary environments. To test the contribution of intracellular coupling between carbon and sulfur metabolisms to the overall magnitude of the sulfur isotope effect, this study compared sulfur isotope fractionations by mutants of Desulfovibrio vulgaris Hildenborough. We tested mutant strains lacking one or two periplasmic (Hyd, Hyn-1, Hyn-2, and Hys) or cytoplasmic hydrogenases (Ech and CooL), and a mutant lacking type I tetraheme cytochrome (TpI-c3). In batch culture, wild-type D. vulgaris and its hydrogenase mutants had comparable growth kinetics and produced the same sulfur isotope effects. This is consistent with the reported redundancy of hydrogenases in D. vulgaris. However, the TpI-c3 mutant (ΔcycA) exhibited slower growth and sulfate reduction rates in batch culture, and produced more H2 and an approximately 50% larger sulfur isotope effect, compared to the wild type. The magnitude of sulfur isotope fractionation in the CycA deletion strain, thus, increased due to the disrupted coupling of the carbon oxidation and sulfate reduction pathways. In continuous culture, wild-type D. vulgaris and the CycA mutant produced similar sulfur isotope effects, underscoring the influence of environmental conditions on the relative contribution of hydrogen cycling to the electron transport. The large sulfur isotope effects associated with the non-ideal stoichiometry of sulfate reduction in this study imply that simultaneous fermentation and sulfate reduction may be responsible for some of the large naturally-occurring sulfur isotope effects. Overall, mutant strains provide a powerful tool to test the effect of specific redox proteins and pathways on sulfur isotope fractionation. PMID:23805134
Acne vulgaris: endocriene aspecten
Dekkers, O. M.; Thio, B. H.; Romijn, J. A.; Smit, J. W. A.
2006-01-01
Androgens play an important part in the development of acne vulgaris. Androgen levels in patients with acne are higher than those in controls and people with the androgen insensitivity syndrome do not develop acne. Local factors other than androgen plasma levels, also play a part in the development
African Journals Online (AJOL)
GB
2015-10-04
Oct 4, 2015 ... CONCLUSION: Dental professionals must be sufficiently familiar with the clinical manifestations of pemphigus vulgaris to ensure early ... 3 SDM College of Dental Sciences, Dharwad, India. Corresponding Author: Rai Arpita, ... sign in this case led to provisional diagnosis of vesiculo-bullous lesion affecting ...
Wortsman, Ximena; Claveria, Pedro; Valenzuela, Fernando; Molina, Maria Teresa; Wortsman, Jacobo
2014-01-01
The purpose of this study was to assess the sonographic morphology of the clinical and subclinical pathology of facial acne vulgaris. We studied patients with facial acne vulgaris diagnosed by certified dermatologists, and using a standardized protocol for sonographic examinations, we sequentially described the sonographic pathomorphologic characteristics. Lesions of particular interest to the referring clinician were also analyzed separately. Additionally, acne involvement was staged clinically and sonographically (SOS-Acne) using morphologic definitions of the relevant lesions and predefined scoring systems for gradation of the severity of acne lesions. A total of 245 acne lesions in 20 consecutive patients were studied. Sonographic abnormalities consisted of pseudocysts, folliculitis, fistulas, and calcinosis. Most conditions were subclinical and mostly due to lesion extensions deep into the dermis and hypodermis (52% of pseudocysts and 68% of fistulas). The statistical concordance between acne severity scores assigned by two separate clinicians was strong (κ = 0.8020), but the corresponding sonographic scores generally showed more severe and clinically occult involvement. Facial acne vulgaris often involves deeper tissues, beyond the reach of the spatially restricted clinical examination; these subclinical conditions can be detected and defined with sonography. Additionally, acne vulgaris is amenable to sonographic scoring.
Lupus vulgaris: difficulties in diagnosis.
Rhodes, Julia; Caccetta, Tony Philip; Tait, Clare
2013-05-01
Lupus vulgaris is one of the most common forms of cutaneous tuberculosis. It presents a diagnostic challenge due to its paucibacillary nature. This is a report of a case of a delayed diagnosis of lupus vulgaris, presenting as perianal and peristomal plaques, followed by a review of the diagnostic tools for lupus vulgaris and their limitations. © 2012 The Authors. Australasian Journal of Dermatology © 2012 The Australasian College of Dermatologists.
Mukta, V; Jayachandran, K
2011-04-01
Lupus vulgaris is chronic, postprimary, paucibacillary cutaneous tuberculosis found in individuals with moderate immunity and high degree of tuberculin sensitivity. Eighty percent of the lesions are on the head and neck. We present the case of a 38 year old lady who was admitted with complaints of worsening breathlessness and low grade fever of one month duration. Examination showed multiple, nontender skin ulcers on bilateral lumbar areas, two oozing serosanguinous discharge and others scarred in the centre. Respiratory system examination and chest X-ray revealed right sided pleural effusion. On investigation, pleural fluid was tuberculous in nature. Skin biopsy from the edge of ulcer was also suggestive of tuberculosis. Patient is doing well on antituberculous drugs. This case highlights the importance of cutaneous manifestations of systemic disease and is an example of the unusual presentation of lupus vulgaris in a case of pleural effusion.
Survey of large protein complexes D. vulgaris reveals great structural diversity
Energy Technology Data Exchange (ETDEWEB)
Han, B.-G.; Dong, M.; Liu, H.; Camp, L.; Geller, J.; Singer, M.; Hazen, T. C.; Choi, M.; Witkowska, H. E.; Ball, D. A.; Typke, D.; Downing, K. H.; Shatsky, M.; Brenner, S. E.; Chandonia, J.-M.; Biggin, M. D.; Glaeser, R. M.
2009-08-15
An unbiased survey has been made of the stable, most abundant multi-protein complexes in Desulfovibrio vulgaris Hildenborough (DvH) that are larger than Mr {approx} 400 k. The quaternary structures for 8 of the 16 complexes purified during this work were determined by single-particle reconstruction of negatively stained specimens, a success rate {approx}10 times greater than that of previous 'proteomic' screens. In addition, the subunit compositions and stoichiometries of the remaining complexes were determined by biochemical methods. Our data show that the structures of only two of these large complexes, out of the 13 in this set that have recognizable functions, can be modeled with confidence based on the structures of known homologs. These results indicate that there is significantly greater variability in the way that homologous prokaryotic macromolecular complexes are assembled than has generally been appreciated. As a consequence, we suggest that relying solely on previously determined quaternary structures for homologous proteins may not be sufficient to properly understand their role in another cell of interest.
Energy Technology Data Exchange (ETDEWEB)
Elias, Dwayne A.; Mukhopadhyay, Aindrila; Joachimiak, Marcin P.; Drury, Elliott C.; Redding, Alyssa M.; Yen, Huei-Che B.; Fields, Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Keasling, Jay D.; Wall, Judy D.
2008-10-27
Hypothetical and conserved hypothetical genes account for>30percent of sequenced bacterial genomes. For the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough, 347 of the 3634 genes were annotated as conserved hypothetical (9.5percent) along with 887 hypothetical genes (24.4percent). Given the large fraction of the genome, it is plausible that some of these genes serve critical cellular roles. The study goals were to determine which genes were expressed and provide a more functionally based annotation. To accomplish this, expression profiles of 1234 hypothetical and conserved genes were used from transcriptomic datasets of 11 environmental stresses, complemented with shotgun LC-MS/MS and AMT tag proteomic data. Genes were divided into putatively polycistronic operons and those predicted to be monocistronic, then classified by basal expression levels and grouped according to changes in expression for one or multiple stresses. 1212 of these genes were transcribed with 786 producing detectable proteins. There was no evidence for expression of 17 predicted genes. Except for the latter, monocistronic gene annotation was expanded using the above criteria along with matching Clusters of Orthologous Groups. Polycistronic genes were annotated in the same manner with inferences from their proximity to more confidently annotated genes. Two targeted deletion mutants were used as test cases to determine the relevance of the inferred functional annotations.
Energy Technology Data Exchange (ETDEWEB)
Tang, Yinjie; Pingitore, Francesco; Mukhopadhyay, Aindrila; Phan,Richard; Hazen, Terry C.; Keasling, Jay D.
2006-07-11
It has been proposed that during growth under anaerobic oroxygen-limited conditions Shewanella oneidensis MR-1 uses theserine-isocitrate lyase pathway common to many methylotrophic anaerobes,in which formaldehyde produced from pyruvate is condensed with glycine toform serine. The serine is then transformed through hydroxypyruvate andglycerate to enter central metabolism at phosphoglycerate. To examine itsuse of the serine-isocitrate lyase pathway under anaerobic conditions, wegrew S. oneidensis MR-1 on [1-13C]lactate as the sole carbon source witheither trimethylamine N-oxide (TMAO) or fumarate as an electron acceptor.Analysis of cellular metabolites indicates that a large percentage(>75 percent) of lactate was partially oxidized to either acetate orpyruvate. The 13C isotope distributions in amino acids and other keymetabolites indicate that, under anaerobic conditions, a complete serinepathway is not present, and lactate is oxidized via a highly reversibleserine degradation pathway. The labeling data also suggest significantactivity in the anaplerotic (malic enzyme and phosphoenolpyruvatecarboxylase) and glyoxylate shunt (isocitrate lyase and malate synthase)reactions. Although the tricarboxylic acid (TCA) cycle is often observedto be incomplete in many other anaerobes (absence of 2-oxoglutaratedehydrogenase activity), isotopic labeling supports the existence of acomplete TCA cycle in S. oneidensis MR-1 under TMAO reductioncondition.
Thymus vulgaris subsp. mansanetianus subsp. nov. (Lamiaceae)
Pedro Pablo Ferrer-Gallego; Albert J. Navarro Peris; Emilio Laguna Lumbreras; Gonzalo Mateo Sanz
2013-01-01
RESUMEN: Se describe una nueva subespecie de Thymus vulgaris L. (Lamiaceae); Th. vulgaris subsp. mansanetianus subsp. nov., caracterizada por presentar un hábito postrado, tallos estoloníferos, decumbentes y radicantes, hojas muy estrechas y una floración otoñal. ABSTRACT: Thymus vulgaris subsp. mansanetianus subsp. nov. (Lamiaceae). A new subspecies of Thymus vulgaris L. (Lamiaceae); Th. vulgaris subsp. mansanetianus subsp. nov. is described. This new subspecies is characterized by its prost...
Energy Technology Data Exchange (ETDEWEB)
Elias, Dwayne; Schadt, Christopher; Miller, Lance; Phelps, Tommy; Brown, S. D.; Arkin, Adam; Hazen, Terry; Drake, Megin; Yang, Z.K.; Podar, Mircea
2010-05-17
One of the largest experimental gaps is between the simplicity of pure cultures and the complexity of open environmental systems, particularly in metal-contaminated areas. These microbial communities form ecosystem foundations, drive biogeochemical processes, and are relevant for biotechnology and bioremediation. A model, metal-reducing microbial community was constructed as either syntrophic or competitive to study microbial cell to cell interactions, cell signaling and competition for resources. The microbial community was comprised of the metal-reducing Desulfovibrio vulgaris Hildenborough and Geobacter sulfurreducens PCA. Additionally, Methanococcus maripaludis S2 was added to study complete carbon reduction and maintain a low hydrogen partial pressure for syntrophism to occur. Further, considerable work has been published on D. vulgaris and the D. vulgaris/ Mc. maripaludis co-culture both with and without stress. We are extending this work by conducting the same stress conditions on the model community. Additionally, this comprehensive investigation includes physiological and metabolic analyses as well as specially designed mRNA microarrays with the genes for all three organisms on one slide so as to follow gene expression changes in the various cultivation conditions as well as being comparable to the co- and individual cultures. Further, state-of -the-art comprehensive AMT tag proteomics allows for these comparisons at the protein level for a systems biology assessment of a model, metal-reducing microbial community. Preliminary data revealed that lactate oxidation by D. vulgaris was sufficient to support both G. sulfurreducens and M. maripaludis via the excretion of H2 and acetate. Fumarate was utilized by G. sulfurreducens and reduced to succinate since neither of the other two organisms can reduce fumarate. Methane was quantified, suggesting acetate and H2 concentrations were sufficient for M. maripaludis. Steady state community cultivation will allow for
ORF Alignment: NC_002937 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EVFRGIIEDKFAPIITQKANQLGCDMAGTVIAPDDAPLITRGVHDLLAAGA 434 ... KVGVLVTGTEVFRGIIEDKFAPIITQKANQLGCDMAGTVIA...PDDAPLITRGVHDLLAAGA Sbjct: 1 ... KVGVLVTGTEVFRGIIEDKFAPIITQKANQLGCDMAGTVIAPDDAPLITRGVHDLLAAGA 60 ... ...vibrio vulgaris subsp. vulgaris str. ... Hildenborough] ... Length = 119 ... Query: 375 KVGVLVTGT
Nail manifestations in pemphigus vulgaris
Cahali Juliana Burihan; Kakuda Everton Yuji Soyama; Santi Cláudia Giuli; Maruta Celina Wakisaka
2002-01-01
Nail involvement in pemphigus vulgaris is rare. We describe 5 patients with pemphigus vulgaris presenting nail involvement. In this disease, nail manifestations present, by order of frequency, as chronic paronychia, onychomadesis, onycholysis, Beau's lines and trachyonychia. All our 5 cases presented with paronychia, and 1 of them also had Beau's lines. Treatment with prednisone and/or cyclophosphamide controlled mucocutaneous and nail manifestations in all cases. O acometimento ungueal no...
Phaseolus vulgaris - recalcitrant potential.
Hnatuszko-Konka, Katarzyna; Kowalczyk, Tomasz; Gerszberg, Aneta; Wiktorek-Smagur, Aneta; Kononowicz, Andrzej K
2014-11-15
Since the ability to genetically engineer plants was established, researchers have modified a great number of plant species to satisfy agricultural, horticultural, industrial, medicinal or veterinary requirements. Almost thirty years after the first approaches to the genetic modification of pulse crops, it is possible to transform many grain legumes. However, one of the most important species for human nutrition, Phaseolus vulgaris, still lacks some practical tools for genomic research, such as routine genetic transformation. Its recalcitrance towards in vitro regeneration and rooting significantly hampers the possibilities of improvement of the common bean that suffers from many biotic and abiotic constraints. Thus, an efficient and reproducible system for regeneration of a whole plant is desired. Although noticeable progress has been made, the rate of recovery of transgenic lines is still low. Here, the current status of tissue culture and recent progress in transformation methodology are presented. Some major challenges and obstacles are discussed and some examples of their solutions are presented. Copyright © 2014 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Odile Valette
2017-09-01
Full Text Available Thioredoxin reductase (TR regulates the intracellular redox environment by reducing thioredoxin (Trx. In anaerobes, recent findings indicate that the Trx redox network is implicated in the global redox regulation of metabolism but also actively participates in protecting cells against O2. In the anaerobe Desulfovibrio vulgaris Hildenborough (DvH, there is an intriguing redundancy of the Trx system which includes a classical system using NADPH as electron source, a non-canonical system using NADH and an isolated TR (DvTRi. The functionality of DvTRi was questioned due to its lack of reactivity with DvTrxs. Structural analysis shows that DvTRi is a NAD(PH-independent TR but its reducer needs still to be identified. Moreover, DvTRi reduced by an artificial electron source is able to reduce in turn DvTrx1 and complexation experiments demonstrate a direct interaction between DvTRi and DvTrx1. The deletion mutant tri exhibits a higher sensitivity to disulfide stress and the gene tri is upregulated by O2 exposure. Having DvTRi in addition to DvTR1 as electron source for reducing DvTrx1 must be an asset to combat oxidative stress. Large-scale phylogenomics analyses show that TRi homologs are confined within the anaerobes. All TRi proteins displayed a conserved TQ/NGK motif instead of the HRRD motif, which is selective for the binding of the 2′-phosphate group of NADPH. The evolutionary history of TRs indicates that tr1 is the common gene ancestor in prokaryotes, affected by both gene duplications and horizontal gene events, therefore leading to the appearance of TRi through subfunctionalization over the evolutionary time.
Pharmacognostic Evaluation of Bambusa vulgaris Var. vulgaris Leaf ...
African Journals Online (AJOL)
The study evaluated the pharmacognostic characters and toxicity of the aqueous ethanolic extract of Bambusa vulgaris leaf in male wistar rats. The microscopy of the leaf revealed diagnostic characters such as anomocytic stomata, sinuous epidermal cells, numerous prisms of calcium oxalate crystals and covering ...
Garg, Taru; Ramchander; Shrihar, Rashmi; Gupta, Tanvi Pal; Aggarwal, Shilpi
2011-01-01
follicular plugging and multiple epithelioid cell granulomas, rimmed by lymphocytes in the deeper portion of the dermis, mainly peri-appendageal. Stain for acid-fast bacteria was negative. Cultures from the skin lesions were negative. The patient was diagnosed as having lupus vulgaris with multiple lesions of varying morphology at different sites with pulmonary tuberculosis and healed lymph node involvement.
Pemphigus vulgaris in adolescence: a case report
Ferreira, Jean Paulo Rodolfo [UNESP; Araújo, Paula Caetano [UNESP; SAliba, Marcos Tadeu Adas [UNESP; Consolaro, Renata Bianco; |Garbin, Cléa Adas Saliba [UNESP]|
2013-01-01
Pemphigus vulgaris is an autoimmune disease, normally associated with oral lesions that generally affects patients aged 40 - 60 years. The aim of this study was to report a case of pemphigus vulgaris presenting at an uncommon age with advanced periodontal disease, and to describe the treatment performed from the time of diagnosis through oral environment restoration and follow-up monitoring. One gingival vesicular lesion was biopsied. After the histological confirmation of pemphigus vulgaris,...
Lupus vulgaris associated with Scrofuloderma
Directory of Open Access Journals (Sweden)
Isha Preet Tuli
2014-01-01
Full Text Available Lupus vulgaris is a rare manifestation of tuberculosis. It is even rarer for it to complicate scrofuloderma. We report a case of a 27-year-old man who had undergone a successful treatment for pulmonary tuberculosis presenting with scrofuloderma with lesions of lupus on the overlying skin. The Mantoux test was positive and initial chest X-ray did not show any active features of tuberculosis. Discharge from the lesion stained positive for acid fast bacilli. Multiple fine needle aspirations were inconclusive. However the histopathology of biopsied lesion revealed tuberculoid granuloma with Langhans giant cells. TThe patient improved with antitubercular therapy. We are presenting this case as a rare coexistence of scrofuloderma with lupus vulgaris.
Sporotrichoid lupus vulgaris: A rare presentation.
Maheshwari, Anshul; Tiwari, Siddhi; Mathur, Deepak K; Bhargava, Puneet
2015-01-01
Lupus vulgaris is the most common presentation of cutaneous tuberculosis in India and can present as papular, nodular, plaque, ulcerative, vegetating, and tumid forms. Unusual variants include the frambesiform, gangrenous, ulcerovegetating, lichen simplex chronicus, myxomatous, and sporotrichoid types. We describe a rare sporotrichoid presentation of lupus vulgaris on the leg of a 28-year-old female of 12 years duration.
Lupus vulgaris with squamous cell carcinoma.
Motswaledi, Mojakgomo Hendrick; Doman, Chantal
2007-12-01
Tuberculosis is still a significant problem in developing countries. Cutaneous forms of tuberculosis account for approximately 10% of all cases of extrapulmonary tuberculosis. Cutaneous tuberculosis may be because of true infection with Mycobacterium tuberculosis or because of tuberculids. Tuberculids are immunological reactions to haematogenously spread antigenic components of M. tuberculosis. True cutaneous tuberculosis may be because of inoculation or haematogenous spread of M. tuberculosis to the skin. Lupus vulgaris is the commonest form of true cutaneous tuberculosis. Other forms of true cutaneous tuberculosis are tuberculous chancre, tuberculosis verrucosa cutis, scrofuloderma, periorificial tuberculosis and miliary tuberculosis of the skin. Lupus vulgaris is usually chronic and progressive. It occurs in patients with moderate to high immunity against M. tuberculosis as evidenced by strongly positive tuberculin test. Long-standing cases of lupus vulgaris may be complicated by squamous cell carcinoma (SCC). We describe a patient who had undiagnosed lupus vulgaris for 35 years until she developed SCC on the lesion of lupus vulgaris.
Zhou, Aifen; Hillesland, Kristina L; He, Zhili; Schackwitz, Wendy; Tu, Qichao; Zane, Grant M; Ma, Qiao; Qu, Yuanyuan; Stahl, David A; Wall, Judy D; Hazen, Terry C; Fields, Matthew W; Arkin, Adam P; Zhou, Jizhong
2015-11-01
To investigate the genetic basis of microbial evolutionary adaptation to salt (NaCl) stress, populations of Desulfovibrio vulgaris Hildenborough (DvH), a sulfate-reducing bacterium important for the biogeochemical cycling of sulfur, carbon and nitrogen, and potentially the bioremediation of toxic heavy metals and radionuclides, were propagated under salt stress or non-stress conditions for 1200 generations. Whole-genome sequencing revealed 11 mutations in salt stress-evolved clone ES9-11 and 14 mutations in non-stress-evolved clone EC3-10. Whole-population sequencing data suggested the rapid selective sweep of the pre-existing polymorphisms under salt stress within the first 100 generations and the slow fixation of new mutations. Population genotyping data demonstrated that the rapid selective sweep of pre-existing polymorphisms was common in salt stress-evolved populations. In contrast, the selection of pre-existing polymorphisms was largely random in EC populations. Consistently, at 100 generations, stress-evolved population ES9 showed improved salt tolerance, namely increased growth rate (2.0-fold), higher biomass yield (1.8-fold) and shorter lag phase (0.7-fold) under higher salinity conditions. The beneficial nature of several mutations was confirmed by site-directed mutagenesis. All four tested mutations contributed to the shortened lag phases under higher salinity condition. In particular, compared with the salt tolerance improvement in ES9-11, a mutation in a histidine kinase protein gene lytS contributed 27% of the growth rate increase and 23% of the biomass yield increase while a mutation in hypothetical gene DVU2472 contributed 24% of the biomass yield increase. Our results suggested that a few beneficial mutations could lead to dramatic improvements in salt tolerance.
Vegetative propagation of Bambusa vulgaris
Directory of Open Access Journals (Sweden)
Rafael Malfitano Braga
2017-06-01
Full Text Available Bamboo is an important source of raw material of multiple uses. The development of simple techniques for its propagation is a practical way to enable its implementation in ownership of low technology. The present work had the objective of evaluating artisanal propagation methods for Bambusa vulgaris. Two types of propagules were tested, with buds budded or not, and three relative positions to the removal of vegetative material on the culm. The best propagule was with only one node, extracted from the lower thirds of the stem, presenting 72% of rooting. This result demonstrates its potential for seedling production of this species under low tech.
Management strategies for acne vulgaris
Directory of Open Access Journals (Sweden)
Whitney KM
2011-04-01
Full Text Available Kristen M Whitney1, Chérie M Ditre21Philadelphia College of Osteopathic Medicine, Philadelphia, PA, USA; 2Skin Enhancement Center and Cosmetic Dermatology, Department of Dermatology, University of Pennsylvania School of Medicine, Philadelphia, PA, USADate of preparation: 30th November 2010Conflicts of interest: None declaredClinical question: What are the most effective treatment(s for mild, moderate, severe, and hormonally driven acne?Results: Mild acne responds favorably to topical treatments such as benzoyl peroxide, salicylic acid, and a low-dose retinoid. Moderate acne responds well to combination therapy comprising-topical benzoyl peroxide, antibiotics, and/or retinoids, as well as oral antibiotics in refractory cases and oral contraceptive pills for female acne patients. Severe nodulocystic acne vulgaris responds best to oral isotretinoin therapy. In female patients with moderate to severe acne, facial hair, loss of scalp hair and irregular periods, polycystic ovarian syndrome should be considered and appropriate treatment with hormonal modulation given. Adjunctive procedures can also be considered for all acne patients.Implementation: Pitfalls to avoid when treating acne: treatment of acne in women of childbearing age; familiarization of all acne treatments in order to individualize management for patients; indications for specialist referral.Keywords: acne vulgaris, benzoyl peroxide, retinoids, antibiotics, light and laser therapy, photodynamic therapy, photopneumatic therapy, chemical peels
Acne vulgaris: pathogenesis, treatment, and needs assessment.
Knutsen-Larson, Siri; Dawson, Annelise L; Dunnick, Cory A; Dellavalle, Robert P
2012-01-01
Acne vulgaris is a common skin condition with substantial cutaneous and psychologic disease burden. Studies suggest that the emotional impact of acne is comparable to that experienced by patients with systemic diseases, like diabetes and epilepsy. In conjunction with the considerable personal burden experienced by patients with acne, acne vulgaris also accounts for substantial societal and health care burden. The pathogenesis and existing treatment strategies for acne are complex. This article discusses the epidemiology, pathogenesis, and treatment of acne vulgaris. The burden of disease in the United States and future directions in the management of acne are also addressed. Copyright © 2012 Elsevier Inc. All rights reserved.
Extensive keloidal healing of pemphigus vulgaris
Directory of Open Access Journals (Sweden)
Khanna Neena
1997-01-01
Full Text Available Bullae of pemphigus vulgaris heal without scarring. We here report a patient of pemphigus vulgaris whose lesions healed with a one-month history of extensive flaccid bullae and uninfected erosions on the trunk and extremities along with superficial erosions in the oral mucosa. The clinical suspicion of pemphigus vulgaris was confirmed by histopathological and immunohistological examination. Pulse therapy with monthly parenteral dexamethasone and cyclophosphamide pulse was instituted. The cutaneous lesions on healing formed extensive keloidal scars despite high dose of monthly corticosteroid therapy.
Hypertrophic lupus vulgaris: an unusual presentation.
Jain, Vijay K; Aggarwal, Kamal; Jain, Sarika; Singh, Sunita
2009-07-01
Lupus vulgaris is the most common form of cutaneous tuberculosis occurring in previously sensitized individuals with a high degree of tuberculin sensitivity. Various forms including plaque, ulcerative, hypertrophic, vegetative, papular, and nodular forms have been described. A 30-year-old male patient presented with a very large hypertrophic lupus vulgaris lesion over left side of chest since 22 years. Histopathological examination showed granulomatous infiltration without caseation necrosis. The Mantoux reaction was strongly positive. Hypertrophic lupus vulgaris of such a giant size and that too at an unusual site is extremely rare and hence is being reported.
Neonatal and infantile acne vulgaris: an update.
Serna-Tamayo, Cristian; Janniger, Camila K; Micali, Giuseppe; Schwartz, Robert A
2014-07-01
Acne may present in neonates, infants, and small children. Neonatal and infantile acne vulgaris are not considered to be rare. The presentation of acne in this patient population sometimes represents virilization and may portend later development of severe adolescent acne. Neonatal and infantile acne vulgaris must be distinguished from other cutaneous disorders seen in newborns and infants. Infantile acne tends to be more pleomorphic and inflammatory, thus requiring more vigorous therapy than neonatal acne.
Pulse Clarithromycin Therapy In Severe ACNE Vulgaris
Directory of Open Access Journals (Sweden)
Rathi Sanjay K
2002-01-01
Full Text Available Three patients with severe acne vulgaris, not responding with long courses of doxycycline, minocycline and erythromycin were given oral clarithromycin in pulsed regimen. The patients were given 7 days course of clarithromycin 250mg twice daily, which was repeated after a gap of 10 days. Such 3 courses were given. The lesions responded significantly. No significant side effect was noted. Pulse clarithromycin therapy seems to be a good alternative and effective tool in the management of severe acne vulgaris.
Management strategies for acne vulgaris
Whitney, Kristen M; Ditre, Chérie M
2011-01-01
Clinical question: What are the most effective treatment(s) for mild, moderate, severe, and hormonally driven acne? Results: Mild acne responds favorably to topical treatments such as benzoyl peroxide, salicylic acid, and a low-dose retinoid. Moderate acne responds well to combination therapy comprising-topical benzoyl peroxide, antibiotics, and/or retinoids, as well as oral antibiotics in refractory cases and oral contraceptive pills for female acne patients. Severe nodulocystic acne vulgaris responds best to oral isotretinoin therapy. In female patients with moderate to severe acne, facial hair, loss of scalp hair and irregular periods, polycystic ovarian syndrome should be considered and appropriate treatment with hormonal modulation given. Adjunctive procedures can also be considered for all acne patients. Implementation: Pitfalls to avoid when treating acne: treatment of acne in women of child-bearing age; familiarization of all acne treatments in order to individualize management for patients; indications for specialist referral. PMID:21691566
The Development of Olfactory Organ of Lissotriton Vulgaris (Amphibia, Caudata)
National Research Council Canada - National Science Library
M F Kovtun; Ya V Stepanyuk
2015-01-01
The Development of Olfactory Organ of Lissotriton vulgaris (Amphibia, Caudata). Kovtun, M. F, Stepanyuk, Ya. V. - Using common histological methods, the morphogenesis of olfactory analyzer peripheral part of Lissotriton vulgaris...
The Development of Olfactory Organ of Lissotriton Vulgaris (Amphibia, Caudata)
National Research Council Canada - National Science Library
M. F. Kovtun; Ya. V. Stepanyuk
2015-01-01
The Development of Olfactory Organ of Lissotriton vulgaris (Amphibia, Caudata). Kovtun, M. F, Stepanyuk, Ya. V. - Using common histological methods, the morphogenesis of olfactory analyzer peripheral part of Lissotriton vulgaris...
Complementary therapies for acne vulgaris.
Cao, Huijuan; Yang, Guoyan; Wang, Yuyi; Liu, Jian Ping; Smith, Caroline A; Luo, Hui; Liu, Yueming
2015-01-19
Acne is a chronic skin disease characterised by inflamed spots and blackheads on the face, neck, back, and chest. Cysts and scarring can also occur, especially in more severe disease. People with acne often turn to complementary and alternative medicine (CAM), such as herbal medicine, acupuncture, and dietary modifications, because of their concerns about the adverse effects of conventional medicines. However, evidence for CAM therapies has not been systematically assessed. To assess the effects and safety of any complementary therapies in people with acne vulgaris. We searched the following databases from inception up to 22 January 2014: the Cochrane Skin Group Specialised Register, the Cochrane Central Register of Controlled Trials (CENTRAL; 2014,Issue 1), MEDLINE (from 1946), Embase (from 1974), PsycINFO (from 1806), AMED (from 1985), CINAHL (from 1981), Scopus (from 1966), and a number of other databases listed in the Methods section of the review. The Cochrane CAM Field Specialised Register was searched up to May 2014. We also searched five trials registers and checked the reference lists of articles for further references to relevant trials. We included parallel-group randomised controlled trials (or the first phase data of randomised cross-over trials) of any kind of CAM, compared with no treatment, placebo, or other active therapies, in people with a diagnosis of acne vulgaris. Three authors collected data from each included trial and evaluated the methodological quality independently. They resolved disagreements by discussion and, as needed, arbitration by another author. We included 35 studies, with a total of 3227 participants. We evaluated the majority as having unclear risk of selection, attrition, reporting, detection, and other biases. Because of the clinical heterogeneity between trials and the incomplete data reporting, we could only include four trials in two meta-analyses, with two trials in each meta-analysis. The categories of CAM included
Complementary therapies for acne vulgaris
Cao, Huijuan; Yang, Guoyan; Wang, Yuyi; Liu, Jian Ping; Smith, Caroline A; Luo, Hui; Liu, Yueming
2015-01-01
Background Acne is a chronic skin disease characterised by inflamed spots and blackheads on the face, neck, back, and chest. Cysts and scarring can also occur, especially in more severe disease. People with acne often turn to complementary and alternative medicine (CAM), such as herbal medicine, acupuncture, and dietary modifications, because of their concerns about the adverse effects of conventional medicines. However, evidence for CAM therapies has not been systematically assessed. Objectives To assess the effects and safety of any complementary therapies in people with acne vulgaris. Search methods We searched the following databases from inception up to 22 January 2014: the Cochrane Skin Group Specialised Register, the Cochrane Central Register of Controlled Trials (CENTRAL; 2014, Issue 1), MEDLINE (from 1946), Embase (from 1974), PsycINFO (from 1806), AMED (from 1985), CINAHL (from 1981), Scopus (from 1966), and a number of other databases listed in the Methods section of the review. The Cochrane CAM Field Specialised Register was searched up to May 2014. We also searched five trials registers and checked the reference lists of articles for further references to relevant trials. Selection criteria We included parallel-group randomised controlled trials (or the first phase data of randomised cross-over trials) of any kind of CAM, compared with no treatment, placebo, or other active therapies, in people with a diagnosis of acne vulgaris. Data collection and analysis Three authors collected data from each included trial and evaluated the methodological quality independently. They resolved disagreements by discussion and, as needed, arbitration by another author. Main results We included 35 studies, with a total of 3227 participants. We evaluated the majority as having unclear risk of selection, attrition, reporting, detection, and other biases. Because of the clinical heterogeneity between trials and the incomplete data reporting, we could only include four
Directory of Open Access Journals (Sweden)
Bhaduri Gautam
1999-01-01
Full Text Available A case of lupus vulgaris at a rare site-eyelid is reported here. Delayed diagnosis of the condition affecting the left eyelid in a female patient aged 78 years, led to scarring and fixity of eyelids with resultant exposure keratitis and dimness of vision. Antitubercular therapy improved skin condition but dimness f vision persisted.
streptococcus pneumoniae , klebsiella pneumoniae proteus vulgaris
African Journals Online (AJOL)
DR. AMINU
ABSTRACT. This investigation was conducted to determine the in-vitro effect of aqueous, ethanol and methanol crude extracts of Euphorbia hirta at concentrations ranging from 10mg/ml – 100mg/ml against three pathogenic bacteria (Streptococcus pneumoniae, Klebsiella pneumoniae and Proteus vulgaris) using cup plate ...
Chlorotic mottle of bean (Phaseolus vulgaris L.)
Jayasinghe, W.U.
1982-01-01
For the past years there have been outbreaks of a disease of bean ( Phaseolus vulgaris L.) in Colombia called bean chlorotic mottle. The etiology of bean chlorotic mottle was not known, but the disease was generally believed to be incited by the same whitefly-transmitted virus
Antimitochondrial Autoantibodies in Pemphigus Vulgaris
Marchenko, Steve; Chernyavsky, Alexander I.; Arredondo, Juan; Gindi, Vivian; Grando, Sergei A.
2010-01-01
A loss of epidermal cohesion in pemphigus vulgaris (PV) results from autoantibody action on keratinocytes (KCs) activating the signaling kinases and executioner caspases that damage KCs, causing their shrinkage, detachment from neighboring cells, and rounding up (apoptolysis). In this study, we found that PV antibody binding leads to activation of epidermal growth factor receptor kinase, Src, p38 MAPK, and JNK in KCs with time pattern variations from patient to patient. Both extrinsic and intrinsic apoptotic pathways were also activated. Although Fas ligand neutralizing antibody could inhibit the former pathway, the mechanism of activation of the latter remained unknown. PV antibodies increased cytochrome c release, suggesting damage to mitochondria. The immunoblotting experiments revealed penetration of PVIgG into the subcellular mitochondrial fraction. The antimitochondrial antibodies from different PV patients recognized distinct combinations of antigens with apparent molecular sizes of 25, 30, 35, 57, 60, and 100 kDa. Antimitochondrial antibodies were pathogenic because their absorption abolished the ability of PVIgG to cause keratinocyte detachment both in vitro and in vivo. The downstream signaling of antimitochondrial antibodies involved JNK and late p38 MAPK activation, whereas the signaling of anti-desmoglein 3 (Dsg3) antibody involved JNK and biphasic p38 MAPK activation. Using KCs grown from Dsg3−/− mice, we determined that Dsg3 did not serve as a surrogate antigen allowing antimitochondrial antibodies to enter KCs. The PVIgG-induced activation of epidermal growth factor receptor and Src was affected neither in Dsg3−/− KCs nor due to absorption of antimitochondrial antibodies. These results demonstrated that apoptolysis in PV is a complex process initiated by at least three classes of autoantibodies directed against desmosomal, mitochondrial, and other keratinocyte self-antigens. These autoantibodies synergize with the proapoptotic serum and
Clark, Melinda E; He, Zhili; Redding, Alyssa M; Joachimiak, Marcin P; Keasling, Jay D; Zhou, Jizhong Z; Arkin, Adam P; Mukhopadhyay, Aindrila; Fields, Matthew W
2012-04-16
Desulfovibrio vulgaris Hildenborough is a sulfate-reducing bacterium (SRB) that is intensively studied in the context of metal corrosion and heavy-metal bioremediation, and SRB populations are commonly observed in pipe and subsurface environments as surface-associated populations. In order to elucidate physiological changes associated with biofilm growth at both the transcript and protein level, transcriptomic and proteomic analyses were done on mature biofilm cells and compared to both batch and reactor planktonic populations. The biofilms were cultivated with lactate and sulfate in a continuously fed biofilm reactor, and compared to both batch and reactor planktonic populations. The functional genomic analysis demonstrated that biofilm cells were different compared to planktonic cells, and the majority of altered abundances for genes and proteins were annotated as hypothetical (unknown function), energy conservation, amino acid metabolism, and signal transduction. Genes and proteins that showed similar trends in detected levels were particularly involved in energy conservation such as increases in an annotated ech hydrogenase, formate dehydrogenase, pyruvate:ferredoxin oxidoreductase, and rnf oxidoreductase, and the biofilm cells had elevated formate dehydrogenase activity. Several other hydrogenases and formate dehydrogenases also showed an increased protein level, while decreased transcript and protein levels were observed for putative coo hydrogenase as well as a lactate permease and hyp hydrogenases for biofilm cells. Genes annotated for amino acid synthesis and nitrogen utilization were also predominant changers within the biofilm state. Ribosomal transcripts and proteins were notably decreased within the biofilm cells compared to exponential-phase cells but were not as low as levels observed in planktonic, stationary-phase cells. Several putative, extracellular proteins (DVU1012, 1545) were also detected in the extracellular fraction from biofilm cells
NCBI nr-aa BLAST: CBRC-XTRO-01-0138 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0138 ref|YP_011077.1| apolipoprotein N-acyltransferase [Desulfovibrio ...vulgaris subsp. vulgaris str. Hildenborough] ref|YP_966749.1| apolipoprotein N-acyltransferase [Desulfovibri...o vulgaris subsp. vulgaris DP4] gb|AAS96336.1| apolipoprotein N-acyltransferase [Desulfovibrio vulgaris subs...p. vulgaris str. Hildenborough] gb|ABM28322.1| apolipoprotein N-acyltransferase [Desulfovibrio vulgaris subsp. vulgaris DP4] YP_011077.1 2e-26 34% ...
[Diet in pathogenesis of acne vulgaris].
Ozdarska, Katarzyna; Osucha, Karolina; Savitskyi, Stepan; Malejczyk, Jacek; Galus, Ryszard
2017-10-23
Acne vulgaris is one of the most common dermatologic condition especially among adolescents. Acne is related to excess sebum production by sebaceous glands, inflammation both within and adjacent to the comedones, hyperproliferation of Propionibacterium acnes. Some of investigations show association between acne and diet. Milk increases the level of IGF-1 leading to the synthesis of androgen-mediated increases sebum production. Chocolate predispose to hyperglycemia and insulinemia which aggravate of acne vulgaris. High levels of omega-6 fatty acids have been associated with increase of acne in contrast to omega-3 fatty acids, which decrease inflammation. Food have huge impact on development and severity of acne and may exert beneficial effect in the treatment of this disorder.
Spotlight on adapalene in acne vulgaris.
Waugh, John; Noble, Stuart; Scott, Lesley J
2004-01-01
Adapalene (Differin) is a retinoid agent indicated for the topical treatment of acne vulgaris. In clinical trials, 0.1% adapalene gel has proved to be effective in this indication and was as effective as 0.025% tretinoin gel, 0.1% tretinoin microsphere gel, 0.05% tretinoin cream and 0.1% tazarotene gel once every two days; however, the drug was less effective than once-daily 0.1% tazarotene gel. It can be used alone in mild acne or in combination with antimicrobials in inflammatory acne and has proved efficacious as maintenance treatment. Adapalene has a rapid onset of action and a particularly favorable tolerability profile compared with other retinoids. These attributes can potentially promote patient compliance, an important factor in treatment success. Adapalene is, therefore, assured of a role in the first-line treatment of acne vulgaris.
Adapalene In The Treatment Of Acne Vulgaris
Directory of Open Access Journals (Sweden)
Prasad H R Y
2004-01-01
Full Text Available Topical tretinoin, a retinoid long in use for the treatment of acne vulgaris, has the disadvantage of skin irritation. Adapalene, a third generation retinoid, has been claimed to have less side-effects. We evaluated the safety and efficacy of adapalene in an open uncontrolled trial. Thirty three patients of mild to moderate acne vulgaris were included in the study. Of them, 22 patients completed the study period of 12 weeks. The mean age of all 33 patients was 19 year with male to female ratio of 1.75:1. There was significant decrease in lesion count in each of 1,4,8 and 12 weeks evaluations (p <0.05 in both inflammatory and non-inflammatory lesions. About 70% complained of burning, 60% of itching and 30% of dryness. However, none of the side-effects was severe enough to stop the medication except in one case.
Giant lupus vulgaris: A rare presentation.
Sacchidanand, S; Sharavana, S; Mallikarjun, M; Nataraja, H V
2012-01-01
Cutaneous tuberculosis continues to be an important public health problem even with the availability of highly effective anti-tuberculous drugs. It constitutes 0.1% of all cases of extrapulmonary tuberculosis. Lupus vulgaris is the most common form of cutaneous tuberculosis that occurs in previously sensitized individuals with a moderate degree of immunity against tubercle bacilli. The different types of lupus vulgaris include plaque, ulcerative, vegetative, papular and nodular, and tumor forms. A 40-year-old man presented with large multiple plaques over right upper limb, right side of chest and back, and right lower limb for the past 30 years. Histopathology showed numerous noncaseating granulomas with Langhan's type of giant cells. The Mantoux test showed strong positivity and there was excellent response to anti-tuberculous treatment. This case is being reported because of its extreme chronicity of 30 years duration, unusually large size and multiplicity of lesions.
Chloroplast Microsatellite Diversity in Phaseolus vulgaris
Desiderio, F.; Bitocchi, E.; Bellucci, E.; Rau, D.; Rodriguez, M.; Attene, G.; Papa, R.; Nanni, L.
2012-01-01
Evolutionary studies that are aimed at defining the processes behind the present level and organization of crop genetic diversity represent the fundamental bases for biodiversity conservation and use. A Mesoamerican origin of the common bean Phaseolus vulgaris was recently suggested through analysis of nucleotide polymorphism at the nuclear level. Here, we have used chloroplast microsatellites to investigate the origin of the common bean, on the basis of the specific characteristics of these markers (no recombination, haploid genome, uniparental inheritance), to validate these recent findings. Indeed, comparisons of the results obtained through analysis of nuclear and cytoplasmic DNA should allow the resolution of some of the contrasting information available on the evolutionary processes. The main outcomes of the present study are: (i) confirmation at the chloroplast level of the results obtained through nuclear data, further supporting the Mesoamerican origin of P. vulgaris, with central Mexico representing the cradle of its diversity; (ii) identification of a putative ancestral plastidial genome, which is characteristic of a group of accessions distributed from central Mexico to Peru, but which have not been highlighted beforehand through analyses at the nuclear level. Finally, the present study suggests that when a single species is analyzed, there is the need to take into account the complexity of the relationships between P. vulgaris and its closely related and partially intercrossable species P. coccineus and P. dumosus. Thus, the present study stresses the importance for the investigation of the speciation processes of these taxa through comparisons of both plastidial and nuclear variability. This knowledge will be fundamental not only from an evolutionary point of view, but also to put P. coccineus and P. dumosus germplasm to better use as a source of useful diversity for P. vulgaris breeding. PMID:23346091
Chloroplast microsatellite diversity in Phaseolus vulgaris.
Directory of Open Access Journals (Sweden)
Francesca eDesiderio
2013-01-01
Full Text Available Evolutionary studies that are aimed at defining the processes behind the present level and organization of crop genetic diversity represent the fundamental bases for biodiversity conservation and use. A Mesoamerican origin of the common bean Phaseolus vulgaris was recently suggested through analysis of nucleotide polymorphism at the nuclear level. Here, we have used chloroplast microsatellites to investigate the origin of the common bean, on the basis of the specific characteristics of these markers (no recombination, haploid genome, uniparental inheritance, to validate these recent findings. Indeed, comparisons of the results obtained through analysis of nuclear and cytoplasmic DNA should allow the resolution of some of the contrasting information available on the evolutionary processes. The main outcomes of the present study are: (i confirmation at the chloroplast level of the results obtained through nuclear data, further supporting the Mesoamerican origin of P. vulgaris, with central Mexico representing the cradle of its diversity; (ii identification of a putative ancestral plastidial genome, which is characteristic of a group of accessions distributed from central Mexico to Peru, but which have not been highlighted beforehand through analyses at the nuclear level. Finally, the present study suggests that when a single species is analysed, there is the need to take into account the complexity of the relationships between P. vulgaris and its closely related and partially intercrossable species P. coccineus and P. dumosus. Thus, the present study stresses the importance for the investigation of the speciation processes of these taxa through comparisons of both plastidial and nuclear variability. This knowledge will be fundamental not only from an evolutionary point of view, but also to put P. coccineus and P. dumosus germplasm to better use as a source of useful diversity for P. vulgaris breeding.
[ACNE VULGARIS--AETIOLOGY, CLASSIFICATION, TREATMENT].
Janda, Katarzyna; Chwilkowska, Magdalena
2014-01-01
A spotless skin is a rarity. Both women and men have different problems related to the complexion. One of the most common problems is acne, which affects an increasing number of people of all ages. Seborrhea skin areas rich in sebaceous glands, the formation of comedones, inflammation, and scars are characteristic for this disease. The aim of the study was to discuss the causes of acne vulgaris, methods of treatment, and proper care of the skin affected by this problem.
The psychosocial impact of acne vulgaris
Directory of Open Access Journals (Sweden)
Neirita Hazarika
2016-01-01
Full Text Available Background: Acne vulgaris causes erythematous papulopustular lesions in active stage and often leave behind residual scarring and pigmentation. Its onset in adolescence may add to the emotional and psychological challenges experienced during this period. Aims: To assess the impact of acne on the various psychosocial domains of daily life. Materials and Methods: This was a prospective, cross-sectional study done in the dermatology out-patient department of a tertiary care hospital from January to March 2015. A total of 100 consecutive, newly diagnosed patients of acne vulgaris, aged 15 years and above were included in this study. The relationship between acne vulgaris and its sequelae was analyzed with ten different domains of daily life by using dermatology life quality index (DLQI questionnaire. Results: Females (56%, 15–20 year olds (61%, facial lesions (60%, and Grade II acne (70% were most common. Acne scars were noted in 75% patients, whereas 79% cases had post-acne hyperpigmentation. Thirty-seven percent patients had DLQI scores of (6–10 interpreted as moderate effect on patient's life. Statistically significant correlation (P < 0.05 found were as follows: Physical symptoms with grade of acne; embarrassment with site and grade of acne; daily activities with grade of acne and post-acne pigmentation; choice of clothes with site of acne; social activities with gender, site and grade of acne; effect on work/study with grade of acne; interpersonal problems with site and post-acne pigmentation; sexual difficulties with grade of acne. Limitation: It was a hospital-based study with small sample size. Conclusion: Significant impact of acne and its sequelae was noted on emotions, daily activities, social activities, study/work, and interpersonal relationships. Assurance and counseling along with early treatment of acne vulgaris is important to reduce disease-related psychosocial sequelae and increase the efficacy of treatment.
[Concepts for immune intervention in psoriasis vulgaris].
Nestle, F O
2000-09-14
Psoriasis vulgaris is a chronic inflammatory skin condition with a genetic background. Activated T-cells and their secreted products seem to play an essential role in the induction as well as the promotion of the psoriatic plaque. We will focus on some recent concepts on the immunopathogenesis of psoriasis highlighting the role of dendritic cells as initiators of the disease as well as the recruitment of disease specific T-cells. Concepts for immunointervention will be introduced.
Pemfigus Vulgaris Manifestasi di Mulut dan Penatalaksanaannya
Directory of Open Access Journals (Sweden)
Metawati Tarmidi
2015-11-01
Full Text Available Pemfigus is an autoimmune disease involving the skin and mucosa and characterized by intraepidermal bullae formation. The four variations of pemphigus are pemphigus vulgaris, vegetans, foliaceus, and erythematosus. Although several clinical variants are recognized, pemphigus vulgaris is the most common form and the type most likely to exhibit oral manifestations. There are from 0,1 to 0,5 cases reported each year per 100,000 population with the highest incidence occurring in the fourth and seventh decades of life. Only rare cases have been reported in children and the elderly. Before the advent of systemic corticosteroid therapy, pemphigus vulgaris was fatal within few months to two years. A characteristic feature is the nikolsky sign which is the ability to elicit the formation of bullae by the application of firm lateral pressure on normal-appearing skin. The oral lesions often have a slow, insidious onset with symptoms present for many months before a diagnosis is made or skin lesions develop. Lesions may be found anywhere but are most common on the palate, buccal mucosa, and gingiva. Although the oral lesions are vesicobullous in nature, intact blisters are rarely seen. Diagnosis is established by biopsy and immunofluorescent studies. Titers on indirect immunofluorescence often correlate to the severity of the disease. The aim of this study is to promote and support early dental diagnosis when the prognosis is good.
Insulin resistance in severe acne vulgaris.
Emiroğlu, Nazan; Cengiz, Fatma Pelin; Kemeriz, Funda
2015-08-01
Acne vulgaris is a pilosebaceous gland disease that usually affects people from puberty to young adulthood. It is seen especially on the face, neck, trunk and arms. Its severity differs from patient to patient and its pathogenesis is multifactorial. The main pathogenic factors of acne are high sebaceous gland secretion, follicular hyperproliferation, high androgen effects, propionibacterium acnes colonization and inflammation. Diet is always thought a probable reason for acne and many studies are done about acne and diet. To determine the effect of insulin resistance in severe acne vulgaris. Two hundred and forty-three acne vulgaris patients and 156 healthy controls were enrolled into the study. The blood levels of insulin and glucose were measured. Homeostasis Model Assessment (HOMA) Index was calculated. The values were compared with the control group. All of the patients were in the severe acne group according to their scores on the global acne scoring scale. While fasting blood glucose levels were not different between the groups (p > 0.05, 82.91 ±9.76 vs. 80.26 ±8.33), the fasting insulin levels were significantly higher in the patient group than in the control group (p pathogenesis of acne.
Auer, M.; Remis, J.; Jorgens, D.; Zemla, M.; Singer, M.; Schmitt, J.; Gorby, Y.; Hazen, T.; Wall, J.; Elias, D.; Torok, T.
2008-12-01
Numerous studies have helped characterize the stress response of the anaerobic sulfate reducer Desulfovibrio vulgaris Hildenborough (DvH). Yet all of these techniques represent bulk analyses of cells grown mostly under liquid culture conditions in large reactors. Such results represent an average over a large variety of individual cellular responses, hence assuming a homogeneous distribution of physiological traits. Moreover, only recently are those techniques applied to the environmentally more relevant condition of microbial communities (biofilms). What is missing is a detailed ultrastructural analysis of such biofilms in order to determine biofilm organization and its extracellular metal deposition distribution. Using sophisticated sample cryo-preparation approaches such as high-pressure freezing, freeze-substitution or microwave- assisted processing, followed serial section TEM imaging, we have found a large heterogeneity with respect to metal precipitation with some cells being surrounded by metal precipitates whereas neighboring cells, being genetically identical and seeing virtually the exact same microenvironment, completely lack extracellular metal deposits. Interestingly, apart from metal deposits near cell surfaces, we also found string- and sheet- like metal deposits in between neighboring cells that in mature biofilms can extend for hundreds of micrometers. In mature DvH biofilms such deposits were predominantly associated with areas of intact cells in biofilms, with areas devoid of such metal deposits displayed predominantly cell debris, suggesting a role of such deposits for cell survival, which may be of high significance to biofilms at DOE sites. Upon tomographic imaging we found that extracellular metal deposits were often associated with thin filaments and vesicle-like features. To complement our serial section 2D analysis of resin-embedded samples and the resulting limitation of sampling 3D biofilm as thin sections of arbitrary orientation, we
Antioxidant effect of Citrullus vulgaris (watermelon) extract against ...
African Journals Online (AJOL)
The Antioxidant effect of Citrullus Vulgaris (Watermelon) extract was evaluated against lipid oxidation in freshly caught fishes during cooking. GC-MS analysis of Hexane and total phenolic extract of Citrullus Vulgaris flesh reveals that the extracts contain 55 compounds which includes 5- hydroxymethyl furfural, ...
[Sensitivity of Chlorella vulgaris to metribuzin, puma and alachlor].
Yang, Zhiqiang; Dong, Bo; Wu, Jincai
2004-09-01
The relative sensitivities of Chlorella vulgaris to three commonly used herbicides metribuzin, puma and alachlor were determined by toxicity tests of 96-h static exposures. The results showed that the toxicities of metribuzin and alachlor to C. vulgaris increased with exposure time, and the density of C. vulgaris decreased with increasing concentrations of these two herbicides in the test media. The maximum specific growth rate of C. vulgaris exposed to metribuzin (0.24 mgL x L(-1)) and alachlor (12.8 mg x L(-1)) was 12.38% and 31.58% of the control, respectively. At low concentration, puma stimulated C. vulgaris growth, but at high concentration, it inhibited the growth significantly. The maximum specific growth rate of C. vulgaris under 0.08 mg x L(-1) puma was 111.44% of the control, and the toxicity of puma declined with increasing exposure duration. The EC50 value of metribuzin, puma and alachlor was 0.021, 0.937, and 5.54 mg x L(-1), respectively. The relative sensitivities of C. vulgaris to the three herbicides decreased in the order of metribuzin, puma and alachlor. The chlorophyll a content of C. vulgaris decreased with the increasing concentrations of metribuzin, puma and alachlor.
Variation in the Breeding System of Prunella vulgaris L.
Prunella vulgaris (Lamiaceae), commonly known as selfheal, is a perennial herb with a long history of use in traditional medicine. Recent studies have found that P. vulgaris possesses anti-inflammatory, antiviral and anti-bacterial properties, which may lead to increased commercial demand. To date...
Energy-Based Devices in Treatment of Acne Vulgaris.
Handler, Marc Z; Bloom, Bradley S; Goldberg, David J
2016-05-01
Acne vulgaris is a chronic dermatologic complaint with a multifactorial cause. Traditionally, antibiotics and retinoids have been used to manage the condition; patient compliance has been an ongoing issue. A variety of energy-based devices have been reported to be effective in the treatment of acne vulgaris. To review and summarize the current literature specific to treatment of acne vulgaris with energy-based devices. A review of the current literature of energy-based devices used for the treatment of acne vulgaris. Although limited randomized controlled trials for the treatment of acne have been performed, significant clinical improvement of acne vulgaris, especially of inflammatory lesions, has been demonstrated with a variety of energy-based devices. Newer approaches may lead to even better results.
Changes in hemostasis in foals naturally infected with Strongylus vulgaris
DEFF Research Database (Denmark)
Pihl, Tina Holberg; Krarup Nielsen, Martin; Jacobsen, Stine
2017-01-01
Strongylus vulgaris has been found endemic in equine populations subject to parasite control by targeted selective anthelmintic therapy. This study investigated hemostasis in foals naturally infected with S. vulgaris and monitored this response over the course of progressing infection stages....... The hemostatic indices D-dimer, antithrombin III (ATIII), fibrinogen, prothrombin time (PT), and activated partial thromboplastin time were evaluated in weekly blood samples for up to 50 weeks in 12 foals born into a herd with high prevalence of S. vulgaris. Results were compared with weekly S. vulgaris antibody...... enzyme-linked immunosorbent assay values in all foals using a linear mixed effects model with repeated measures and to total numbers of S. vulgaris larvae in nine foals at necropsy with Pearson linear correlation. In the first week of life, all evaluated indices of hemostasis were significantly different...
Hormonal treatment of acne vulgaris: an update
Elsaie, Mohamed L
2016-01-01
Acne vulgaris is a common skin condition associated with multiple factors. Although mostly presenting alone, it can likewise present with features of hyperandrogenism and hormonal discrepancies. Of note, hormonal therapies are indicated in severe, resistant-to-treatment cases and in those with monthly flare-ups and when standard therapeutic options are inappropriate. This article serves as an update to hormonal pathogenesis of acne, discusses the basics of endocrinal evaluation for patients with suspected hormonal acne, and provides an overview of the current hormonal treatment options in women. PMID:27621661
Hormonal treatment of acne vulgaris: an update
Directory of Open Access Journals (Sweden)
Elsaie ML
2016-09-01
Full Text Available Mohamed L Elsaie Department of Dermatology and Venereology, National Research Centre, Cairo, Egypt Abstract: Acne vulgaris is a common skin condition associated with multiple factors. Although mostly presenting alone, it can likewise present with features of hyperandrogenism and hormonal discrepancies. Of note, hormonal therapies are indicated in severe, resistant-to-treatment cases and in those with monthly flare-ups and when standard therapeutic options are inappropriate. This article serves as an update to hormonal pathogenesis of acne, discusses the basics of endocrinal evaluation for patients with suspected hormonal acne, and provides an overview of the current hormonal treatment options in women. Keywords: acne, hormones, hyperandrogenism
Nootropic effect of meadowsweet (Filipendula vulgaris) extracts.
Shilova, I V; Suslov, N I
2015-03-01
The effects of the extracts of the aboveground parts of Filipendula vulgaris Moench on the behavior and memory of mice after hypoxic injury and their physical performance in the open-field test were studied using the models of hypoxia in a sealed volume, conditioned passive avoidance response (CPAR), and forced swimming with a load. The extracts improved animal resistance to hypoxia, normalized orientation and exploration activities, promoted CPAR retention after hypoxic injury, and increased physical performance. Aqueous extract of meadowsweet had the most pronounced effect that corresponded to the effect of the reference drug piracetam. These effects were probably caused by modulation of hippocampal activity.
Lupus vulgaris in a young girl.
Goyal, Tarang; Varshney, Anupam; Bakshi, S K
2013-01-01
With the estimated global burden of TB being 8.8 million incident cases and 1.1 million deaths from TB in HIV-negative cases and additional 0.35 million deaths in HIV-associated cases,1 the total number of cutaneous TB cases ( lupus vulgaris in a young girl with rapid progression of a large plaque with hypertrophic features in the periphery. The case is unusual due to its rapid progression, unusual site and extensive giant form which have never been reported previously.
Annular Lupus Vulgaris Mimicking Tinea Cruris
Heo, Young Soo; Shin, Won Woong; Kim, Yong Ju; Song, Hae Jun
2010-01-01
Cutaneous tuberculosis is an infrequent form of extrapulmonary tuberculosis. It is often clinically and histopathologically confused with various cutaneous disorders. A 36-year-old man attended our clinic with slowly progressive, asymptomatic, annular skin lesions on both the thighs and buttocks for 10 years. He consulted with many physicians and was improperly treated with an oral antifungal agent for several months under the diagnosis of tinea cruris, but no resolution of his condition was observed. A diagnosis of lupus vulgaris was made based on the histopathologic examination and the polymerase chain reaction assay. Anti-tuberculosis therapy was administered and the lesions started to regress. PMID:20548922
Disseminated lupus vulgaris: a case report.
Can, Burce; Zindanci, Ilkin; Turkoglu, Zafer; Kavala, Mukaddes; Ulucay, Vasfiye; Demir, Filiz Topaloglu
2014-01-01
Lupus vulgaris is a secondary form of cutaneous tuberculosis which persists for years if not treated. The head and neck are the most commonly affected sites. While less frequently arms and legs, and rarely the trunk and the scalp are involved. Herein, we describe a 73-year-old man with a 5-year history of slowly growing, atrophic, some eroded and ulcerated, red-brown plaques on his forehead, nose, cheeks, ear lobes, trunk and extremites. All of his disseminated lesions healed after antituberculosis therapy.
Evaluation of active oxygen effect on photosynthesis of Chlorella vulgaris.
Hirayama, S; Ueda, R; Sugata, K
1996-09-01
The relationship between O2 and an active oxygen scavenging system in Chlorella vulgaris var.vulgaris (IAM C-534) was investigated. When Chlorella vulgaris was exposed to 2% O2, only traces of active oxygen scavenging enzymes were found. When the Chlorella vulgaris was treated with 20% or 50% O2, it was shown that the level of enzyme activity increased as the O2 concentration increased. An increase in enzyme activity was not found in any specific enzyme but in all of the enzymes, but the level of glutathione and ascorbate remained the same in all the cases. In addition, the photosynthetic efficiency also decreased as the concentration of O2 was increased. These results suggest that an O2 enriched environment can lead to an increase in the production of active oxygen species such as O2.- and H2O2 and to a decrease in the photosynthetic efficiency in Chlorella vulgaris. The hydroxyl radical (.OH) was detected directly in the Chlorella vulgaris suspension with a spin trapping reagent. It was also clear that the increase in the .OH intensity as the visible light intensity increased was unrelated to the O2 concentration. It was suggested that the conditions for producting .OH and the other active oxygen species were different, and that two types of oxygen stress should exist in the Chlorella vulgaris.
Lupus vulgaris: unusual presentation on face.
Pilani, A; Vora, R V
2014-01-01
Lupus vulgaris is a variant of cutaneous tuberculosis. As the disease has potential to mutilate when left untreated, leaving deforming scars and disfigurement, an early diagnosis is of paramount importance. Though the common type is plaque type, rarely mutilating and vegetative forms also are found. A 28 year old female, labourer presented with progressive annular plaque over right side of cheek extending upto right lower lid and ala of nose. There were two satellite plaques near the right side of giant lesion. On diascopy apple jelly nodule was seen. There was no regional lymhadenopathy. Histopathological examination showed many granulomas in upper dermis extending to deep dermis comprising of epitheloid cells with langhans' type of giant cells, lymphocytic infiltration & focal necrosis suggestive of lupus vulgaris. The consequences of failing to make an early diagnosis can be disastrous for the patients, as the progression of the disease can lead to necrosis, destruction of bones and cartilage leading to permanent deformity. Thus it is vital for clinicians to have a high index of suspicion of such atypical forms and take biopsy samples for histological and bacteriological studies.
[Microstructural changes in hardened beans (Phaseolus vulgaris)].
Mujica, Maria Virginia; Granito, Marisela; Soto, Naudy
2015-06-01
(Phaseolus vulgaris). The hardening of Phaseolus vulgaris beans stored at high temperature and high relative humidity is one of the main constraints for consumption. The objective of this research was to evaluate by scanning electron microscopy, structural changes in cotyledons and testa of the hardened beans. The freshly harvested grains were stored for twelve months under two conditions: 5 ° C-34% RH and 37 ° C-75% RH, in order to promote hardening. The stored raw and cooked grains were lyophilized and fractured. The sections of testa and cotyledons were observed in an electron microscope JSM-6390. After twelve months, grains stored at 37 ° C-75% RH increased their hardness by 503%, whereas there were no significant changes in grains stored at 5 ° C-34% RH. At the microstructural level, the cotyledons of the raw grains show clear differences in appearance of the cell wall, into the intercellular space size and texture matrix protein. There were also differences in compaction of palisade and sub-epidermal layer in the testa of raw grains. After cooking, cotyledon cells of the soft grains were well separated while these ofhard grains were seldom separated. In conclusion, the found differences in hard and soft grains showed a significant participation of both structures, cotyledons and testa, in the grains hardening.
Calcinosis cutis secondary to facial acne vulgaris: A rare complication
Directory of Open Access Journals (Sweden)
Srimanta Kumar Sahu
2015-01-01
Full Text Available Acne vulgaris is a common dermatological disease commonly affecting the adolescent and young adults. It is characterized by the presence of pleomorphic skin lesions such as comadones, papules, pustules, and nodules. The common complications are postacne hyperpigmentation and scarring causing psychological impact. Calcinosis cutis is the pathologic deposition of insoluble calcium salt in the skin and subcutaneous tissue. Calcinosis cutis following acne vulgaris is rarely reported in the literature. We report a case of calcinosis cutis in acne vulgaris in a 55-year-old man.
[Study on chemical constituents of Citrullus vulgaris Schrad vine (II)].
Gong, Xiao-Mei; Wang, Shuo; Zhou, Xiao-Lei; Zhou, Dan-Dan; Dai, Hang; Deng, Jia-Gang
2013-10-01
To study the chemical constituents of ethyl acetate fraction of Citrullus vulgaris Schrad vine. Compounds were isolated and purified by polyamide column chromatography, silica gel column chromatography, thin layer chromatography and sephadex gel column chromatography. Their structures were elucidated on the basis of physicochemical properties and spectral data. Ten compounds were isolated from Citrullus vulgaris Schrad vine and elucidated as: pentadecanoic acid (1), monopentadecanoin (2), 2, 3-dihydroxypropyl nonadecoate (3), lignoceric acid-2, 3-dihydroxy-propanenyl ester (4), lancerebroside 5 (5), salicylic acid (6), 4-hydroxybenzoic acid (7), hydroquinone (8), succinic acid (9) and vanillic acid (10). Compounds 1 - 10 are obtained from Citrullus vulgaris Schrad vine for the first time.
Vascular cognitive impairment in Pemphigus vulgaris: a case report
Directory of Open Access Journals (Sweden)
José Ibiapina Siqueira- Neto
Full Text Available ABSTRACT Pemphigus vulgaris is a systemic auto-immune medical condition that mainly manifests with changes in skin and vasculopathy. This is a case report of a 69-year-old male with confirmed histopathologic diagnosis of Pemphigus vulgaris presenting ulterior Cognitive Impairment, mostly in executive function. The patient was treated using steroids, immunomodulatory therapy, fluoxetine and galantamine. Neuropsychological testing and magnetic resonance (MRI were performed. This is the first report of correlational cognitive impairment with Pemphigus vulgaris in the literature. Physicians should be aware of vascular causes for cognitive impairment in patients presenting auto-immune conditions.
Propionibacterium acnes in the pathogenesis and immunotherapy of acne vulgaris.
Liu, Pei-Feng; Hsieh, Yao-Dung; Lin, Ya-Ching; Two, Aimee; Shu, Chih-Wen; Huang, Chun-Ming
2015-01-01
Acne vulgaris, a multi-factorial disease, is one of the most common skin diseases, affecting an estimated 80% of Americans at some point during their lives. The gram-positive and anaerobic Propionibacterium acnes (P. acnes) bacterium has been implicated in acne inflammation and pathogenesis. Therapies for acne vulgaris using antibiotics generally lack bacterial specificity, promote the generation of antibiotic-resistant bacterial strains, and cause adverse effects. Immunotherapy against P. acnes or its antigens (sialidase and CAMP factor) has been demonstrated to be effective in mice, attenuating P. acnes-induced inflammation; thus, this method may be applied to develop a potential vaccine targeting P. acnes for acne vulgaris treatment. This review summarizes reports describing the role of P. acnes in the pathogenesis of acne and various immunotherapy-based approaches targeting P. acnes, suggesting the potential effectiveness of immunotherapy for acne vulgaris as well as P. acnes-associated diseases.
Fatty acids composition of microalgae Chlorella vulgaris can be ...
African Journals Online (AJOL)
Fatty acids composition of microalgae Chlorella vulgaris can be modulated by varying carbon dioxide concentration in outdoor culture. YAM Yusof, JMH Basari, NA Mukti, R Sabuddin, AR Muda, S Sulaiman, S Makpol, WZW Ngah ...
Effects of Kidney Bean, Phaseolus vulgaris Meal on the Growth ...
African Journals Online (AJOL)
, Oreochromis niloticus (mean weight 1.36 + 0.05 g) fed diets containing varying levels of the kidney bean, Phaseolus vulgaris were investigated under laboratory conditions. The kidney bean was incorporated at separate levels of 60, 40, ...
Performance of climber common bean (Phaseolus vulgaris L.) lines ...
African Journals Online (AJOL)
STORAGESEVER
2009-06-03
pathogen co-adaptation in Malawi. Proceed- ings of Bean/Cowpea CRSP Eastern African Regionalisation. Workshop, Lilongwe, p. 7. Mloza Banda HR, Ferguson AE, Mkandawire ABC (2003). The common bean (Phaseolus vulgaris ...
Antifertility activity of Artemisia vulgaris leaves on female Wistar rats.
Shaik, Afsar; Kanhere, Rupesh S; Cuddapah, Rajaram; Nelson, Kumar S; Vara, Prasanth Reddy; Sibyala, Saisaran
2014-03-01
To evaluate the antifertility activity of Artemisia vulgaris leaves on female Wistar rats. The plant extract was tested for its effect on implant formation at two dose levels, 300 and 600 mg·kg⁻¹, respectively. The effective methanolic plant extract was further studied for estrogenic potency on ovariectomised immature female Wistar rats. The data presented in this study demonstrate the antifertility potential of Artemisia vulgaris methanolic leaf extract, which shows a strong and significant decrease in implant formation (100%), and a strong estrogenic effect resulting in a significant increase in uterine weight in immature ovariectomised rats. These observations suggest that the methanolic extract of Artemisia vulgaris leaves has strong anti-implantation activity and estrogenic activity. The methanolic plant extract of A. vulgaris has antifertility activity. Copyright © 2014 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.
Hepatoprotective activity of Thymus vulgaris extract against Toxoplasma gondii infection
Directory of Open Access Journals (Sweden)
Nagwa Mostafa El-Sayed
2017-05-01
Full Text Available Objective: To evaluate the hepatoprotective activity of Thymus vulgaris (T. vulgaris extract against Toxoplasma gondii (T. gondii infection in experimentally infected mice. Methods: Sixty mice were divided into six groups (Group I–Group VI. Group I was normal control (non-infected, non-treated; Group II was non-infected and treated with T. vulgaris extract (500 mg/kg; Group III was T. gondii infected-non-immunosuppressed control; Group IV consisted of infected immunosuppressed mice; Group V was infected and treated with T. vulgaris extract; Group VI consisted of infected immunosuppressed mice treated with T. vulgaris extract. Hepatoprotective effect of T. vulgaris extract was evaluated by histopathological examination of tissue sections stained with hematoxylin and eosin, determination of liver function parameters (alanine aminotransaminase, aspartate aminotransaminase and alkaline phosphates, total bilirubin, total protein concentrations and assessment of hepatocytes genotoxicity by comet assay.Antigenotoxic effect of T. vulgaris was assessed by several comet assay parameters that were provided by the image analysis software, including % tailed cells, % of DNA in the tail, tail length, and tail moment. Results: Treatment with T. vulgaris in both Groups V and VI improved T. gondii induced pathological lesions in the infected liver that regressed to near the normal picture especially in Group V. Also, it restored the altered values of liver function parameters near to the normal levels significantly (P < 0.05 compared with Groups III and IV respectively. Regarding comet assay parameters, all of them were significantly increased (P < 0.05 after T. gondii infection (Group III and reached the greatest values in infected immunosuppressed group (Group IV compared to the normal controls (Group I. With treatment by T. vulgaris in Groups V and VI, there was a significant decrease (P < 0.05 in all values compared to Groups III and V respectively. The
Pemphigus vulgaris and laser therapy: Crucial role of dentists
Pavlić Verica; Vujić-Aleksić Vesna; Zubović Nina; Veselinović Valentina
2014-01-01
Introduction. Pemphigus vulgaris is a relatively rare, chronic, autoimmune vesiculobullous disorder characterized by formation of intraepithelial vesiculae and/or bullae in the skin and mucous membrane. Systemic steroids are considered to be the standard first-line therapy for pemphigus vulgaris. However, for patients unresponsive to standard therapy, the new treatment modalities are being sought. Low-level laser therapy has been accepted as an alternative ...
Lupus vulgaris of external nose--a case report.
Arunkumar, J S; Naveen, K N; Prasad, K C; Santhosh, S G; Hegde, J S
2013-02-01
Lupus vulgaris is the most common morphological variant of cutaneous tuberculosis accounting for approximately 59% of cases of cutaneous tuberculosis in India. We present a case of lupus vulgaris of external nose diagnosed early and treated with CAT-3 RNTCP regimen for six months without any nasal deformity except for a small scar over the dorsum of the nose. Patient followed up for one year after completion of the prescribed regimen, there being no recurrence of the lesion.
Pemphigus vulgaris with significant periodontal findings: a case report.
Pradeep, A R; Manojkumar, S Thorat; Arjun, Raju
2010-05-01
The purpose of this article is to report a case of pemphigus vulgaris associated with periodontitis (plaque-induced inflammation), and the role of a dermatologist and a periodontist in its management. This case reaffirms the fact that plaque control is the most important procedure in preventing periodontal infection in pemphigus vulgaris patients. These patients should be informed about the risk of periodontitis and encouraged to pursue long-term periodontal follow up to prevent their periodontal disease progression.
Novel techniques for enhancement and segmentation of acne vulgaris lesions.
Malik, A S; Humayun, J; Kamel, N; Yap, F B-B
2014-08-01
More than 99% acne patients suffer from acne vulgaris. While diagnosing the severity of acne vulgaris lesions, dermatologists have observed inter-rater and intra-rater variability in diagnosis results. This is because during assessment, identifying lesion types and their counting is a tedious job for dermatologists. To make the assessment job objective and easier for dermatologists, an automated system based on image processing methods is proposed in this study. There are two main objectives: (i) to develop an algorithm for the enhancement of various acne vulgaris lesions; and (ii) to develop a method for the segmentation of enhanced acne vulgaris lesions. For the first objective, an algorithm is developed based on the theory of high dynamic range (HDR) images. The proposed algorithm uses local rank transform to generate the HDR images from a single acne image followed by the log transformation. Then, segmentation is performed by clustering the pixels based on Mahalanobis distance of each pixel from spectral models of acne vulgaris lesions. Two metrics are used to evaluate the enhancement of acne vulgaris lesions, i.e., contrast improvement factor (CIF) and image contrast normalization (ICN). The proposed algorithm is compared with two other methods. The proposed enhancement algorithm shows better result than both the other methods based on CIF and ICN. In addition, sensitivity and specificity are calculated for the segmentation results. The proposed segmentation method shows higher sensitivity and specificity than other methods. This article specifically discusses the contrast enhancement and segmentation for automated diagnosis system of acne vulgaris lesions. The results are promising that can be used for further classification of acne vulgaris lesions for final grading of the lesions. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Essential Oil Characterization of Thymus vulgaris from Various Geographical Locations
Directory of Open Access Journals (Sweden)
Prabodh Satyal
2016-10-01
Full Text Available Thyme (Thymus vulgaris L. is a commonly used flavoring agent and medicinal herb. Several chemotypes of thyme, based on essential oil compositions, have been established, including (1 linalool; (2 borneol; (3 geraniol; (4 sabinene hydrate; (5 thymol; (6 carvacrol, as well as a number of multiple-component chemotypes. In this work, two different T. vulgaris essential oils were obtained from France and two were obtained from Serbia. The chemical compositions were determined using gas chromatography–mass spectrometry. In addition, chiral gas chromatography was used to determine the enantiomeric compositions of several monoterpenoid components. The T. vulgaris oil from Nyons, France was of the linalool chemotype (linalool, 76.2%; linalyl acetate, 14.3%; the oil sample from Jablanicki, Serbia was of the geraniol chemotype (geraniol, 59.8%; geranyl acetate, 16.7%; the sample from Pomoravje District, Serbia was of the sabinene hydrate chemotype (cis-sabinene hydrate, 30.8%; trans-sabinene hydrate, 5.0%; and the essential oil from Richerenches, France was of the thymol chemotype (thymol, 47.1%; p-cymene, 20.1%. A cluster analysis based on the compositions of these essential oils as well as 81 additional T. vulgaris essential oils reported in the literature revealed 20 different chemotypes. This work represents the first chiral analysis of T. vulgaris monoterpenoids and a comprehensive description of the different chemotypes of T. vulgaris.
Changes in serum desnutrin levels in patients with acne vulgaris.
Demir, Betul; Ucak, Haydar; Cicek, Demet; Aydin, Suleyman; Erden, Ilker; Dertlioglu, Selma Bakar
2014-01-01
Androgens and insulin may contribute to increased sebum production in the pathogenesis of acne vulgaris. We investigated the association between serum desnutrin levels and acne vulgaris in the pathogenesis of insulin resistance. 25 patients presenting with acne vulgaris and 25 control subjects participated in this study. Fasting blood glucose, triglycerides, LDL, VLDL, HDL, total cholesterol, insulin, C-peptide and thyroid function tests were measured. The homeostasis model assessment of insulin resistance (HOMA-IR) was used to calculate insulin resistance. Desnutrin levels were determined by enzyme-linked immunosorbent assay (ELISA) according to the manufacturer's protocol. Patients with acne vulgaris had a mean serum desnutrin level of (8.83 ± 1.13 μIU/mL), which was statistically significantly lower in the control group (10:58 ± 3.43 μIU/mL). In patients with acne vulgaris the serum glucose levels, insulin levels and HOMA-IR values (87.92 ± 7:46 mg/dL, 11.33 ± 5.93 μIU/mL, 2.49 ± 1.40, respectively) were significantly higher than the control group (77.36 ± 9.83 mg/dL, 5.82 ± 2.68 μIU/mL, 1.11 ± 0.51, respectively) (p = 0.01, pacne vulgaris, as a result of increased levels of serum glucose and insulin, the function of desnutrin was suppressed, perhaps contributing to insulin resistance.
Essential Oil Characterization of Thymus vulgaris from Various Geographical Locations
Satyal, Prabodh; Murray, Brittney L.; McFeeters, Robert L.; Setzer, William N.
2016-01-01
Thyme (Thymus vulgaris L.) is a commonly used flavoring agent and medicinal herb. Several chemotypes of thyme, based on essential oil compositions, have been established, including (1) linalool; (2) borneol; (3) geraniol; (4) sabinene hydrate; (5) thymol; (6) carvacrol, as well as a number of multiple-component chemotypes. In this work, two different T. vulgaris essential oils were obtained from France and two were obtained from Serbia. The chemical compositions were determined using gas chromatography–mass spectrometry. In addition, chiral gas chromatography was used to determine the enantiomeric compositions of several monoterpenoid components. The T. vulgaris oil from Nyons, France was of the linalool chemotype (linalool, 76.2%; linalyl acetate, 14.3%); the oil sample from Jablanicki, Serbia was of the geraniol chemotype (geraniol, 59.8%; geranyl acetate, 16.7%); the sample from Pomoravje District, Serbia was of the sabinene hydrate chemotype (cis-sabinene hydrate, 30.8%; trans-sabinene hydrate, 5.0%); and the essential oil from Richerenches, France was of the thymol chemotype (thymol, 47.1%; p-cymene, 20.1%). A cluster analysis based on the compositions of these essential oils as well as 81 additional T. vulgaris essential oils reported in the literature revealed 20 different chemotypes. This work represents the first chiral analysis of T. vulgaris monoterpenoids and a comprehensive description of the different chemotypes of T. vulgaris. PMID:28231164
Chlorella vulgaris: A Multifunctional Dietary Supplement with Diverse Medicinal Properties.
Panahi, Yunes; Darvishi, Behrad; Jowzi, Narges; Beiraghdar, Fatemeh; Sahebkar, Amirhossein
2016-01-01
Chlorella vulgaris is a green unicellular microalgae with biological and pharmacological properties important for human health. C. vulgaris has a long history of use as a food source and contains a unique and diverse composition of functional macro- and micro-nutrients including proteinsChlorella vulgaris is a green unicellular microalgae with biological and pharmacological properties important for human health. C. vulgaris has a long history of use as a food source and contains a unique and diverse composition of functional macro- and micro-nutrients including proteins, omega-3 polyunsaturated fatty acids, polysaccharides, vitamins and minerals. Clinical trials have suggested that supplementation with C. vulgaris can ameliorate amelioration hyperlipidemia and hyperglycemia, and protect against oxidative stress, cancer and chronic obstructive pulmonary disease. In this review, we summarize the findings on the health benefits of Chlorella supplementation and the molecular mechanisms underlying these effects., omega-3 polyunsaturated fatty acids, polysaccharides, vitamins and minerals. Clinical trials have suggested that supplementation with C. vulgaris can ameliorate amelioration hyperlipidemia and hyperglycemia, and protect against oxidative stress, cancer and chronic obstructive pulmonary disease. In this review, we summarize the findings on the health benefits of Chlorella supplementation and the molecular mechanisms underlying these effects.
Pemphigus Vulgaris and Infections: A Retrospective Study on 155 Patients
Directory of Open Access Journals (Sweden)
Nafiseh Esmaili
2013-01-01
Full Text Available Background. Autoimmune process and immunosuppressive therapy of pemphigus vulgaris would predispose the patients to infections. Aim. We aimed to study the prevalence of infection and pathogenic agents in pemphigus vulgaris patients admitted to dermatology service. Material and methods. This retrospective study was conducted on 155 pemphigus vulgaris patients (68 males, 87 females admitted to dermatology service between 2009 and 2011. In this study, the diagnosis of pemphigus vulgaris was confirmed by light microscopic and direct immunofluorescence findings. Data were collected through a questionnaire. Results. Of 155 pemphigus vulgaris patients, 33 had infection at admission and 9 acquired nosocomial infection. In addition, 37 cases of oral candidiasis and 15 cases of localized herpes simplex were recorded. Totally, 94 cases of infection were recorded. The occurrence of infection was significantly related to the severity of disease, number of hospital admissions, and presence of diabetes mellitus. The most common pathogenic germs isolated from cultures were Staphylococcus aureus and Escherichia coli. Conclusion. Severity of pemphigus vulgaris and diabetes were directly related with tendency to infections. Staphylococcus aureus and Escherichia coli were the most common pathogenic agents. Due to limitations of retrospective study, a prospective study is recommended.
Oral gugulipid in acne vulgaris management
Directory of Open Access Journals (Sweden)
Jaideep Dogra
1990-01-01
Full Text Available Gugulipid is the standardized extract of the oleo-resin of Commiphora mukul (Burseraceace an Indian medicinal plant. The active ingredients are two guggulsterones Z and E. Gugulipid is an effective hypolipidemic agent, has a marked antilipolytic activity in rats. Considering the pathogenesis of acne vulgaris and the pharmacological properties of Gugulipid this trial was initiated. Thirty patients with moderate to severe acne ( Grade 4 were included in this study. Tab Guglip was prescribed in tds dosage for 6 weeks. Excellent, good and moderate response was seen in nine (30% fourteen (46.66% and seven (23.33% patients respectively out of the total thirty. No topical treatment was recommended except for local skin -hygiene. The drug showed excellent tolerance. Only three patients (10% reported relapse when examined at 3 months follow up.
Role of olfaction in Octopus vulgaris reproduction.
Polese, Gianluca; Bertapelle, Carla; Di Cosmo, Anna
2015-01-01
The olfactory system in any animal is the primary sensory system that responds to chemical stimuli emanating from a distant source. In aquatic animals "Odours" are molecules in solution that guide them to locate food, partners, nesting sites, and dangers to avoid. Fish, crustaceans and aquatic molluscs possess sensory systems that have anatomical similarities to the olfactory systems of land-based animals. Molluscs are a large group of aquatic and terrestrial animals that rely heavily on chemical communication with a generally dispersed sense of touch and chemical sensitivity. Cephalopods, the smallest class among extant marine molluscs, are predators with high visual capability and well developed vestibular, auditory, and tactile systems. Nevertheless they possess a well developed olfactory organ, but to date almost nothing is known about the mechanisms, functions and modulation of this chemosensory structure in octopods. Cephalopod brains are the largest of all invertebrate brains and across molluscs show the highest degree of centralization. The reproductive behaviour of Octopus vulgaris is under the control of a complex set of signal molecules such as neuropeptides, neurotransmitters and sex steroids that guide the behaviour from the level of individuals in evaluating mates, to stimulating or deterring copulation, to sperm-egg chemical signalling that promotes fertilization. These signals are intercepted by the olfactory organs and integrated in the olfactory lobes in the central nervous system. In this context we propose a model in which the olfactory organ and the olfactory lobe of O. vulgaris could represent the on-off switch between food intake and reproduction. Copyright © 2014 Elsevier Inc. All rights reserved.
Phototherapy in the treatment of acne vulgaris.
Sami, Nevien A; Attia, Abeer T; Badawi, Ashraf M
2008-07-01
Achieving an effective management of acne vulgaris with minimal complications remains a difficult challenge for physicians. Moreover, the rise in antibiotic-resistant strains reduce the future usefulness of current mainstay therapies, and accordingly, the need for alternative therapies is mandatory. Phototherapy has been shown to be an effective treatment for acne, and there has been a renewed interest in photodynamic therapy as a treatment modality for this condition. To evaluate the effectiveness of pulsed dye laser (PDL), intense pulsed light (IPL) and light-emitting diode (LED) phototherapy for the treatment of moderate to severe acne vulgaris. Forty-five patients with moderate to severe acne were randomly divided into 3 equal groups. Group 1 was treated with a PDL, group 2 was treated with IPL, and group 3 was treated with a blue-red combination LED. Treatment was continued until a > or = 90% clearance of patient lesions was achieved. Clinical assessments were conducted before starting treatment, at 1 month as a midpoint evaluation, and after the final treatment session. Patients treated with the PDL reached a > or = 90% clearance of their inflammatory lesions after a mean of 4.1 +/- 1.39 sessions, while patients treated with IPL required a mean of 6 +/- 2.05 sessions. Patients treated with the LED required a mean of 10 +/- 3.34 sessions. At the mid-point evaluation, the percent reduction in acne lesions treated with the PDL was 90% or more, in cases of IPL and the LED, the percent reductions were 41.7% and 35.3%, respectively. Laser and light phototherapy sessions were well tolerated with minimal adverse events experienced as being mild and usually self-limiting. The encouraging results of the present study contributes evidence of phototherapy as useful therapeutic option for treatment of moderate to severe acne, and validates further studies to evaluate treatments with a larger number of patients and for a longer period of follow-up.
Directory of Open Access Journals (Sweden)
S. RUSINA
2003-06-01
Full Text Available The dry calcareous grassland vegetation of Westem and Central Latvia is described based on 93 rclevés, Ali relevés could be assigned to one community type Filipendula vulgaris-Helictotrichon pratense named according to dominant species. Four variants were distinguished: typicum, Viscaria vulgaris, Astragalus danicus and Carex flacca. Ellenberg indìcator values were calculated to study the ecology of communities. Floristic differences among variants are associated mainly with soil reaction (Ellenberg indicator values for soil pH range from 6.0 to 7.6, but conditions of moisture and fertility are similar among the variants. The calcareous grassland vegetation in Latvia represents transition vegetation between the c1asses Molinio-Arrhenatheretea and Festuco-Brometea. However, ecologically and floristically, these communities are closer to the class Festuco-Brometea and could be assigned to the order Brometalia. For designation to alliance and associations, more data is required. The results are compared with similar communities in other European countries.
Genetics, chemistry and ecology of a qualitative glucosinolate polymorphism in Barbarea vulgaris
Van Leur, H.
2008-01-01
Like many other plants, chemical defence compounds are involved in the defense of Barbarea vulgaris against natural enemies. Barbarea vulgaris produces glucosinolates, which are present in most crucifers such as cabbage, mustard, and the scientific model species Arabidopsis thaliana. Glucosinolates
Sim, M.; Ono, S.; Bosak, T.
2012-12-01
A large fraction of anaerobic mineralization of organic compounds relies on microbial sulfate reduction. Sulfur isotope fractionation by these microbes has been widely used to trace the biogeochemical cycling of sulfur and carbon, but intracellular mechanisms behind the wide range of fractionations observed in nature and cultures are not fully understood. In this study, we investigated the influence of electron transport chain components on the fractionation of sulfur isotopes by culturing Desulfovibrio vulgaris Hildenborough mutants lacking hydrogenases or type I tetraheme cytochrome c3 (Tp1-c3). The mutants were grown both in batch and continuous cultures. All tested mutants grew on lactate or pyruvate as the sole carbon and energy sources, generating sulfide. Mutants lacking cytoplasmic and periplasmic hydrogenases exhibited similar growth physiologies and sulfur isotope fractionations to their parent strains. On the other hand, a mutant lacking Tp1-c3 (ΔcycA) fractionated the 34S/32S ratio more than the wild type, evolving H2 in the headspace and exhibiting a lower specific respiration rate. In the presence of high concentrations of pyruvate, the growth of ΔcycA relied largely on fermentation rather than sulfate reduction, even when sulfate was abundant, producing the largest sulfur isotope effect observed in this study. Differences between sulfur isotope fractionation by ΔcycA and the wild type highlight the effect of electron transfer chains on the magnitude of sulfur isotope fractionation. Because Tp1-c3 is known to exclusively shuttle electrons from periplasmic hydrogenases to transmembrane complexes, electron transfers in the absence of Tp1-c3 should bypass the periplasmic hydrogen cycling, and the loss of reducing equivalents in the form of H2 can impair the flow of electrons from organic acids to sulfur, increasing isotope fractionation. Larger fractionation by ΔcycA can inform interpretations of sulfur isotope data at an environmental scale as well
Nitrogen and Phosphorus Biomass-Kinetic Model for Chlorella vulgaris in a Biofuel Production Scheme
2010-03-01
NITROGEN AND PHOSPHORUS BIOMASS-KINETIC MODEL FOR CHLORELLA VULGARIS IN A BIOFUEL PRODUCTION SCHEME THESIS William M. Rowley, Major...States Government. AFIT/GES/ENV/10-M04 NITROGEN AND PHOSPHORUS BIOMASS-KINETIC MODEL FOR CHLORELLA VULGARIS IN A BIOFUEL...MODEL FOR CHLORELLA VULGARIS IN A BIOFUEL PRODUCTION SCHEME William M. Rowley, BS Major, USMC Approved
[A revision of chiggers in the vulgaris group (Trombiculidae: Neotrombicula)].
Stekol'nikov, A A
1999-01-01
A revision of chigger mites species, being closely related to Neotrombicula vulgaris (Schluger, 1955), is given. 2 new species are described: N. aideriensis sp. n. from Western Kopetdagh and N. macrovulgaris sp. n. from Western Caucasus. N. aideriensis sp. n. differs from all other species of the vulgaris group by presence of single barb on the lateral seta of palpal tibia in most specimens. This species differs also from N. vulgaris by lesser width of scutum, shorter setae of scutum and idiosoma and by longer legs. N. macrovulgaris sp. n. differs from all other species of the vulgaris group by longer legs, more numerous idiosomal setae and by larger scutum. N. vulgaris is recorded for the first time in Bulgaria, Turkmenistan (western Kopet-Dag) and Krasnodar Territory, N. baschkirica Kudryashova, 1998--in Chuvashia, Kirov Province, Komi Republic and Tyumen' Province, N. kharadovi Kudryashova, 1998--in Russia (Altai Territory) and in Karaganda Province (Kazakhstan). The latter species is reported from several new hosts. Variation of morphometric parameters in the vulgaris group are investigated by the methods of multivariate analysis, the pattern of correlations between them is shown. A complex of diagnostic features in the group is revised. Discriminant functions produced by the computer program DIADIS (A. L. Lobanov, ZI RAS) allows to determine confidently representatives of the vulgaris group. Ecogeographical component of intraspecific variability and character variance at the specific level is revealed in vulgaris group. N. macrovulgaris characterized by the largest scutum, numerous setae and long legs was found in the most rigorous, cold and damp climate (alpine zone of western Caucasus). On the other hand, N. kharadovi, which have the most fine scutum and shortest setae, inhabits rather dry and warm Middle Asia and neighbouring territories. The sample of N. vulgaris collected in the steppe part of Stavropol' Territory differed from the material collected in
[Lupus vulgaris manifestation as a destructive nose and facial tumor].
Haller, D; Reisser, C
2009-04-01
Lupus vulgaris is the most frequent manifestation of cutaneous tuberculosis, but in Europe it is limited to isolated cases. Mainly immunocompetent individuals are affected by this result of an endogenous reinfection on a lymphogenous-less frequently hematogenous-pathway. Lupus vulgaris has been observed to develop in more than 50% of all patients who already suffer from other manifestations of tuberculosis. The development of a squamous cell carcinoma in the lupus vulgaris is a rare complication; therefore, lupus vulgaris is deemed a facultative precancerosis.A 68-year-old female Serbo-Croatian patient presented with an extensive ulcerative nose and facial tumor. Her anamnesis included a squamous cell carcinoma of the nose that had been excised alio loco 3 years before. Further examinations revealed enlarged cervical lymphoma on both sides, and pulmonary metastases were also suspected. The tumor biopsy revealed a necrotic, granulomatous inflammation. No acid-fast rods were seen on Ziehl-Neelsen stain. The tuberculous origin of this ulcerative skin tumor-the lupus vulgaris-as an endogenous reinfection of pulmonary tuberculosis manifestation was confirmed by the detection of Mycobacterium tuberculosis DNA in polymerase chain reaction and the growth of Mycobacterium tuberculosis colonies in the bacterial culture (skin biopsy and bronchial secretion). The skin tumor as well as the pulmonary manifestation were successfully treated with combined tuberculostatic therapy and showed a dramatic response within 3 months.
The complete chloroplast genome sequence of sugar beet (Beta vulgaris ssp. vulgaris).
Li, Han; Cao, Hua; Cai, Yan-Fei; Wang, Ji-Hua; Qu, Su-Ping; Huang, Xing-Qi
2014-06-01
The complete nucleotide sequence of the sugar beet (Beta vulgaris ssp. vulgaris) chloroplast genome (cpDNA) was determined in this study. The cpDNA was 149,637 bp in length, containing a pair of 24,439 bp inverted repeat regions (IR), which were separated by small and large single copy regions (SSC and LSC) of 17,701 and 83,057 bp, respectively. 53.4% of the sugar beet cpDNA consisted of gene coding regions (protein coding and RNA genes). The gene content and relative positions of 113 individual genes (79 protein encoding genes, 30 tRNA genes, 4 rRNA genes) were almost identical to those of tobacco cpDNA. The overall AT contents of the sugar beet cpDNA were 63.6% and in the LSC, SSC and IR regions were 65.9%, 70.8% and 57.8%, respectively. Fifteen genes contained one intron, while three genes had two introns.
ACNE VULGARIS TREATMENT : THE CURRENT SCENARIO
Rathi, Sanjay K
2011-01-01
Acne Vulgaris is one of the most common skin disorders which dermatologists have to treat. It mainly affect adolescent, though may present at any age. In recent years, due to better understanding of the pathogenesis of acne, new therapeutic modalities and various permutation and combinations have been designed. In topical agents; benzoyl peroxide, antibiotics, retinoids, etc are the mainstay of treatment; can be given in combinations. While systemic therapy includes oral antibiotics, hormonal therapy, and isotretinoin, depending upon the need of patients it has to be selected. Physical treatment in the form of lesion removal, photo-therapy is also helpful in few of them. Since various old and new topical and systemic agents are available to treat acne, it sometime confuse treating dermatologist. To overcome this, panel of physicians and researchers worked together as a global alliance and task force to improve outcomes in acne treatment. They have tried to give consensus recommendation for the treatment of acne. Successful management of acne needs careful selection of anti-acne agents according to clinical presentation and individual patient needs. PMID:21572783
Acne vulgaris treatment : The Current Scenario
Directory of Open Access Journals (Sweden)
Sanjay K Rathi
2011-01-01
Full Text Available Acne Vulgaris is one of the most common skin disorders which dermatologists have to treat. It mainly affect adolescent, though may present at any age. In recent years, due to better understanding of the pathogenesis of acne, new therapeutic modalities and various permutation and combinations have been designed. In topical agents; benzoyl peroxide, antibiotics, retinoids, etc are the mainstay of treatment; can be given in combinations. While systemic therapy includes oral antibiotics, hormonal therapy, and isotretinoin, depending upon the need of patients it has to be selected. Physical treatment in the form of lesion removal, photo-therapy is also helpful in few of them. Since various old and new topical and systemic agents are available to treat acne, it sometime confuse treating dermatologist. To overcome this, panel of physicians and researchers worked together as a global alliance and task force to improve outcomes in acne treatment. They have tried to give consensus recommendation for the treatment of acne. Successful management of acne needs careful selection of anti-acne agents according to clinical presentation and individual patient needs.
A review of phytotherapy of Acne vulgaris
Directory of Open Access Journals (Sweden)
Marija Glavas Dodov
2009-11-01
Full Text Available Acne vulgaris (acne is a cutaneous pleomorphic disorder of the pilosebaceous unit involving abnormalities in sebum production and is characterized by both inflammatory (papules, pustules and nodules and non-inflammatory (comedones, open and closed lesions. Propionibacterium acnes and Staphylococcus epidermidis are common pus-forming microbes responsible for the development of various forms of acne. This disease remains a common condition in industrialized societies, with many mainstream treatment options available. There are many acne products on the market, and making an appropriate selection can be daunting. Common therapies that are used for the treatment of acne include topical, systemic, hormonal, herbal and combination therapy. Topically used agents are benzoyl peroxide, antibiotics and retinoid. Systemically used agents are antibiotics and isotretinoin. However, all such treatments carry risks and none is completely satisfactory. Natural alternatives are gaining greater research support, and have much to offer clinically in this disorder. This review focuses primarily on herbal treatments for acne that show scientific evidence of clinical efficacy, as well as the more common herbs shown to be useful in the treatment of this dermatologic disorder.
Treatment of acne vulgaris in pregnant patients.
Pugashetti, Rupa; Shinkai, Kanade
2013-01-01
The management of acne vulgaris in the setting of pregnancy raises important clinical considerations regarding the efficacy and safety of acne treatments in this special patient population. Particular challenges include the absence of safety data, discrepancy in safety data between different safety rating systems, and lack of evidence-based recommendations for the treatment of acne during pregnancy. Nonetheless, many therapeutic options exist, and the treatment of acne in pregnant women can be safely and often effectively accomplished. For mild or moderate disease, patients can be treated with topical antimicrobial agents, anti-inflammatory agents, as well as glycolic and salicylic acid. Several topical agents, notably benzoyl peroxide, previously viewed as potentially dangerous are cited by many sources as being considered safe. When necessary, systemic therapies that can be safely added include penicillins, amoxicillin, cephalosporins, erythromycin, clindamycin, and tetracyclines or sulfonamides, depending on the stage of fetal development. Adjunct therapy may include phototherapy or laser treatments. Physicians should work with this often highly motivated, safety-conscious patient population to tailor an individualized treatment regimen. This treatment regimen will likely shift throughout the different stages of fetal development, as distinct safety considerations are raised prior to conception as well as during each of the trimesters of pregnancy. Important considerations regarding acne management in breast-feeding mothers is also discussed. © 2013 Wiley Periodicals, Inc.
Acne vulgaris in children and adolescents.
Schnopp, C; Mempel, M
2011-08-01
Acne vulgaris is a very common inflammatory skin disease originating from the pilosebaceous unit. Peak incidence is at puberty, but acne can affect all age groups. Prepubertal acne is rare, but important to recognize as diagnostic and therapeutic procedures differ from pubertal acne. Acne neonatorum is a mild, self-limiting disease, whereas acne infantum commonly presents with moderate to severe lesions and high risk of scarring thus requiring early intervention. Mid-childhood or prepubertal acne raises the suspicion of hyperandrogenemia, further investigations are indicated to rule out underlying disease. The same applies to any patient with very severe acne, acne not responding to therapy or unusual clinical presentation. Etiopathogenesis of acne is not yet fully understood. Familiy history is the most important risk factor to develop severe acne and scarring. The relevance of life style factors such as smoking or diet is controversial. Lately high carbohydrate diet and dairy products have been implicated as aggravating factors. Mild acne normally responds to topical monotherapy, in moderate disease combination of two synergistically acting substances (e.g. benzoyl peroxid plus antibiotic, benzoyl peroxid plus retinoid, retinoid plus antibiotic, benzoyl peroxid plus azelaic acid) will improve clinical response. Retinoids and/or benzoylperoxid have been shown to be effective in maintenance therapy. In patients with severe disease or high risk of scarring systemic therapy with antibiotics, oral contraceptives with antiandrogenic properties and in particularly isotretinoin as most effective acne treatment should be considered early to avoid physical and emotional scars.
Use of Chlorella vulgaris for bioremediation of textile wastewater.
Lim, Sing-Lai; Chu, Wan-Loy; Phang, Siew-Moi
2010-10-01
The potential application of Chlorella vulgaris UMACC 001 for bioremediation of textile wastewater (TW) was investigated using four batches of cultures in high rate algae ponds (HRAP) containing textile dye (Supranol Red 3BW) or TW. The biomass attained ranged from 0.17 to 2.26 mg chlorophyll a/L while colour removal ranged from 41.8% to 50.0%. There was also reduction of NH(4)-N (44.4-45.1%), PO(4)-P (33.1-33.3%) and COD (38.3-62.3%) in the TW. Supplementation of the TW with nutrients of Bold's Basal Medium (BBM) increased biomass production but did not improve colour removal or reduction of pollutants. The mechanism of colour removal by C. vulgaris is biosorption, in accordance with both the Langmuir and Freundlich models. The HRAP using C. vulgaris offers a good system for the polishing of TW before final discharge. Copyright 2010 Elsevier Ltd. All rights reserved.
An Atlas of annotations of Hydra vulgaris transcriptome.
Evangelista, Daniela; Tripathi, Kumar Parijat; Guarracino, Mario Rosario
2016-09-22
RNA sequencing takes advantage of the Next Generation Sequencing (NGS) technologies for analyzing RNA transcript counts with an excellent accuracy. Trying to interpret this huge amount of data in biological information is still a key issue, reason for which the creation of web-resources useful for their analysis is highly desiderable. Starting from a previous work, Transcriptator, we present the Atlas of Hydra's vulgaris, an extensible web tool in which its complete transcriptome is annotated. In order to provide to the users an advantageous resource that include the whole functional annotated transcriptome of Hydra vulgaris water polyp, we implemented the Atlas web-tool contains 31.988 accesible and downloadable transcripts of this non-reference model organism. Atlas, as a freely available resource, can be considered a valuable tool to rapidly retrieve functional annotation for transcripts differentially expressed in Hydra vulgaris exposed to the distinct experimental treatments. WEB RESOURCE URL: http://www-labgtp.na.icar.cnr.it/Atlas .
Lupus vulgaris in a pediatric patient: a clinicohistopathological diagnosis.
Afsar, F Sule; Afsar, Ilhan; Diniz, Gulden; Asilsoy, Suna; Sorguc, Yelda
2008-04-01
Lupus vulgaris is the most common form of cutaneous tuberculosis which usually occurs in patients previously sensitized to Mycobacterium tuberculosis. We present a case of a 10-year-old boy who was diagnosed as lupus vulgaris clinically and histopathologically. He had well demarcated, irregularly bordered, pink, infiltrated plaques on his left cheek showing apple-jelly appearance on diascopy. The histopathological examination showed tuberculoid granulomas with Langhans type giant cells. The Mantoux reactivity was in normal limits, and no acid-fast bacilli was found in the lesion, either by direct stained smears or by culture. The lesions showed marked improvement on anti-tuberculosis treatment. We want to emphasize that histopathological examination has diagnostic value in lupus vulgaris in correlation with clinical appearance, when direct analysis or culture is negative.
Lupus vulgaris occurring in a locus minoris resistentiae.
Long, Richard; Beatch, Anita; Lee, Mao-Cheng; Cheung-Lee, Melody; Wasel, Norman
2009-01-01
The pathogenesis of lupus vulgaris, a form of cutaneous tuberculosis, is not always clear, especially in patients who do not have coexistent extracutaneous tuberculosis and in patients with single lesions. To report a case of lupus vulgaris in a locus minoris resistentiae (a site of reduced resistance) and to use a unique set of clinical circumstances and laboratory tests to reconstruct the pathogenesis of the lesion and the response to treatment. Lupus vulgaris can occur in a locus minoris resistentiae; local trauma and possibly other factors, such as increased temperature, topical corticosteroids, and the virulence of the infecting strain, may facilitate the growth of Mycobacterium tuberculosis present at a locus minoris resistentiae as a result of a silent bacillemia.
Lupus vulgaris in a pediatric patient: a clinicohistopathological diagnosis
Directory of Open Access Journals (Sweden)
F. Sule Afsar
Full Text Available Lupus vulgaris is the most common form of cutaneous tuberculosis which usually occurs in patients previously sensitized to Mycobacterium tuberculosis. We present a case of a 10-year-old boy who was diagnosed as lupus vulgaris clinically and histopathologically. He had well demarcated, irregularly bordered, pink, infiltrated plaques on his left cheek showing apple-jelly appearance on diascopy. The histopathological examination showed tuberculoid granulomas with Langhans type giant cells. The Mantoux reactivity was in normal limits, and no acid-fast bacilli was found in the lesion, either by direct stained smears or by culture. The lesions showed marked improvement on anti-tuberculosis treatment. We want to emphasize that histopathological examination has diagnostic value in lupus vulgaris in correlation with clinical appearance, when direct analysis or culture is negative.
Transcriptome analysis of the Octopus vulgaris central nervous system.
Directory of Open Access Journals (Sweden)
Xiang Zhang
Full Text Available BACKGROUND: Cephalopoda are a class of Mollusca species found in all the world's oceans. They are an important model organism in neurobiology. Unfortunately, the lack of neuronal molecular sequences, such as ESTs, transcriptomic or genomic information, has limited the development of molecular neurobiology research in this unique model organism. RESULTS: With high-throughput Illumina Solexa sequencing technology, we have generated 59,859 high quality sequences from 12,918,391 paired-end reads. Using BLASTx/BLASTn, 12,227 contigs have blast hits in the Swissprot, NR protein database and NT nucleotide database with E-value cutoff 1e(-5. The comparison between the Octopus vulgaris central nervous system (CNS library and the Aplysia californica/Lymnaea stagnalis CNS ESTs library yielded 5.93%/13.45% of O. vulgaris sequences with significant matches (1e(-5 using BLASTn/tBLASTx. Meanwhile the hit percentage of the recently published Schistocerca gregaria, Tilapia or Hirudo medicinalis CNS library to the O. vulgaris CNS library is 21.03%-46.19%. We constructed the Phylogenetic tree using two genes related to CNS function, Synaptotagmin-7 and Synaptophysin. Lastly, we demonstrated that O. vulgaris may have a vertebrate-like Blood-Brain Barrier based on bioinformatic analysis. CONCLUSION: This study provides a mass of molecular information that will contribute to further molecular biology research on O. vulgaris. In our presentation of the first CNS transcriptome analysis of O. vulgaris, we hope to accelerate the study of functional molecular neurobiology and comparative evolutionary biology.
A review of adapalene in the treatment of acne vulgaris.
Irby, Cynthia E; Yentzer, Brad A; Feldman, Steven R
2008-11-01
Topical retinoids help address the early lesions of acne vulgaris. Consensus guidelines advocate the use of topical retinoids as the primary treatment for most forms of acne vulgaris. However, all topical retinoid preparations may be irritating, and this may contribute to underutilization in clinical practices. Topical adapalene fosters topical retinoid treatment of acne with less irritation. Adapalene is a more stable molecule than tretinoin. Adapalene can be used without concern for photo-deactivation. Because of its chemical stability, adapalene can be used in combination with benzoyl peroxide products. The availability of a stable topical retinoid associated with little irritation may facilitate meeting acne treatment consensus guidelines.
Acne Vulgaris and Acne Rosacea: An Update in Etiopathogenesis
Directory of Open Access Journals (Sweden)
Ozlem Ekiz
2014-04-01
Full Text Available Acne vulgaris is a chronic inflammatory disease of the pilosebaceous unit, characterized by comedones, papules, pustules, nodules, and scars rarely. The major pathogenic factors are abnormal follicular differentiation and increased ductal cornification, abnormal activity of sebaceous glands, microbial colonization of pilosebaceous units by Propionibacterium acnes and inflammation. Rosacea is a common, chronic inflammatory relapsing skin disorder of the central area of the face characterized by transient or persistent erythema, telangiectasia, papules and pustules. Although several hypotheses have been suggested for the etiopathogenesis of rosacea, the exact etiology is still unknown. In this review, we tried to summarize up-to-date information about etiopathogenesis of acne vulgaris and rosocea.
Coincident systemic lupus erythematosus and psoriasis vulgaris: a case report.
Wang, Y; Da, G; Yu, Y; Han, J; Li, H
2015-12-01
Psoriasis vulgaris is an autoimmune chronic inflammatory skin disease, but its association with other typical autoimmune disease such as systemic lupus erythematosus has only occasionally been reported. We presented a 25-year-old female who developed systemic lupus erythematosus associated with psoriasis vulgaris. Her conditions were in good control after she got administration of prednisolone (5 mg/day) and Tripterygium Wilfordii Hook (20 mg/day). It is necessary to integrate past history and physical examination to diagnose coincident SLE and psoriasis, and combined treatment with prednisolone and Tripterygium Wilfordii Hook proves effective.
The Development of Olfactory Organ of Lissotriton Vulgaris (Amphibia, Caudata
Directory of Open Access Journals (Sweden)
Kovtun M. F.
2015-12-01
Full Text Available The Development of Olfactory Organ of Lissotriton vulgaris (Amphibia, Caudata. Kovtun, M. F, Stepanyuk, Ya. V. - Using common histological methods, the morphogenesis of olfactory analyzer peripheral part of Lissotriton vulgaris (Amphibia, Caudata was studied, during the developmental period starting with olfactory pit laying and finishing with definitive olfactory organ formation. Special attention is paid to vomeronasal organ and vomeronasal gland development. Reasoning from obtained data, we consider that vomeronasal organ emerged as the result of olfactory epithelium and nasal cavity differentiation.
The dual nature of Interleukin-10 in pemphigus vulgaris
Cho, Michael Jeffrey; Ellebrecht, Christoph T.; Payne, Aimee S.
2014-01-01
The immunomodulatory cytokine interleukin-10 (IL-10) plays beneficial but also potentially detrimental roles in inflammation, infection, and autoimmunity. Recent studies suggest a regulatory role for IL-10-expressing B cells in the autoimmune blistering disease pemphigus vulgaris. Here we review the studies on IL-10 in pemphigus vulgaris and discuss the potential pathophysiological significance of these findings in comparison to prior studies of IL-10 in other human conditions. A better understanding of the complex roles of IL-10 in immune regulation may improve our understanding of pemphigus pathogenesis and treatment. PMID:25464924
SEZARY SYNDROME MIMICKING GENERALIZED PSORIASIS VULGARIS
Directory of Open Access Journals (Sweden)
Eko Rianova Lynoora
2016-09-01
Full Text Available Sezary syndrome is the leukemic variant of cutaneous T cell lymphoma. This disease is characterized by some reddish patches or plaques all over the skin which extends to the whole body into erythroderma, lymphadenopathy. It is also indicated by the presence of atypical lymphocytes called Sezary cells. This case report is aimed to know clinical manifestation, examination and management of Sezary syndrome which clinically resembles generalized psoriasis. A 60 years old man came with scaly reddish brown plaques almost all over his body. It was accompanied by lymphadenopathy on the supraclavicular lymph node right and left as well as intense itchy. Other clinical features were alopecia, palmoplantar hyperkeratosis, onychodysthropy, facies leonine without anesthesia on the lesion and enlargement of peripheral nerve. From a laboratory test, an increase in the number of leukocytes and, Sezary cells were found in peripheral blood smear examination; while the histopathology showed focal athrophy and acanthosis of the epidermis and dense infiltration of lymphocytes in the dermo-epidermal junction and superficial dermis. Patient received 3 x 5 mg (1 cycle of methotrexate (MTX with 0,1% cream mometasone furoate and 3x1 tablet of CTM for adjunctive therapy. Methotrexate was discontinued because there was a disturbance in liver function and deterioration of patient’s condition. After 25 days of treatment, the patient got sepsis and then passed away. Early onset of Sezary syndrome in this case is difficult to know because the clinical manifestation is similar with psoriasis vulgaris. Supporting examination such as laboratory test, blood smears and histopathology examination could help the diagnosis. The presence of lymphadenopathy, and atypical lymphocytes in the peripheral blood and the extensive skin involvement reflect the poor prognosis. The most common cause of death was sepsis.
Composite Phaseolus vulgaris plants with transgenic roots as ...
African Journals Online (AJOL)
In this paper a system is described to obtain so-called transgenic composite plants from P. vulgaris. These have a transgenic root system, obtained through Agrobacterium rhizogenes transformation of de-rooted seedlings. Their potentials for studies on important processes in the root system will be discussed.
Oral Pemphigus Vulgaris: Case Report | Rai | Ethiopian Journal of ...
African Journals Online (AJOL)
Eighty to ninety percent of patients with pemphigus vulgaris develop oral lesions and in 60% of cases oral lesions are the first sign. Timely recognition and therapy of oral lesion is critical as it may prevent skin involvement. If treatment is instituted during this time, the disease is easier to control and the chance for an early ...
Genetic diversity study of common bean (Phaseolus vulgaris L ...
African Journals Online (AJOL)
SAM
2014-09-03
Sep 3, 2014 ... Phaseolus vulgaris L. (family Leguminosae), is a leguminous crop widely distributed in all parts of the world. In Ethiopia, common bean is cultivated as a source of protein for local consumption and for export. Mostly, it grows in the warm and lowland areas of the country. The aim of this research was to.
Evaluation of Azithromycin in Treatment of Acne Vulgaris Compared to
African Journals Online (AJOL)
Introduction: Acne vulgaris is the most common dermatological disorder in adolescence. Treatment is essential to prevent physical and psychological scarring. Although many treatments for acne are available, effective management has become increasingly challenging with the emergence of antibiotic-resistant strains of ...
Composite Phaseolus vulgaris plants with transgenic roots as ...
African Journals Online (AJOL)
SERVER
2008-02-19
Feb 19, 2008 ... ... important processes in the root system will be discussed. Key words: Genetic transformation, Phaseolus vulgaris, Agrobacterium rhizogenes. INTRODUCTION. Grain legumes are important agricultural crops, especially for developing countries, where they provide proteins in vegetarian or meat-poor diets.
Response of Field Beans ( Phaseolus vulgaris L.) to Unacidulated ...
African Journals Online (AJOL)
The agronomic effectiveness of minjingu rock phosphate (MRP) was compared with that of highly soluble phosphate triple superphosphate (TSP), in pot studies with field bean (P. vulgaris L. ) in a greenhouse at the field station of Faculty of Agriculture, University of Nairobi, Kenya. MRP finely ground with 30 Grade % P and ...
allelopathic effects of eucalyptus tereticornis on phaseolus vulgaris ...
African Journals Online (AJOL)
user
The water extracts of leaves (green, brown and decayed stages) and bark of Eucalyptus tereticornis were tested for seed ... percentage of Phaseolus vulgaris due to the treatments of water extracts of leaves and bark of Eucalyptus, also affected the ... chemicals from its leaves or litter which inhibits the germination or growth ...
Assessment of genetic diversity in French bean (Phaseolus vulgaris ...
African Journals Online (AJOL)
ONOS
2010-08-09
Aug 9, 2010 ... RAPD molecular markers were used to evaluate the genetic diversity in the fourteen varieties of French bean (Phaseolus vulgaris) of three eco-geographical regions of Bangladesh. Out of the 20 primers only,. 6 yielded polymorphic banding patterns. In total, 40 different DNA bands were reproducibly ...
The biomass and ecology of chokka squid Loligo vulgaris reynaudii ...
African Journals Online (AJOL)
1991-01-22
Jan 22, 1991 ... Migration, stock size and ecology of chokka squid Loligo vulgaris reynaudii off the West Coast of South Africa were studied and their relationship to other regions compared by analysis of distributional, biomass, and size composition, and biological data collected from biannual research cruises from ...
A comparison between Daphnia pulex and Hydra vulgaris as ...
African Journals Online (AJOL)
The mortalities as well as morphological changes (H. vulgaris) were analysed using Microsoft Excel. The LC50-values were statistically determined using the EPA Probit Analysis Model and the Spearman-Karber analysis methods. Prior to being used, analysis of the physico-chemical properties, nutrients and metals of both ...
Effects of Thymus vulgaris and Mentha pulegium on colour, nutrients ...
African Journals Online (AJOL)
This study was designed to investigate the effects of Thymus vulgaris (thyme) and Mentha pulegium (mentha) powders on meat colour, nutrient composition and malondialdehyde (MDA) where broiler chickens were under heat stress. Two hundred one-day-old male chicks were used in a completely randomized design with ...
Reproductive Biology of the Common Octopus (Octopus vulgaris ...
African Journals Online (AJOL)
policy in the management of the fishery in. Kenya. METHODS. Sampling for common octopus was carried out ..... Morocco-Mauritania (Hatanaka, 1979; Dia,. 1988). It has been stated that such variations in the sex ratio .... Reproductive cycle and energy allocation of Octopus vulgaris in Galician waters, NE. Atlantic. Fisheries ...
Genetic diversity study of common bean ( Phaseolus vulgaris L ...
African Journals Online (AJOL)
Phaseolus vulgaris L. (family Leguminosae), is a leguminous crop widely distributed in all parts of the world. In Ethiopia, common bean is cultivated as a source of protein for local consumption and for export. Mostly, it grows in the warm and lowland areas of the country. The aim of this research was to investigate the genetic ...
Assessment of genetic diversity in French bean ( Phaseolus vulgaris ...
African Journals Online (AJOL)
RAPD molecular markers were used to evaluate the genetic diversity in the fourteen varieties of French bean (Phaseolus vulgaris) of three eco-geographical regions of Bangladesh. Out of the 20 primers only, 6 yielded polymorphic banding patterns. In total, 40 different DNA bands were reproducibly obtained, out of which ...
POD DEVELOPMENT INCREASES THE OZONE SENSITIVITY OF PHASEOLUS VULGARIS
The objective of this study was to determine if the O3 sensitivity of Phaseolus vulgaris L. changed with plant development. Plants exposed to charcoal-filtered air or elevated O3 throughout the study were compared to those exposed only during the vegetative or reproductive s...
Registration of Gabisa Common Bean ( Phaseolus vulgaris L.) Variety
African Journals Online (AJOL)
Gabisa is a common name for common bean (Phaseolus vulgaris L.) variety with pedigree name of VAX-2. It is a bush food bean variety selected out of common bean lines introduced to Ethiopia through CIAT program and released in 2007 by the Bako Agricultural Research Center for production in western Ethiopia and ...
Evaluation of common bean (Phaseolus vulgaris) response to charcoal rot
Charcoal rot in common beans (Phaseolus vulgaris L.), caused by Macrophomina phaseolina (Tassi) Gold. (Mph), is an endemic disease in the prevailing hot and dry conditions in southern Puerto Rico. This study evaluated the 120 bean genotypes that compose the BASE 120 panel under screenhouse conditio...
Phosphorus use efficiency in common bean ( Phaseolus vulgaris L ...
African Journals Online (AJOL)
The tripartite symbiosis of common bean (Phaseolus vulgaris L.) recombinant inbred line (RIL) 147 with rhizobia and arbuscular mycorrhizal fungi (AMF) was assessed in sand culture by comparing the effects of three AMF species on the mycorrhizal root colonization, rhizobial nodulation, plant growth and phosphorus use ...
Gallium-67-citrate uptake in a case of acne vulgaris
Energy Technology Data Exchange (ETDEWEB)
Kipper, M.S.; Taylor, A.; Ashburn, W.L.
1981-09-01
A case of increased Ga-67 uptake in a patient with active acne vulgaris is reported. The scan was requested in a search for metastatic testicular carcinoma or bleomycin pulmonary toxicity. Careful clinical evaluation including physical examination was necessary in order to avoid an erroneous scan interpretation.
Drug resistant Proteus mirabilis and Proteus vulgaris isolated from ...
African Journals Online (AJOL)
Proteus mirabilis and Proteus vulgaris are pathogens often associated with drug resistance traits. They are of public health importance with zoonotic status. They have been globally associated with humans and poultry infections. Multidrug resistant strains of these organisms are routinely isolated from organs samples from ...
Response of common bean ( Phaseolus vulgaris L.) cultivars to ...
African Journals Online (AJOL)
Yield losses in common bean (Phaseolus vulgaris L.) may occur due to boron (B) deficiency when the susceptible cultivars are grown in calcareous boron deficient soils. The study was therefore aimed at investigating the effects of three B doses: control (0.0 kg ha-1), soil application (3.0 kg ha-1) and foliar fertilization (0.3 kg ...
Investigation of optimal condition for Chlorella vulgaris microalgae growth
Directory of Open Access Journals (Sweden)
S. Daliry
2017-03-01
Full Text Available Due to its abundance and also flexibility of cultivation conditions, Chlorella vulgaris microalgae is one of the most ideal options available in order to production of microalgae based biodiesel. Since vulgaris cultivation for fuel production needs economic considerations to be taken, and in first place providing biomass and lipid production costs is important, wide researches have been conducted in this field, and this study aims to spot the best condition for cultivation of this valuable specie by reviewing the whole research conducted. So far, Researchers' efforts show that, the best condition for vulgaris cultivation is mixotrophic regime which is done in a bubble column photobioreactor. Glucose as carbonic source and nitrate as nitrogen source, have the most efficacy among nutrition conditions. It is known the best results obtain in amounts glucose and nitrate of 20 and o.5 g/L respectively. Alkaline medium (pH 9 to 10, non-continuous illumination, 5 to 7 Klux and a 200 mL/min aeration flow rate, indicated the best physical conditions. The most vulgaris biomass amount produced was 3.43 g/L, and the best lipid productivity was measured 66.25 mg/L/day.
The oral adverse effects of isotretinoin treatment in acne vulgaris ...
African Journals Online (AJOL)
Background: Isotretinoin is the most effective therapy to treat severe acne vulgaris and its systemic adverse effects have been well documented, but little is known on dental side effects over the course of treatment. Objectives: This prospective case-control study aimed to evaluate the oral adverse effects of isotretinoin in ...
Reproductive biology of common octopus Octopus vulgaris (Cuvier ...
African Journals Online (AJOL)
Abstract. Although common octopus catches are increasing globally, lack of information on the species reproductive biology has been a major concern in its management particularly in Kenya. The present study aimed at investigating the reproductive biology of Octopus vulgaris from Shimoni and Vanga in the Kenyan South ...
Enzymatic Browning in Sugar Beet Leaves (Beta vulgaris L.)
Vissers, Anne; Kiskini, Alexandra; Hilgers, Roelant; Marinea, Marina; Wierenga, Peter Alexander; Gruppen, Harry; Vincken, Jean Paul
2017-01-01
Sugar beet (Beta vulgaris L.) leaves of 8 month (8m) plants showed more enzymatic browning than those of 3 month (3m). Total phenolic content increased from 4.6 to 9.4 mg/g FW in 3m and 8m, respectively, quantitated by
Response of Field Beans ( Phaseolus vulgaris L.) to Unacidulated ...
African Journals Online (AJOL)
Response of Field Beans (Phaseolus vulgaris L.) to Unacidulated Phosphorus Source in an Andosols in Kenya. C Owino-Gerroh, JK Keter, JP Mbuvi. Abstract. The agronomic effectiveness of minjingu rock phosphate (MRP) was compared with that of highly soluble phosphate triple superphosphate (TSP), in pot studies with ...
Bioremediation of the textile waste effluent by Chlorella vulgaris
Directory of Open Access Journals (Sweden)
Hala Yassin El-Kassas
2014-01-01
Full Text Available The microalgae biomass production from textile waste effluent is a possible solution for the environmental impact generated by the effluent discharge into water sources. The potential application of Chlorella vulgaris for bioremediation of textile waste effluent (WE was investigated using 22 Central Composite Design (CCD. This work addresses the adaptation of the microalgae C. vulgaris in textile waste effluent (WE and the study of the best dilution of the WE for maximum biomass production and for the removal of colour and Chemical Oxygen Demand (COD by this microalga. The cultivation of C. vulgaris, presented maximum cellular concentrations Cmax and maximum specific growth rates μmax in the wastewater concentration of 5.0% and 17.5%, respectively. The highest colour and COD removals occurred with 17.5% of textile waste effluent. The results of C. vulgaris culture in the textile waste effluent demonstrated the possibility of using this microalga for the colour and COD removal and for biomass production. There was a significant negative relationship between textile waste effluent concentration and Cmax at 0.05 level of significance. However, sodium bicarbonate concentration did not significantly influence the responses of Cmax and the removal of colour and COD.
Composite Phaseolus vulgaris plants with transgenic roots as ...
African Journals Online (AJOL)
Large seeded grain legumes such as the common bean (Phaseolus vulgaris) and cowpea (Vigna unguiculata) are very important crops with seeds that are major protein source for people in developing countries, but their yields and improvement lag behind the economically more important cereals. For research purposes ...
Biocontrol Of Viral Necrotic Disease Of Phaseolus Vulgaris By ...
African Journals Online (AJOL)
This study revealed that the preinoculation of soil with rhizosphere microorganisms significantly reduced number of local lesions produced by TNV, in P. vulgaris plants either grown in amended or unamended soil. Phaseolus plants grown in fish meal amended soil supplied with RMs singly or in mixtures, and then their ...
Dapsone 7.5% Gel: A Review in Acne Vulgaris.
Al-Salama, Zaina T; Deeks, Emma D
2017-02-01
Dapsone 7.5% gel (Aczone ® ) is indicated for the once-daily topical treatment of acne vulgaris in patients aged ≥12 years. Dapsone is a sulfone antibacterial with anti-inflammatory actions, which are thought to be largely responsible for its efficacy in treating acne vulgaris. In two phase III trials of 12 weeks' duration in patients aged ≥12 years with moderate acne vulgaris, once-daily dapsone 7.5% gel reduced acne severity (as per the Global Acne Assessment Score) and lesion counts versus vehicle. The benefits of dapsone 7.5% gel over vehicle were seen as early as week 2 for inflammatory lesion counts, and from week 4 or 8 for other outcomes. Dapsone 7.5% gel was well tolerated, with a low incidence of treatment-related adverse events, with the majority of adverse events being administration-site related and mild or moderate in severity. Thus, dapsone 7.5% gel is an effective and well tolerated option for the topical treatment of acne vulgaris in patients aged ≥12 years, with the convenience of once-daily application.
Aluminium Tolerance of Four Bean ( Phaseolus vulgaris L.) Varieties ...
African Journals Online (AJOL)
Four bean (Phaseolus vulgaris) varieties ('Rosecoco'– GLP 2, 'Mwitemania'– GLP X 92, 'Mwezi Moja' – GLP 1004, and French bean – 'Amy') locally obtained from seed merchants in Kenya were investigated for their aluminium tolerance under two techniques of screening, namely root elongation and staining.
Performance of Phaseolus vulgaris L. in a soil contaminated with ...
African Journals Online (AJOL)
Phytoremediation is an alternative low cost approach for in situ treatment of polluted soils. This study evaluated growth and biochemical composition of Phaseolus vulgaris as influenced by spent engine oil contaminated soil. The experiment was conducted in a pot during the 2005 cropping season. The soil received (0% ...
Vegetative propagation of Syringa vulgaris L. in vitro.
Pierik, R.L.M.; Steegmans, H.H.M.; Elias, A.A.; Stiekema, O.T.J.; Velde, van der A.J.
1988-01-01
Excised shoot tips from adult Syringa vulgaris L. plants were rejuvenated by repeated subculturing in vitro. The number of subcultures required to rejuvenate the shoots was strongly dependent on the age and genotype of the plant material. Three rootstocks (K8, A2 and A3) and 5 cultivars
Nodulation and nitrogen fixation in common bean (Phaseolus vulgaris)
African Journals Online (AJOL)
Mamadou Gueye
Rhizobium. INTRODUCTION. In Senegal, common bean (Phaseolus vulgaris) needs to be inoculated with elite Rhizobium strains in the growing area called Niayes zone (Diouf et al., 1999). Usually, seeds of common bean supplied to farmers are often treated with fungicide to prevent losses due to seed- borne pathogens.
Direct hydroacoustic observations of chokka squid Loligo vulgaris ...
African Journals Online (AJOL)
Direct hydroacoustic observations of chokka squid Loligo vulgaris reynaudii spawning activity in deep water. ... The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, ...
The Oral Adverse Effects of Isotretinoin Treatment in Acne Vulgaris ...
African Journals Online (AJOL)
2016-01-31
Jan 31, 2016 ... Assessment System, isotretinoin, salivary flow. The Oral Adverse Effects of Isotretinoin Treatment in Acne Vulgaris. Patients: A Prospective, Case–control Study. U Erdemir, G Okan1, S Gungor2, B Tekin3, SO Yildiz4, E Yildiz isotretinoin adversely affects salivary flow and buffer capacity.[6-8]. Dental caries is ...
The biomass and ecology of chokka squid Loligo vulgaris reynaudii ...
African Journals Online (AJOL)
Migration, stock size and ecology of chokka squid Loligo vulgaris reynaudii off the West Coast of South Africa were studied and their relationship to other regions compared by analysis of distributional, biomass, and size composition, and biological data collected from biannual research cruises from 1983-1987. Biomass ...
Direct hydroacoustic observations of chokka squid Loligo vulgaris ...
African Journals Online (AJOL)
During the November 1996 survey, seven such targets were observed near the bottom at depths of 115–125 m, directly south of the traditional inshore spawning grounds of chokka squid Loligo vulgaris reynaudii at Cape St Francis. The targets were close to prominent seabed ridges and extended 30–40 m off the bottom.
Chlorella vulgaris modulates hydrogen peroxide-induced dna ...
African Journals Online (AJOL)
A decline in DNA damage was observed in post-treated cells which proves Chlorella vulgaris to present bioremediative properties. In cells induced with oxidative stress, telomere length decreased significantly coupled with a concomitant decline of telomerase activity (p<0.05). However, these reductions were prevented with ...
Topical antibiotic monotherapy prescribing practices in acne vulgaris.
Hoover, William D; Davis, Scott A; Fleischer, Alan B; Feldman, Steven R
2014-04-01
The aim of this study is to evaluate the frequency of dosing topical antibiotics as monotherapy in the treatment of acne vulgaris, and physician specialty prescribing these medications. This study is a retrospective review of all visits with a sole diagnosis of acne vulgaris (ICD-9-CM code 706.1) found on the National Ambulatory Medical Care Survey (NAMCS) in 1993-2010. We recorded the number of visits surveyed where acne vulgaris was the sole diagnosis, number of visits where topical antibiotics were the only treatment prescribed, and the specialty of physician in each encounter. Topical erythromycin or clindamycin were the sole medication prescribed in 0.81% of the visits recorded, with 60% of these prescriptions arising from dermatologists and 40% from non-dermatologists. The trend of prescribing topical antibiotic monotherapy is declining (p acnes to topical antibiotic regimens has led to the need to re-evaluate the use of topical antibiotics in the treatment of acne vulgaris. While the rate of topical antibiotic monotherapy is declining, their use should be reserved for situations where the direct need for antibiotics arises. If a clinician feels that antibiotics are a necessary component to acne therapy, they should be used as part of a combination regimen.
Effect of Euphorbia hirta and Thymus vulgaris powders on ...
African Journals Online (AJOL)
The ban placed on the long term use of commercial antibiotics at subtherapeutic levels for diseases control and growth promotion in livestock production necessitated a worldwide search for available, cost effective and efficacious alternatives. Accordingly, the effects of Euphorbia hirta (EH) and Thymus vulgaris (TV) ...
Pathological Fracture due to pemphigus vulgaris: A case report ...
African Journals Online (AJOL)
Pemphigus vulgaris is a rare but serious autoimmune mucocutaneous bullous disease.The two cardinal pathological processes at work are a split within the epidermis and loss of adhesion of epidermal cells (Acantholysis). It is due to deposition of pathogenic IgG on the Keratinocyte cell surface. The mainstay of treatment is ...
Pinguicula vulgaris L. (Vetblad) weer terug in Noord-Brabant
Rossenaar, Arnout-Jan; Kierkels, Geert; Schelle, Marian; Bos, Frank
1999-01-01
In August 1998 Pinguicula vulgaris was discovered in the middle of Noord-Brabant after almost 50 years of absence in this province. The species appeared on three spots on the embankement of a pool in heathland, after recent restoration measurements.
The epidemiology of acne vulgaris in late adolescence
Directory of Open Access Journals (Sweden)
Lynn DD
2016-01-01
Full Text Available Darren D Lynn,1 Tamara Umari,1 Cory A Dunnick,2,3 Robert P Dellavalle2–4 1Department of Dermatology, University of Colorado School of Medicine, 2Department of Dermatology, University of Colorado Anschutz Medical Campus, Aurora, 3Dermatology Service, US Department of Veterans Affairs, Eastern Colorado Health Care System, Denver, 4Department of Epidemiology, Colorado School of Public Health, University of Colorado Anschutz Medical Campus, Aurora, CO, USA Importance: Acne vulgaris is the most common skin condition affecting late adolescents across the globe. Although prior studies have evaluated epidemiologic patterns of acne vulgaris in various ethnicities and regions, adequate understanding of the worldwide burden of the disease associated with patients in their late adolescence (15–19-year olds remains lacking. Objective: To assess the global burden of the disease associated with acne vulgaris for late adolescents (15–19-year olds and provide an overview of the epidemiology, pathophysiology, and treatment options for acne in this population. Design: Database summary study. Setting: Global Burden of Disease Study 2010 database. Participants: Global Burden of Disease regions comprised countries with prevalence of acne vulgaris between the ages of 15 and 19 years. Main outcomes and measures: Geographic region-level disability-adjusted life year rates (per 100,000 persons associated with acne vulgaris in years 1990 through 2010. Median percentage change in disability-adjusted life year rates was estimated for each region across the specified study period. Conclusion and relevance: Acne vulgaris-associated disease burden exhibits global distribution and has continued to grow in prevalence over time within this population. This continued growth suggests an unmet dermatologic need worldwide for this disorder and potential opportunities for improved access and delivery of dermatologic care. Our analysis of the literature reveals numerous
Association of Serum Testosterone with Acne Vulgaris in Women
Directory of Open Access Journals (Sweden)
Md. Moksedur Rahman
2012-06-01
Full Text Available Background: Androgens enhance the sebum production and follicular keratosis that plays the key role in the aetiology of acne. Objective: To find out the association between serum testosterone and acne vulgaris. Methods: A case control study was carried out for a period of two years in the outpatient department of Dermatology and Venereology, Bangabandhu Sheikh Mujib Medical University (BSMMU, Dhaka, Bangladesh. Female patients having acne vulgaris were selected as case. Healthy control (age and sex matched were enrolled from the community. Results: The study showed that the mean age of the cases was 22.43 with standard deviation 5.2 years and the mean age of the control was 23.23 with standard deviation 5.9 years. The mean duration of disease was 62.6 months ranging from 12 months to 300 months. All the patients had presented with comedones (blackheads and whiteheads followed by 94.3% had papules and 58.6% had pustules. Considering the site of lesion, all the patients had acne in the face. Data analysis revealed that the percentage of serum testosterone above normal was found to be high among the cases with acne (10% whereas below normal level of serum testosterone was found among the control and the difference was statistically significant (p<0.001. Conclusion:The study found a significant association between serum testosterone and acne vulgaris. As serum testosterone is associated with acne vulgaris, testosterone levels should be measured in patients presenting with acne vulgaris especially in treatment resistant cases and anti-androgen treatment may be indicated in cases with elevated testosterone level.DOI: http://dx.doi.org/10.3329/bsmmuj.v5i1.10980 BSMMU J 2012; 5(1:1-5
Repolho, Tiago; Baptista, Miguel; Pimentel, Marta S; Dionísio, Gisela; Trübenbach, Katja; Lopes, Vanessa M; Lopes, Ana Rita; Calado, Ricardo; Diniz, Mário; Rosa, Rui
2014-01-01
The ability to understand and predict the effects of ocean warming (under realistic scenarios) on marine biota is of paramount importance, especially at the most vulnerable early life stages. Here we investigated the impact of predicted environmental warming (+3 °C) on the development, metabolism, heat shock response and antioxidant defense mechanisms of the early stages of the common octopus, Octopus vulgaris. As expected, warming shortened embryonic developmental time by 13 days, from 38 days at 18 °C to 25 days at 21 °C. Concomitantly, survival decreased significantly (~29.9 %). Size at hatching varied inversely with temperature, and the percentage of smaller premature paralarvae increased drastically, from 0 % at 18 °C to 17.8 % at 21 °C. The metabolic costs of the transition from an encapsulated embryo to a free planktonic form increased significantly with warming, and HSP70 concentrations and glutathione S-transferase activity levels were significantly magnified from late embryonic to paralarval stages. Yet, despite the presence of effective antioxidant defense mechanisms, ocean warming led to an augmentation of malondialdehyde levels (an indicative of enhanced ROS action), a process considered to be one of the most frequent cellular injury mechanisms. Thus, the present study provides clues about how the magnitude and rate of ocean warming will challenge the buffering capacities of octopus embryos and hatchlings' physiology. The prediction and understanding of the biochemical and physiological responses to warmer temperatures (under realistic scenarios) is crucial for the management of highly commercial and ecologically important species, such as O. vulgaris.
Skin prick test results to artesunate in children sensitized to Artemisia vulgaris L.
Mori, F; Pantano, S; Rossi, M E; Montagnani, C; Chiappini, E; Novembre, E; Galli, L; de Martino, M
2015-09-01
Artemisia vulgaris L and Artemisia annua L (Chinese: qinghao) are similar plants of the Asterbaceae family. Artesunate, a semi-synthetic derivate of artemisin which is the active principle extract of the plant qinghao, has antimalarial properties. Some cases of severe allergic reactions to artesunate have been described. The purpose of this study was to evaluate the association between positive skin tests to Artemisia vulgaris L allergen and a preparation of injectable artesunate. A total of 531 children were skin prick tested with inhalants (including Artemisia vulgaris L), foods, and artesunate. Among the 59 patients positive to Artemisia vulgaris L only one child was also positive to artesunate. No child was positive to artesunate in those negative to Artemisia vulgaris L. We conclude that Artemisia vulgaris L sensitization is not associated with sensitization to artesunate; consequently, skin test to artesunate should not be carried out before using the drug considering the rare allergic reactions. © The Author(s) 2015.
The optimal hyperspectral quantitative models for chlorophyll-a of chlorella vulgaris
Cheng, Qian; Wu, Xiuju
2009-09-01
Chlorophyll-a of Chlorella vulgaris had been related with spectrum. Based on hyperspectral measurement for Chlorella vulgaris, the hyperspectral characteristics of Chlorella vulgaris and their optimal hyperspectral quantitative models of chlorophyll-a (Chla) estimation were researched in situ experiment. The results showed that the optimal hyperspectral quantitative model of Chlorella vulgaris was Chla=180.5+1125787(R700)'+2.4 *109[(R700)']2 (P0Chlorella vulgaris, two reflectance crests were around 540 nm and 700 nm and their locations moved right while Chl-a concentration increased. The reflectance of Chlorella vulgaris decreases with Cha concentration increase in 540 nm, but on the contrary in 700nm.
Identifikasi Kromatografi Lapis Tipis Sudamala (Artemisia vulgaris L.
Directory of Open Access Journals (Sweden)
Ira Arundina
2015-12-01
Full Text Available Karsinoma sel skuamosa rongga mulut merupakan jenis kanker yang paling sering ditemukan di rongga mulut. Faktor risiko utama terjadi keganasan di rongga mulut meliputi riwayat serta kebiasaan mengkonsumsi tembakau dan atau alkohol. Tanaman sudamala (Artemisia vulgaris L. sering digunakan di masyarakat sebagai anti tumor pada organ pencernaan termasuk di rongga mulut, namun belum ada penelitian tentang bahan aktif yang berperan sebagai anti kanker di rongga mulut. Banyak didapatkan spesies dari genus Artemisia, sedangkan yang banyak tumbuh di Indonesia adalah spesies Artemisia vulgaris L. Tujuan penelitian ini adalah untuk menjelaskan identifikasi menggunakan Kromatografi Lapis Tipis (KLT dari sudamala. Penelitian meliputi ekstraksi sudamala, identifikasi ekstrak sudamala, fraksinasi sudamala menggunakan Kromatografi Kolom Vakum dan identifikasi dari fraksi sudamala menggunakan Kromatografi Lapis Tipis (KLT. Ekstrak heksan sudamala yang dilakukan fraksinasi menggunakan n-heksan: etil asetat menghasilkan 11 fraksi. Fraksi n-heksan: etil asetat (3:7,v/v dari sudamala yang teridentifikasi menggunakan Kromatografi Lapis Tipis (KLT mengandung terpenoid. Identification of Sudamala ( Artemisia vulgaris L. Thin Layer Chromatography. Oral squamous cell carcinoma is the type of cancer which is most frequently found in oral cavity. The primary risk factor of malignancy in oral cavity includes the habit of consuming tobacco and or alcohol. The plant sudamala (Artemisia vulgaris L. is often used in the community as anti-tumor in digestive organ, including in oral cavity. However, there have been no studies on active ingredients playing the role as anti-cancer in oral cavity. The species are mostly from the genus Artemisia, while those generally growing in Indonesia are the species Artemisia vulgaris L. The objective of this study is to explain the identification by TLC of sudamala. The study was sudamala extraction, identification of sudamala extract
DEFF Research Database (Denmark)
Gissel, Line Engbo
This presentation builds on an earlier published article, 'Contemporary Transitional Justice: Normalising a Politics of Exception'. It argues that the field of transitional justice has undergone a shift in conceptualisation and hence practice. Transitional justice is presently understood to be th...
National Research Council Canada - National Science Library
Adeolu Aderemi; Colin Hunter; Ole Pahl; Xinhua Shu
2015-01-01
Raphidocelis subcapitata and Chlorella vulgaris are bioassay microalgae with rigid cellulosic cell wall which can hinder the release of intracellular proteins often studied as toxicity biomarkers...
Almuaigel, Mohammad Faisal; Seif, Mosaad A; Albuali, Hamad Waleed; Alharbi, Omar; Alhawash, Amer
2017-10-01
The present investigation was carried out to evaluate the reduction potential of aqueous extract of casing of pods of phaseolus vulgaris in blood glucose and lipids levels among hyperglycemic streptozotocin (STZ)-induced rats. Oral administration of 150mg/kg of aqueous oral administration of aqueous pod extract of phaseolus vulgaris to diabetic rats for 40days resulted in a significant decrease in blood glucose (pphaseolus vulgaris and glibenclamide reduced the blood levels of glucose and lipids. In addition, aqueous extract of phaseolus vulgaris pods was more effective than glibenclamide in reducing blood glucose. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Bakopoulos, Vasileios; White, Daniella; Valsamidis, Michail-Aggelos; Vasilaki, Feli
2017-03-01
Adult common octopus individuals were intramuscularly infected with Photobacterium damsela subsp. piscicida in order to investigate if this species is sensitive to this common and important fish pathogen. The fate of the bacterial antigens and the tissue responses of Octopus vulgaris were studied employing immunohistochemical techniques. Strong reaction at the site of injection was evident from day 2 post-infection that continued until day 14. Great numbers of hemocytes that were attracted at the site of infection were involved in phagocytosis of bacteria. Very early in the infection, a transition of cells to fibroblasts and an effort to isolate the infection was observed. During the course of the study, very large necrotic cells were seen at the site of infection, whereas during the later stages hemocytes with phagocytosed bacteria were observed in well-defined pockets inside the muscle tissue. None of the internal organs tested for the presence of the bacterium were positive with the exception of the digestive gland where antigen staining was observed which was not associated with hemocyte infiltration. The high doses of bacterial cells used in this experimental infection and the lack of disease signs from Octopus vulgaris suggest that, under normal conditions, octopus is resistant to Photobacterium damsela subsp. piscicida. Copyright © 2017 Elsevier Inc. All rights reserved.
Significance of diet in treated and untreated acne vulgaris.
Kucharska, Alicja; Szmurło, Agnieszka; Sińska, Beata
2016-04-01
The relationship between diet and acne is highly controversial. Several studies during the last decade have led dermatologists to reflect on a potential link between diet and acne. This article presents the latest findings on a potential impact that diet can have on pathogenesis of acne vulgaris. The association between diet and acne can no longer be dismissed. Compelling evidence shows that high glycemic load diets may exacerbate acne. Dairy ingestion appears to be weakly associated with acne and the roles of omega-3 fatty acids, dietary fiber, antioxidants, vitamin A, zinc and iodine remain to be elucidated. The question of what the impact of diet is on the course of acne vulgaris still remains unclear.
Significance of diet in treated and untreated acne vulgaris
Directory of Open Access Journals (Sweden)
Alicja Kucharska
2016-05-01
Full Text Available The relationship between diet and acne is highly controversial. Several studies during the last decade have led dermatologists to reflect on a potential link between diet and acne. This article presents the latest findings on a potential impact that diet can have on pathogenesis of acne vulgaris. The association between diet and acne can no longer be dismissed. Compelling evidence shows that high glycemic load diets may exacerbate acne. Dairy ingestion appears to be weakly associated with acne and the roles of omega-3 fatty acids, dietary fiber, antioxidants, vitamin A, zinc and iodine remain to be elucidated. The question of what the impact of diet is on the course of acne vulgaris still remains unclear.
Thymus vulgaris essential oil: chemical composition and antimicrobial activity.
Borugă, O; Jianu, C; Mişcă, C; Goleţ, I; Gruia, A T; Horhat, F G
2014-01-01
The study was designed to determine the chemical composition and antimicrobial properties of the essential oil of Thymus vulgaris cultivated in Romania. The essential oil was isolated in a yield of 1.25% by steam distillation from the aerial part of the plant and subsequently analyzed by GC-MS. The major components were p-cymene (8.41%), γ-terpinene (30.90%) and thymol (47.59%). Its antimicrobial activity was evaluated on 7 common food-related bacteria and fungus by using the disk diffusion method. The results demonstrate that the Thymus vulgaris essential oil tested possesses strong antimicrobial properties, and may in the future represent a new source of natural antiseptics with applications in the pharmaceutical and food industry.
Respose of Phaseolus vulgaris L. cultivars to drought stress
Directory of Open Access Journals (Sweden)
Amalia Domínguez
2014-01-01
Full Text Available Tolerance to drought is a desired cultivars of Phaseolus vulgaris L. The present study aimed to determine the response of 22 cultivars of common bean during the early stages of vegetative development character. The plants were subjected to irrigation at 70% or 20% of field capacity (FC for seven days and the indicators were measured relative water content, stomatal opening, stomatal index, proline content and total phenols in leaves. The data obtained were processed using a principal component analysis and the variables studied were represented by a bivariate graph (biplot. It was possible to group the cultivars based on their response in tolerant, moderately tolerant and susceptible to water stress condition induced by irrigation at 20% FC. Stomatal opening and relative water content were recommended to be used as criteria for selecting cultivars tolerant to water stress indicators bean. Key words: PCA, Phaseolus vulgaris L., proline, water stress
[Effects of seed priming on vigor of Prunella vulgaris seeds].
Zhang, Xian-Xiu; Guo, Qiao-Sheng; Wang, Yan-Ru
2008-03-01
To select an effective way to enhance vigor of Prunella vulgaris seeds. Three population seeds were treated at the 20 degrees C and dark enviroment. Priming with 20% - 30% PEG and 200 - 400 mg x L(-1) GA3 could enhance seeds germination and vigor. Germination percentage of three population seeds treated with 0. 6% - 3.0% NaCl reduced, but they started to germinate in advance. Treated with 0.6% - 2.4% KNO3-KH2PO4, germination rate and vigor of seeds in Zijinshan and Pan' an both increased and the one in Bozhou decreased. Vigor of P. vulgaris seed treated with PEG and GA3 under proper concentration increases, while treated with KNO3-KH2PO, and NaCl low vigor seeds germination rate reduces.
LIPID ACCUMULATION OF CHLORELLA VULGARIS UNDER DIFFERENT PHOSPHATE CONCENTRATIONS
Directory of Open Access Journals (Sweden)
Magdalena Karolina Rokicka
2017-04-01
Full Text Available The cultivation and utilization of microalgae is now a intensively developing area of research. Some species of microalgae, under appropriate conditions, accumulate large amounts of lipids in the cells. This lipids have a suitable profile of fatty acids for biodiesel production. The culture of microalgae for lipids accumulation should be performed in certain physicochemical conditions. The aim of the study was to determine the effect of variable ortophophates concentrations in the culture medium for lipids accumulation of microalgae Chlorella vulgaris and to determine of parameters of the phosphoric shock in the medium. The study confirmed the possibility of the use of the phosphoric shock in the medium to maximize lipids accumulation by the microalgae Chlorella vulgaris. In the study, 45.23% of the oil was obtained from the biomass from the culture with phosphoric shock in the medium and 18% less of the oil was obtained from the biomass from the standard culture.
Biodiesel production in crude oil contaminated environment using Chlorella vulgaris.
Xaaldi Kalhor, Aadel; Mohammadi Nassab, Adel Dabbagh; Abedi, Ehsan; Bahrami, Ahmad; Movafeghi, Ali
2016-12-01
Biodiesel is a valuable alternative to fossil fuels and many countries choose biodiesel as an unconventional energy source. A large number of investigations have been done on microalgae as a source of oil production. In recent years, wastewater pollutions have caused many ecological problems, and therefore, wastewater phycoremediation has attracted the international attention. This paper studied the cultivation of Chlorella vulgaris in a crude oil polluted environment for biodiesel production. Intended concentrations were 10 and 20gperliter (crude oil/water) at two times. The results showed that the growth of C. vulgaris was improved in wastewater and the maximum amount of dry mass and oil was produced at the highest concentration of crude oil (0.41g and 0.15g/l, respectively). In addition, dry mass and oil yield of the microalga were significantly enhanced by increasing the experiment duration. Copyright © 2016 Elsevier Ltd. All rights reserved.
Case of lupus vulgaris diagnosed 50 years after onset.
Uttawichai, Pattanawadee; Igarashi, Tsukasa; Kawana, Seiji
2009-02-01
Cutaneous tuberculosis is an infrequent form of extrapulmonary tuberculosis, but is a symptom that can lead to diagnosis of tuberculosis. We describe a case of lupus vulgaris in a 79-year-old woman who had a 50-year history of a slowly growing plaque on her right cheek. She visited many hospitals without resolution and the plaque gradually enlarged. Recently, she was misdiagnosed with eczema and prescribed topical steroids that had no effect, and she subsequently visited our outpatient clinic. A diagnosis of lupus vulgaris was made based on histopathology, culture and polymerase chain reaction, and isoniazid, rifampicin and ethambutol were administered as antituberculosis treatment. Although the incidence of cutaneous tuberculosis has decreased significantly in developed countries, knowledge and awareness of the disease are still of importance for proper diagnosis and treatment.
Phaseolus vulgaris RbohB functions in lateral root development.
Montiel, Jesús; Arthikala, Manoj-Kumar; Quinto, Carmen
2013-01-01
Respiratory burst oxidase homologs (RBOHs) catalyze the reduction of oxygen to generate superoxide anion, a kind of reactive oxygen species (ROS). The ROS produced by RBOHs play essential roles in diverse processes, such as root hair development, stomata closure and signaling mechanisms in response to abiotic stimuli and during plant-pathogen interactions. Recently, we found that PvRbohB silencing in transgenic Phaseolus vulgaris roots had a negative impact on lateral root density. In this work, we show that the downregulation of PvRbohB affects both the growth and ROS levels in recently emerged lateral roots. In addition, we found that the PvRbohB promoter was activated during lateral root primordium initiation in the pericycle, and remained active throughout lateral root development. This study identifies RBOHs as potentially important players in lateral root development in P. vulgaris.
Treatment of acne vulgaris during pregnancy and lactation.
Kong, Y L; Tey, H L
2013-06-01
Acne vulgaris is a common problem encountered by pregnant and lactating women. Unfortunately, in clinical practice, treatment is often not optimized as a result of the lack of safety data and unified recommendations on the use of the various anti-acne therapies. In this narrative review, current data on their safety is summarized. We recommend the use of topical medications as first-line treatment for acne vulgaris in pregnant and lactating women. These include antibiotics (erythromycin, clindamycin, metronidazole and dapsone), benzoyl peroxide, azelaic acid and salicylic acid. Oral agents and/or light-based therapy may be considered as second-line treatment. The former consists of oral macrolides (erythromycin and azithromycin), cephalexin or zinc compounds. Blue-violet or red light phototherapy may be used as monotherapy or in addition to topical and/or oral therapies. Hormonal therapy, antibiotics consisting of tetracyclines, co-trimoxazole and fluoroquinolones, and both oral and topical retinoids should be avoided.
The morphology and adhesion mechanism of Octopus vulgaris suckers.
Tramacere, Francesca; Beccai, Lucia; Kuba, Michael; Gozzi, Alessandro; Bifone, Angelo; Mazzolai, Barbara
2013-01-01
The octopus sucker represents a fascinating natural system performing adhesion on different terrains and substrates. Octopuses use suckers to anchor the body to the substrate or to grasp, investigate and manipulate objects, just to mention a few of their functions. Our study focuses on the morphology and adhesion mechanism of suckers in Octopus vulgaris. We use three different techniques (MRI, ultrasonography, and histology) and a 3D reconstruction approach to contribute knowledge on both morphology and functionality of the sucker structure in O. vulgaris. The results of our investigation are two-fold. First, we observe some morphological differences with respect to the octopus species previously studied (i.e., Octopus joubini, Octopus maya, Octopus bimaculoides/bimaculatus and Eledone cirrosa). In particular, in O. vulgaris the acetabular chamber, that is a hollow spherical cavity in other octopuses, shows an ellipsoidal cavity which roof has an important protuberance with surface roughness. Second, based on our findings, we propose a hypothesis on the sucker adhesion mechanism in O. vulgaris. We hypothesize that the process of continuous adhesion is achieved by sealing the orifice between acetabulum and infundibulum portions via the acetabular protuberance. We suggest this to take place while the infundibular part achieves a completely flat shape; and, by sustaining adhesion through preservation of sucker configuration. In vivo ultrasonographic recordings support our proposed adhesion model by showing the sucker in action. Such an underlying physical mechanism offers innovative potential cues for developing bioinspired artificial adhesion systems. Furthermore, we think that it could possibly represent a useful approach in order to investigate any potential difference in the ecology and in the performance of adhesion by different species.
The morphology and adhesion mechanism of Octopus vulgaris suckers.
Directory of Open Access Journals (Sweden)
Francesca Tramacere
Full Text Available The octopus sucker represents a fascinating natural system performing adhesion on different terrains and substrates. Octopuses use suckers to anchor the body to the substrate or to grasp, investigate and manipulate objects, just to mention a few of their functions. Our study focuses on the morphology and adhesion mechanism of suckers in Octopus vulgaris. We use three different techniques (MRI, ultrasonography, and histology and a 3D reconstruction approach to contribute knowledge on both morphology and functionality of the sucker structure in O. vulgaris. The results of our investigation are two-fold. First, we observe some morphological differences with respect to the octopus species previously studied (i.e., Octopus joubini, Octopus maya, Octopus bimaculoides/bimaculatus and Eledone cirrosa. In particular, in O. vulgaris the acetabular chamber, that is a hollow spherical cavity in other octopuses, shows an ellipsoidal cavity which roof has an important protuberance with surface roughness. Second, based on our findings, we propose a hypothesis on the sucker adhesion mechanism in O. vulgaris. We hypothesize that the process of continuous adhesion is achieved by sealing the orifice between acetabulum and infundibulum portions via the acetabular protuberance. We suggest this to take place while the infundibular part achieves a completely flat shape; and, by sustaining adhesion through preservation of sucker configuration. In vivo ultrasonographic recordings support our proposed adhesion model by showing the sucker in action. Such an underlying physical mechanism offers innovative potential cues for developing bioinspired artificial adhesion systems. Furthermore, we think that it could possibly represent a useful approach in order to investigate any potential difference in the ecology and in the performance of adhesion by different species.
Miliaria pustulosa misdiagnosed as a case of acne vulgaris
Directory of Open Access Journals (Sweden)
Iqbal Bukhari
2016-10-01
Full Text Available Miliaria is a skin disorder of eccrine glands. Based on the level of sweat duct obstruction, miliaria is subdivided into three main types: Miliaria crystallina, miliaria rubra and miliaria profunda. Besides, resident skin bacteria are thought to play a role in its pathogenesis. In this report we are presenting a case of miliaria pustulosa which was misdiagnosed initially as a case of acne vulgaris.
Dicamba causes genomic instability in Phaseolus vulgaris seedlings
Aydin, Murat; Taşpınar, Mahmut Sinan; Arslan, Esra; Yaǧci, Semra; Aǧar, Güleray
2017-04-01
The herbicide 3,6-dichloro-2-methoxybenzoic acid (dicamba) is principally used widely agriculture today. The widely use of dicamba in agriculture may represent a potential toxic risks to some crops. Thus, the present study aimed to evaluate the genotoxic effects of dicamba by using randomly amplified polymorphic DNA (RAPD) in Phaseolus vulgaris seedlings. The results showed that persistent DNA damage and decreased genomic template stability (GTS) induced by dicamba (0,2, 0,4 and 0,6 ppm).
Growth of Chlorella vulgaris and Nannochloris oculata in effluents of ...
African Journals Online (AJOL)
Microalgae were inoculated in photobioreactors in 6 L of medium (WTF or BBM) at an initial concentration of 1.0 × 106 cells ml-1 at 20 ± 2°C. The highest average cell density as well as the highest productivity of biomass observed in the treatments was C. vulgaris treatment in BBM and multi-LED lighting (8.83 × 107 cells ...
TRENDS OF SELF MEDICATION IN PATIENTS WITH ACNE VULGARIS
Tanzeela Khalid; Tariq Iqbal
2010-01-01
Back ground:Self medication is a norm in our country. One factor probably contributing to this phenomenonis over the counter sale of almost all medication without any regulation. In our dermatologypractice, we frequently encounter patients with acne vulgaris deteriorated by topical use of selfmedication. However, there is very little data to support this in our set up.Objective:To determine the percentage of acne patients using self medication in our population.Design:A cross-sectional survey...
Body Image Disturbance in Patients with Acne Vulgaris
Bowe, Whitney P.; Doyle, Amanda K.; CRERAND, CANICE E.; Margolis, David J.; Shalita, Alan R.
2011-01-01
Psychosocial outcome measures, which attempt to examine acne from the patient's perspective, have become increasingly important in dermatology research. One such measure is the Body Image Disturbance Questionnaire. The authors' primary aim was to determine the validity and internal consistency of the Body Image Disturbance Questionnaire in patients with acne vulgaris. The secondary aim was to investigate the relationship between body image disturbance and quality of life. This cross-sectional...
Novel pharmacological approaches for the treatment of acne vulgaris.
Valente Duarte de Sousa, Isabel Cristina
2014-10-01
Acne vulgaris is the most common skin disease worldwide; yet, current treatment options, although effective, are associated with unwanted side effects, chronicity, relapses and recurrences. The adequate control of the four pathogenic mechanisms, involved in the appearance of acne lesions, is paramount to treatment success. The authors discuss and evaluate the pathogenic pathways related to the mechanisms of action of novel molecules, which are currently under investigation for the treatment of acne vulgaris. The manuscript is based on comprehensive searches made through PubMed, GoogleScholar and ClinicalTrial.gov, using different combination of key words, which include acne vulgaris, pathogenesis, treatment, sebogenesis and Propionibacterium acnes. In the near future, more effective treatments with fewer side effects are expected. The use of topical antiandrogens, acetylcholine inhibitors and PPAR modulators seem to be promising options for controlling sebum production. Retinoic acid metabolism-blocking agents and IL-1α inhibitors have the potential to become legitimate alternative options to retinoid therapy in the management of infundibular dyskeratosis. Indeed, the authors believe that there will likely be a decline in the use of antibiotics for controlling P. acnes colonization and targeting the inflammation cascade.
Recycling of food waste as nutrients in Chlorella vulgaris cultivation.
Lau, Kin Yan; Pleissner, Daniel; Lin, Carol Sze Ki
2014-10-01
Heterotrophic cultivation of Chlorella vulgaris was investigated in food waste hydrolysate. The highest exponential growth rate in terms of biomass of 0.8day(-1) was obtained in a hydrolysate consisting of 17.9gL(-1) glucose, 0.1gL(-1) free amino nitrogen, 0.3gL(-1) phosphate and 4.8mgL(-1) nitrate, while the growth rate was reduced in higher concentrated hydrolysates. C. vulgaris utilized the nutrients recovered from food waste for the formation of biomass and 0.9g biomass was produced per gram glucose consumed. The microalgal biomass produced in nutrient sufficient batch cultures consisted of around 400mgg(-1) carbohydrates, 200mgg(-1) proteins and 200mgg(-1) lipids. The conversion of nutrients derived from food waste and the balanced biomass composition make C. vulgaris a promising strain for the recycling of food waste in food, feed and fuel productions. Copyright © 2014 Elsevier Ltd. All rights reserved.
Growth of Chlorella vulgaris and associated bacteria in photobioreactors.
Lakaniemi, Aino-Maija; Intihar, Veera M; Tuovinen, Olli H; Puhakka, Jaakko A
2012-01-01
The aim of this study was to test three flat plate photobioreactor configurations for growth of Chlorella vulgaris under non-axenic conditions and to characterize and quantify associated bacterial communities. The photobioreactor cultivations were conducted using tap water-based media to introduce background bacterial population. Growth of algae was monitored over time with three independent methods. Additionally, the quantity and quality of eukaryotes and bacteria were analysed using culture-independent molecular tools based on denaturing gradient gel electrophoresis (PCR-DGGE) and quantitative polymerase chain reaction (QPCR). Static mixers used in the flat plate photobioreactors did not generally enhance the growth at the low light intensities used. The maximum biomass concentration and maximum specific growth rate were 1.0 g l(-1) and 2.0 day(-1) respectively. Bacterial growth as determined by QPCR was associated with the growth of C. vulgaris. Based on PCR-DGGE, bacteria in the cultures mainly originated from the tap water. Bacterial community profiles were diverse but reproducible in all flat plate cultures. Most prominent bacteria in the C. vulgaris cultures belonged to the class Alphaproteobacteria and especially to the genus Sphingomonas. Analysis of the diversity of non-photosynthetic microorganisms in algal mass cultures can provide useful information on the public health aspects and unravel community interactions. © 2011 The Authors. Microbial Biotechnology © 2011 Society for Applied Microbiology and Blackwell Publishing Ltd.
Vitreoscilla hemoglobin gene ( vgb) improves lutein production in Chlorella vulgaris
Ma, Ruijuan; Lin, Xiangzhi
2014-03-01
Vitreoscilla hemoglobin is an oxygen-binding protein that promotes oxygen delivery and reduces oxygen consumption under low oxygen conditions to increase the efficiency of cell respiration and metabolism. In this study, we introduced a Vitreoscilla hemoglobin gene ( vgb) into Chlorella vulgaris by Agrobacterium tumefaciens -mediated transformation (ATMT). PCR analysis confirmed that the vgb gene was successfully integrated into the Chlorella vulgaris genome. Analysis of biomass obtained in shake flasks revealed transformant biomass concentrations as high as 3.28 g/L, which was 38.81% higher than that of the wild-type strain. Lutein content of transformants also increased slightly. Further experiments recovered a maximum lutein yield of 2.91 mg/L from the transformants, which was 36.77% higher than that of the wild-type strain. The above results suggest that integrated expression of the vgb gene may improve cell growth and lutein yield in Chlorella vulgaris, with applications to lutein production from Chlorella during fermentation.
ORAL ANTIBIOTICS IN ACNE VULGARIS: THERAPEUTIC RESPONSE OVER 5 YEARS
Directory of Open Access Journals (Sweden)
ROSHIDAH B
2010-01-01
Full Text Available Introduction: Antibiotic resistant P. acnes have influenced acne therapy worldwide resulting in increased use of topicaland systemic retinoids. Judicious use of oral antibiotic is important for effective therapeutic outcome. Objectives: To determine the response and side effects of oral antibiotic treatment in acne vulgaris. To determine the typeof antibiotic used, therapy duration and the types of concomitant topical therapy. Methods: Retrospective analysis of the therapeutic response to oral antibiotics therapy in acne vulgaris in the Dermatology Department, Hospital Kuala Lumpur. New cases of acne vulgaris from 2005 to 2009 were randomly selected. The clinical notes of 250 patients treated with oral antibiotics were reviewed. Results: About 60% of patients achieved good to excellent response to therapy while satisfactory response was seen in 26%. Only 8% patients experienced minor side effects. Doxycycline was the most frequently prescribed antibiotic, followed by tetracycline and erythromycin ethylsuccinate. The prescribing pattern was consistent over the years. The mean duration of treatment is four to five months. Oral antibiotic was augmented with topical therapy in 98.8% of patients. Conclusion: Good to excellent therapeutic response was achieved in the majority of patients and results observed have remained stable over the last five years.
Photon up-conversion increases biomass yield in Chlorella vulgaris.
Menon, Kavya R; Jose, Steffi; Suraishkumar, Gadi K
2014-12-01
Photon up-conversion, a process whereby lower energy radiations are converted to higher energy levels via the use of appropriate phosphor systems, was employed as a novel strategy for improving microalgal growth and lipid productivity. Photon up-conversion enables the utilization of regions of the solar spectrum, beyond the typical photosynthetically active radiation, that are usually wasted or are damaging to the algae. The effects of up-conversion of red light by two distinct sets of up-conversion phosphors were studied in the model microalgae Chlorella vulgaris. Up-conversion by set 1 phosphors led to a 2.85 fold increase in biomass concentration and a 3.2 fold increase in specific growth rate of the microalgae. While up-conversion by set 2 phosphors resulted in a 30% increase in biomass and 12% increase in specific intracellular neutral lipid, while the specific growth rates were comparable to that of the control. Furthermore, up-conversion resulted in higher levels of specific intracellular reactive oxygen species in C. vulgaris. Up-conversion of red light (654 nm) was shown to improve biomass yields in C. vulgaris. In principle, up-conversion can be used to increase the utilization range of the electromagnetic spectrum for improved cultivation of photosynthetic systems such as plants, algae, and microalgae. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Growth of Chlorella vulgaris and associated bacteria in photobioreactors
Lakaniemi, Aino‐Maija; Intihar, Veera M.; Tuovinen, Olli H.; Puhakka, Jaakko A.
2012-01-01
Summary The aim of this study was to test three flat plate photobioreactor configurations for growth of Chlorella vulgaris under non‐axenic conditions and to characterize and quantify associated bacterial communities. The photobioreactor cultivations were conducted using tap water‐based media to introduce background bacterial population. Growth of algae was monitored over time with three independent methods. Additionally, the quantity and quality of eukaryotes and bacteria were analysed using culture‐independent molecular tools based on denaturing gradient gel electrophoresis (PCR‐DGGE) and quantitative polymerase chain reaction (QPCR). Static mixers used in the flat plate photobioreactors did not generally enhance the growth at the low light intensities used. The maximum biomass concentration and maximum specific growth rate were 1.0 g l−1 and 2.0 day−1 respectively. Bacterial growth as determined by QPCR was associated with the growth of C. vulgaris. Based on PCR‐DGGE, bacteria in the cultures mainly originated from the tap water. Bacterial community profiles were diverse but reproducible in all flat plate cultures. Most prominent bacteria in the C. vulgaris cultures belonged to the class Alphaproteobacteria and especially to the genus Sphingomonas. Analysis of the diversity of non‐photosynthetic microorganisms in algal mass cultures can provide useful information on the public health aspects and unravel community interactions. PMID:21936882
Photosynthetic and cellular toxicity of cadmium in Chlorella vulgaris.
Ou-Yang, Hui-Ling; Kong, Xiang-Zhen; Lavoie, Michel; He, Wei; Qin, Ning; He, Qi-Shuang; Yang, Bin; Wang, Rong; Xu, Fu-Liu
2013-12-01
The toxic effects of cadmium (Cd) on the green alga Chlorella vulgaris were investigated by following the response to Cd of various toxicity endpoints (cell growth, cell size, photochemical efficiency of PSII in the light or Φ(PSII), maximal photochemical efficiency or Fv/Fm, chlorophyll a fluorescence, esterase activity, and cell viability). These toxicity endpoints were studied in laboratory batch cultures of C. vulgaris over a long-term 96-h exposure to different Cd concentrations using flow cytometry and pulse amplitude modulated fluorometry. The sequence of sensitivity of these toxicity endpoints was: cell yield > Φ(PSII) ≈ esterase activity > Fv/Fm > chlorophyll a fluorescence ≈ cell viability. It is shown that cell apoptosis or cell death only accounted for a minor part of the reduction in cell yield even at very high algistatic free Cd²⁺ concentrations, and other mechanisms such as blocked cell divisions are major contributors to cell yield inhibition. Furthermore, cadmium may affect both the electron donors and acceptors of the electron transport chain at high free Cd²⁺ concentration. Finally, the resistance of cells to cell death was size-dependent; medium-sized cells had the highest toxicity threshold. The present study brings new insights into the toxicity mechanisms of Cd in C. vulgaris and provides a detailed comparison of the sensitivity of various Cd toxicity endpoints. © 2013 SETAC.
Lipid production of Chlorella vulgaris cultured in artificial wastewater medium.
Feng, Yujie; Li, Chao; Zhang, Dawei
2011-01-01
Chlorella vulgaris was used to study algal lipid production with wastewater treatment. Artificial wastewater was used to cultivate C. vulgaris in a column aeration photobioreactor (CAP) under batch and semi-continuous cultivation with various daily culture replacements (0.5l-1.5l per 2l reactor). The cell density was decreased from 0.89 g/l with the daily replacement of 0.5l to 0.28 g/l with 1.5l replacement. However, C. vulgaris culture achieved the highest lipid content (42%, average value of the phase) and the lipid productivity (147 mg/ld(-1)) with daily replacement of 1.0 l. And then the nutrient removal efficiency were 86% (COD), 97% (NH(4)(+)) and 96% (TP), respectively. Analyses of energy efficiency showed that the net energy ratio (NER) for lipid production with daily replacement of 1.0 l (1.25) was higher than the other volume replacement protocols. And cost analyses showed that the algal biomass can be competitive with petroleum at US$ 63.97 per barrel with the potential credit for wastewater treatment. According to the above results, it is concluded that the present research will lead to an economical technology of algal lipid production. Copyright © 2010 Elsevier Ltd. All rights reserved.
Enhancement of hydrolysis of Chlorella vulgaris by hydrochloric acid.
Park, Charnho; Lee, Ja Hyun; Yang, Xiaoguang; Yoo, Hah Young; Lee, Ju Hun; Lee, Soo Kweon; Kim, Seung Wook
2016-06-01
Chlorella vulgaris is considered as one of the potential sources of biomass for bio-based products because it consists of large amounts of carbohydrates. In this study, hydrothermal acid hydrolysis with five different acids (hydrochloric acid, nitric acid, peracetic acid, phosphoric acid, and sulfuric acid) was carried out to produce fermentable sugars (glucose, galactose). The hydrothermal acid hydrolysis by hydrochloric acid showed the highest sugar production. C. vulgaris was hydrolyzed with various concentrations of hydrochloric acid [0.5-10 % (w/w)] and microalgal biomass [20-140 g/L (w/v)] at 121 °C for 20 min. Among the concentrations examined, 2 % hydrochloric acid with 100 g/L biomass yielded the highest conversion of carbohydrates (92.5 %) into reducing sugars. The hydrolysate thus produced from C. vulgaris was fermented using the yeast Brettanomyces custersii H1-603 and obtained bioethanol yield of 0.37 g/g of algal sugars.
A systematic review of benzoyl peroxide for acne vulgaris.
Mohd Nor, Noor Hidayah; Aziz, Zoriah
2013-10-01
Comparative trials of benzoyl peroxide (BPO) have yielded contradictory results on its effectiveness for acne vulgaris. The aim of the study was to synthesise the evidence for the effectiveness of BPO-containing topical products for facial acne vulgaris. Systematic review. The Cochrane Central Register of Controlled trials, Cochrane Library, MEDLINE and other relevant databases were searched without publication date or language restriction. We identified 22 trials involving 2212 participants; 12 trials compared BPO as single agent while the other 10 trials compared BPO in combination products. All trials reported lesion count as the outcome measure but only five trials provided numerical data. However, pooling of data from these trials was inappropriate due to variations between trials in terms of acne severity, comparator used and trial duration. Overall the study quality was fair but most studies had some bias particularly in method of random generation and allocation concealment. Although the results provide some evidence that BPO reduces acne-lesion count, the available evidence is not robust enough for firm conclusions. There is no high quality evidence that topical BPO improves facial acne vulgaris, and further research is needed.
Metastasized squamous cell carcinoma developed on lupus vulgaris.
Pătraşcu, V; Georgescu, Claudia Valentina; Tănase, Loredana Elena; Mogoantă, S S
2008-01-01
Lupus vulgaris (LV) is the most frequent cutaneous tuberculosis, representing more than 55% of the tuberculoses with this location. Malignization can occur after a long latency (10-30 years), in 1-2% of the cases, and it is mainly in squamous cell carcinoma. The histological exam is highly important in the observation of neoplasic transformations. The authors present a 59-years-old female patient, from the rural environment, working as a farmer, with lupus vulgaris developing since her first childhood years. It started at the age of 2 years, at the right ear lobule, after the empiric perforation for earrings. The evolution was progressive, eccentric, interesting the pinna and the right cheek in the meanwhile. At the first examination, in 2002, a diffuse mass of red-yellowish infiltration was found at the level of the right ear and the right cheek. In the following two years, an ulcero-vegetating tumor developed at the level of the right ear lobule, accompanied by the presence of a right retromandibular adenopathy, of about 1 cm, which was proved by the histopathologic exam to be a squamous cell carcinoma developed from a lupus vulgaris. After scraping out the right retromandibular ganglion, detected by palpation, a histological exam showed ganglion metastasis.
Profile of acne vulgaris-A hospital-based study from South India
Directory of Open Access Journals (Sweden)
Adityan Balaji
2009-01-01
Full Text Available Background: Acne vulgaris is believed to be the most common disease of the skin. There is no Indian study on the profile of acne vulgaris, markers of severe forms of acne vulgaris and a possible correlation between acne vulgaris and markers of androgenicity in females. Aim: To study the profile of acne vulgaris, its seasonal variation, relationship with smoking and possible correlation between acne vulgaris and markers of androgenicity in females. Methods: The study was conducted between August 2006 and June 2008. All patients with acne vulgaris who consented to participate in the study were included. The parameters evaluated included age, gender, age of onset, duration of lesions, site of lesions, grade, relation with menstrual cycle, markers of androgenicity, number of acne lesions such as comedones, papules pustules and nodules, number and site of post-acne scarring, post-acne hyperpigmentation, seasonal variation and history of smoking. Results: A total of 309 patients with acne vulgaris were included in the study. The frequency of acne vulgaris in our study was 1.068%. Mean age of the study group was 19.78 years. Male to female ratio was 1.25:1. The most common age group involved was 16 to 20 years (59.8%. Mean age of onset was 15.97 years. Face was involved in all the patients, followed by back (28.2%, chest (20.1%, neck (9.4% and arms (10%. In the older age groups, women were more likely to report having acne vulgaris than men ( P = 0.01. The closed comedones outnumbered open comedones by a factor of 4.9:1. A total of 186 patients (60.2% had grade 1 acne vulgaris, 85 (27.5% had grade 2 acne, 8 (2.6% had grade 3 acne and 30 (9.7% had grade 4 acne vulgaris. There was a higher incidence of scarring (39.5% and post-acne hyperpigmentation (24.6% in our study. In female patients, 57.7% had premenstrual flare and 12.4% had cutaneous markers of androgenicity. There was no association between severity of acne vulgaris and other markers of
Rostami Mogaddam, Majid; Safavi Ardabili, Nastaran; Maleki, Nasrollah; Soflaee, Maedeh
2014-01-01
Acne vulgaris is the most common cutaneous disorder affecting adolescents and young adults. Some studies have reported an association between serum zinc levels and acne vulgaris. We aimed to evaluate the serum zinc level in patients with acne vulgaris and compare it with healthy controls. One hundred patients with acne vulgaris and 100 healthy controls were referred to our clinic. Acne severity was classified according to Global Acne Grading System (GAGS). Atomic absorption spectrophotometry ...
Panjaitan, Joice Sonya
2011-01-01
Background Acne vulgaris is a skin disease that is commonly found in the community. Acne vulgaris has been known had a complex pathogenesis and IGF-1 was allegedly had a role in the pathogenesis of acne vulgaris. IGF-1 can enhance keratinocyte cell proliferation and increase sebum production. However, the role of IGF-1 in the various degree of acne vulgaris severity remains unclear. Objective To determine the correlation between the serum IGF-1 level and the severity degree of acne ...
Andre Gassmann; Rosemarie De Clerck-Floate; Sharlene Sing; Ivo Tosevski; Milana Mitrovic; Olivier Krstic
2014-01-01
Linaria vulgaris Mill. (Plantaginaceae), common or yellow toadflax, is a Eurasian short-lived perennial forb invasive throughout temperate North America. Rhinusa pilosa (Gyllenhal) (Coleoptera, Curculionidae) is a univoltine shoot-galling weevil found exclusively on L. vulgaris in Europe. Under no-choice test conditions, 13 non-native Linaria species exposed toR....
The response of Acne vulgaris to antibiotics both oral and topical | Al ...
African Journals Online (AJOL)
Background: Acne vulgaris is a chronic inflammatory skin disease that involves pilosebaceous units. Many systemic treatments used for acne vulgaris such as antibiotics, hormonal therapy, isotretinoin and occasionally, corticosteroids. Oral azithromycin has been advocated by some in the treatment of acne, but its efficacy ...
Effect of uranium uptake on oxidative stress reactions for Phaseolus vulgaris
Cuypers, Ann; Vandenhove, H.; Hees, M.; Wannijn, J.
2005-01-01
The present study aims to analyze the biological effects induced by bioaccumulation of uranium by Phaseolus vulgaris. Following a 1 week exposure, plant development and the capacity of enzymes involved in the anti-oxidative defense mechanism of the plant were analyzed. uranium; oxidative stress; Phaseolus vulgaris; uptake; hydroponics
Anti-ulcer activity of fruit of Lagenaria vulgaris | Patil | Nigerian ...
African Journals Online (AJOL)
Anti-ulcer activity of fruit of Lagenaria vulgaris. Kalpana S Patil, Sunil V Garad. Abstract. Petroleum ether (40-600), chloroform, alcohol and aqueous extract of Lagenaria vulgaris fruits have been evaluated for its anti-ulcer activity by using pylorus ligation method in rats. Doses for the different extracts were selected based on ...
Directory of Open Access Journals (Sweden)
MAHENDRA RAI
2012-07-01
Full Text Available Kon K, Rai M. 2012. Antibacterial activity of Thymus vulgaris essential oil alone and in combination with other essential oils. Nusantara Bioscience 4: 50-56. Essential oils (EOs from plants represent an alternative approach in combating antibiotic-resistant bacteria. One of the EOs with proven antibacterial properties is Thymus vulgaris EO. The purpose of the present work was to investigate in vitro antibacterial activity of T. vulgaris EO alone and in combination with other EOs. The activity of T. vulgaris EO was screened in combination with 34 EOs against Staphylococcus aureus and Escherichia coli by disk diffusion method; then the most effective combinations were evaluated by broth microdilution method. Against S. aureus the synergistic effect was found in combination of T. vulgaris and Cinnamomum zeylonicum EOs with fractional inhibitory concentration (FIC index of 0.26; Juniperus communis and Picea abies EOs showed additive effect (FIC indexes were 0.74 and 0.78, respectively. Combination of T. vulgaris EO with Aniba rosaeodora and Melissa officinalis EOs demonstrated synergistic effect against E. coli (FIC indexes were 0.23 and 0.34, respectively; combination of T. vulgaris and Mentha piperita EOs was additive (FIC index 0.55. Therefore, combining T. vulgaris EO with other EOs has potential in further enhancing its antibacterial properties.
Njoo, M. D.; Das, P. K.; Bos, J. D.; Westerhof, W.
1999-01-01
To investigate the association between the experimentally induced Kobner phenomenon (KP-e) and the Kobner phenomenon by history (KP-h), disease activity, and therapeutic responsiveness in vitiligo vulgaris. Cohort study. An outpatient clinic. Sixty-one consecutive patients with vitiligo vulgaris.
Effect of gene transfer of Chlorella vulgaris n-3 fatty acid desaturase ...
African Journals Online (AJOL)
Chlorella vulgaris had the gene of n-3 fatty acid desaturase (CvFad3) which can synthesize the precursor of n-3 polyunsaturated fatty acids (PUFAs) or to convert n-6 to n-3 PUFAs. The objective of this study was to examine whether the CvFad3 gene from C. vulgaris can be functionally expressed in mammalian cells and ...
Chen, Shan-Jia; Chen, Xiu-Rong; Yan, Long; Zhao, Jian-Guo; Zhang, Fei; Jiang, Zi-Jian
2014-04-01
The effects of different concentrations of bisphenol A (BPA) on Chlorella vulgaris and removal capacity of BPA by Chlorella vulgaris were investigated. Results showed that a low concentration (0-20 mg x L(-1)) of BPA promoted the growth of Chlorella vulgaris, whereas a relative high concentration (20-50 mg x L(-1)) of BPA inhibited the growth of Chlorella vulgaris, and the inhibition effect was positively correlated with the concentration of BPA. Likewise, a high dose of initial BPA (> 20 mg x L(-1)) led to a decline in the content of chlorephyll a. Chlorella vulgaris had BPA removal capacity when initial BPA concentration ranged from 2 mg x L(-1) to 50 mg x L(-1). There was positive correlation between the removal rate of BPA per cell and initial BPA concentration. The removal rate of BPA was the highest when initial BPA was 50 mg x L(-1), which appeared between lag phase and logarithmic phase.
Co-pyrolysis characteristics of microalgae Chlorella vulgaris and coal through TGA.
Chen, Chunxiang; Ma, Xiaoqian; He, Yao
2012-08-01
To find out an alternative of coal saving, a kind of microalgae, Chlorella vulgaris (C. vulgaris) which is widespread in fresh water was introduced into coal pyrolysis process. In this work, the pyrolysis experiments of C. vulgaris and coal blend (CCB) were carried out by TGA, and those of C. vulgaris and coal were also taken respectively as control groups. It was found that: the TG and DTG profiles of CCB were similar to C. vulgaris, but different from coal under various blending ratios; DTG profiles of CCB were different at several heating rates; interaction was observed between the solid phases of CCB; kinetic triplets were determined by the Kissinger-Akahira-Sunose (KAS), Flynn-Wall-Ozawa (FWO), and master-plots method, respectively. The results provide a reference for further study on co-pyrolysis of microalgae and coal to a certain extent. Crown Copyright © 2012. Published by Elsevier Ltd. All rights reserved.
Naylor, Mary; Keating, Stacen A.
2008-01-01
Transitional care encompasses a broad range of services and environments designed to promote the safe and timely passage of patients between levels of health care and across care settings. High-quality transitional care is especially important for older adults with multiple chronic conditions and complex therapeutic regimens, as well as for their…
Directory of Open Access Journals (Sweden)
Anísio Azzini
1979-01-01
Full Text Available Em condições de laboratório foram produzidas pastas celulósicas pelo processo alcalino monossulfito, com várias concentrações dos reagentes químicos, sulfito de sódio e licor-verde sulfato. As propriedades dessas celuloses foram comparadas com aquelas da celulose obtida pelo processo sulfato (kraft de uso generalizado pela indústria de celulose e papel. As características físico-mecânicas e ópticas das celuloses monossulfito e sulfato foram satisfatórias e semelhantes, com exceção da resistência ao rasgo, que na celulose sulfato foi maior. Os cavacos utilizados, nas dimensões de 5,5 x 0,8 x 0,5cm, respectivamente para comprimento, largura e espessura, foram adequados ao processo sulfato e inadequados às condições do processo monossulfito, que produziu celulose com menor rendimento depurado, maior porcentagem de rejeitos e maior teor de lignina residual nas fibras, determinado pelo número kappa. A densidade básica e as dimensões das fibras variaram no sentido radial do colmo, principalmente a densidade básica, cujos valores decresceram acentuadamente da camada externa para a interna.Pulps in laboratory conditions were obtained from Bambusa vulgaris Schrad by the alkaline monosulphite process, with various concentrations of the cooking chemicals. The strength properties of these pulps were compared to those obtained by the sulphate process. The results showed that both pulps were similar, excepting the tear resistance that was higher in the sulphate one. It was observed that chips with 5.5 x 0.8 x 0.5cm, respectively to the length, width and thickness were appropriated to the sulphate process but not to the conditions of the alkaline monosulphate process, which produced pulps with low values in terms of screening yield, percentage of screenings and kappa number. The variability of bamboo culm in the radial direction was also determined regarding basic density and fiber dimensions. The results showed variations in those
Potential Health Effects of Enzymatic Protein Hydrolysates from Chlorella vulgaris
Directory of Open Access Journals (Sweden)
Mahsa Sedighi
2016-06-01
Full Text Available Background and Objective: Chlorella vulgaris is a multi-cellular edible algal species with abundant proteins. Extraction of high value protein fractions for pharmaceutical and nutritional applications can significantly increase the commercial value of microalga biomasses. There is no known report on the anticancer peptides derived from the Chlorella vulgaris abundant protein.Materials and Methods: This study examined the antimicrobial and anticancer effects of peptides from a hydrolyzed Chlorella vulgaris protein with 62 kDa molecular weight. Protein hydrolysis was done by pepsin as a gastrointestinal protease, and was monitored through protein content measurement, sodium dodecyl sulfate polyacrylamide gel electrophoresis, and high performance liquidchromatography measurements. Inhibitory effect of the produced peptides on Escherichia coli cells and breast cancer cell lines was assayed.Results and Conclusion: Hydrolyzed peptides induced a decrease of about 34.1% in the growth of Escherichia coli, and the peptides of 3 to 5 kDa molecular weight had strong impact on the viability of breast cancer cells with IC50 value of 50 μg μl-1. The peptide fractions demonstrating antimicrobial and anti-cancer activities have the potential for use as functional food ingredients for health benefits. These results demonstrate that inexpensive algae proteinscould be a new alternative to produce anticancer peptides.Conflict of interest: The authors declare that there is no conflict of interest.
Managing nonteratogenic adverse reactions to isotretinoin treatment for acne vulgaris.
Reilly, Bridget K; Ritsema, Tamara S
2015-07-01
Isotretinoin is the strongest, most effective oral treatment for patients with severe acne vulgaris, with remission rates of 89% and higher. Because of its potency, isotretinoin causes many adverse reactions. This article reviews common and severe adverse reactions to isotretinoin and how providers can best manage these reactions. Because of inconclusive research on the correlation between isotretinoin and depression and irritable bowel syndrome, providers should ask patients about symptoms monthly. Prescribing micronized isotretinoin and starting at the lowest dose with gradual upward titration also can help reduce the incidence of adverse reactions.
Newer topical therapies for the treatment of acne vulgaris.
Del Rosso, James Q
2007-11-01
Newer topical therapies approved by the US Food and Drug Administration (FDA) for the treatment of acne vulgaris are dapsone gel 5% and clindamycin phosphate 1.2% and tretinoin 0.025% combination gel. Both are formulated in aqueous-based gel vehicles. These newer topical acne products have been shown to be effective and safe in pivotal 12-week phase 3 trials and long-term studies completed over 12 months. This article reviews applicable pharmacokinetic, efficacy, and safety data reported with both products.
Supercritical CO2 extraction of essential oils from Thymus vulgaris
Directory of Open Access Journals (Sweden)
S.A.B. Vieira de Melo
2000-09-01
Full Text Available Supercritical CO2 extraction of essential oil from Thymus vulgaris leaves was studied using experimental data recently obtained in the Florys S.p.A. laboratory. Mass transfer coefficients in the supercritical and solid phases from extraction curves at 40°C and 20 MPa were evaluated using a mathematical model based on the local adsorption equilibrium of essential oil on lipid in leaves. The adsorption equilibrium constant was fitted to these experimental data, and internal and external mass transfer resistances were calculated, allowing identification of the mechanism controlling the extraction process.
Spina ventosa with lupus vulgaris and lymphadenopathy: Multifocal tuberculosis
Directory of Open Access Journals (Sweden)
Sanjeev Sharma
2015-01-01
Full Text Available Tuberculous dactylitis is a rare yet well-recognized disease of small bones of the hands and feet. It occurs in young children below five years of age. Tubercular dactylitis with lupus vulgaris and lymphadenopathy was suspected clinically and radiologically in an 8-year-old girl who had multiple soft tissue swelling of hands and feet with ulceration, encrustations, and an atrophic scar with lytic expansile lesions of the small bones of the hands and feet. Tubercular lymph node involvement was confirmed histopathologically.
Lupus vulgaris with tubercular lymphadenitis and IgA nephropathy.
Khaira, Ambar; Rathi, Om P; Mahajan, Sandeep; Sharma, Alok; Dinda, Amit K; Tiwari, Suresh C
2008-02-01
A 14-year-old girl presented with a 10-year history of a large crusted plaque over the right thigh for 10 years and small reddish plaque over the left upper back for 3 months. On routine evaluation, she was found to have hematuria. Skin biopsy from the lesion was suggestive of skin tuberculosis (lupus vulgaris), and kidney biopsy showed features of IgA nephropathy (IgAN). Fine-needle aspiration from the inguinal lymph node was consistent with granulomatous disease. The patient has been on anti-tubercular treatment, and the hematuria has subsided.
Ulcerative lupus vulgaris over nose, leading to cosmetic deformity.
Nair, Pragya A; Mehta, Malay J; Patel, Bhumi B
2015-01-01
Lupus vulgaris (LV), is a chronic and progressive form of secondary cutaneous tuberculosis. In India, it is commonly seen over buttocks, thighs, and legs whereas involvement of nose is quite rare. Ulcerative variant particularly over nose causes destruction of cartilage, leading to irreversible deformities and contracture. High-index of suspicion is required for early diagnosis and prevention of cosmetic deformity. A case of LV over nose in a young male with ulceration is reported who responded well to anti-tubercular therapy, but left with scarring of nose, which could have been prevented if adequate awareness regarding extra-pulmonary cases would have been practiced.
Effect of the Glycemic Index of Carbohydrates on Acne vulgaris
Jennie C. Brand-Miller; Peter Petocz; Stockmann, Karola S.; Atkinson, Fiona S.; Choi, James Y. J.; Stephen Lee; Reynolds, Rebecca C.
2010-01-01
Acne vulgaris may be improved by dietary factors that increase insulin sensitivity. We hypothesized that a low-glycemic index diet would improve facial acne severity and insulin sensitivity. Fifty-eight adolescent males (mean age ± standard deviation 16.5 ± 1.0 y and body mass index 23.1 ± 3.5 kg/m2) were alternately allocated to high or low glycemic index diets. Severity of inflammatory lesions on the face, insulin sensitivity (homeostasis modeling assessment of insulin resistance), androgen...
Novel protocol for lutein extraction from microalga Chlorella vulgaris
DEFF Research Database (Denmark)
D'Este, Martina; De Francisci, Davide; Angelidaki, Irini
2017-01-01
Lutein is a pigment generally extracted from marigold flowers. However, lutein is also found in considerable amounts in microalgae. In this study a novel method was developed to improve the extraction efficiency of lutein from microalga C. vulgaris. Differently from conventional methods, ethanol...... purity was increased from 73.6% to 93.7% by decreasing the ethanol-water ratio from 85% to 50% in the resolubilization step. The novel method was also tested with tetrahydrofuran. The extraction proved to be again more effective than the conventional one; however dichloromethane outperformed...
Spina ventosa with lupus vulgaris and lymphadenopathy: Multifocal tuberculosis.
Sharma, Sanjeev; Sood, Shikha; Gupta, Mudita
2015-12-01
Tuberculous dactylitis is a rare yet well-recognized disease of small bones of the hands and feet. It occurs in young children below five years of age. Tubercular dactylitis with lupus vulgaris and lymphadenopathy was suspected clinically and radiologically in an 8-year-old girl who had multiple soft tissue swelling of hands and feet with ulceration, encrustations, and an atrophic scar with lytic expansile lesions of the small bones of the hands and feet. Tubercular lymph node involvement was confirmed histopathologically.
The Paleobiolinguistics of the Common Bean (Phaseolus vulgaris L.
Directory of Open Access Journals (Sweden)
Cecil H. Brown
2014-10-01
Full Text Available Paleobiolinguistics is used to determine when and where the common bean (Phaseolus vulgaris L. developed significance for prehistoric groups of Native America. Dates and locations of proto-languages for which common bean terms reconstruct generally accord with crop-origin and dispersal information from plant genetics and archaeobotany. Paleobiolinguistic and other lines of evidence indicate that human interest in the common bean became significant primarily with the widespread development of a village‐farming way of life in the New World rather than earlier when squash and maize and a few other crops became important.
Luelsdorff, P A
1992-01-01
In classic generative grammar a distinction is drawn between linguistic 'competence' and linguistic 'performance', the former referring to linguistic knowledge, the latter to how linguistic knowledge is used. However, this controversial differentiation obscures the additional dichotomy between linguistic knowledge for production and linguistic knowledge for recognition. In this article it is shown that production and recognition differ, that recognition is not simply the inverse of production, and that the derivation of production from recognition and recognition from production require a small set of generalizable 'transitional determinacies'. Secondly, it is shown that transitional determinacies explain the difference between 'overt' and 'covert' recognition recently observed in prosopagnosics, patients unable to recognize familiar faces. Prosopagnosics and normals are found to differ in their transitional determinacies, such that prosopagnosics require more binders (precisors) for covert recognition than normals. In general, it is concluded that transitional determinacies are as necessary to the theory of grammar as determinacies themselves.
Inhibitory effects of Iranian Thymus vulgaris extracts on in vitro growth of Entamoeba histolytica.
Behnia, Maryam; Haghighi, Ali; Komeylizadeh, Hossein; Tabaei, Seyyed-Javadi Seyyed; Abadi, Alireza
2008-09-01
One of the most common drugs used against a wide variety of anaerobic protozoan parasites is metronidazole. However, this drug is mutagenic for bacteria and is a potent carcinogen for rodents. Thymus vulgaris is used for cough suppression and relief of dyspepsia. Also it has antibacterial and antifungal properties. The aim of this study was to investigate antiamebic effect of Thymus vulgaris against Entamoeba histolytica in comparison with metronidazole. One hundred gram air-dried T. vulgaris plant was obtained and macerated at 25 degrees C for 14 days using n-hexane and a mixture of ethanol and water. For essential oil isolation T. vulgaris was subjected to hydrodistillation using a clevenger-type apparatus for 3 hr. E. histolytica, HM-1: IMSS strain was used in all experiments. It was found that the minimal inhibitory concentration (MIC) for T. vulgaris hydroalcoholic, hexanic extracts, and the essential oil after 24 hr was 4 mg/mL, 4 mg/mL, and 0.7 mg/mL, respectively. After 48 hr the MIC for T. vulgaris hydroalcoholic and hexanic extracts was 3 and 3 mg/mL, respectively. Therefore, it can be concluded that the Iranian T. vulgaris is effective against the trophozoites of E. histolytica.
Efficacy and safety of superficial chemical peeling in treatment of active acne vulgaris*
Al-Talib, Hassanain; Al-khateeb, Alyaa; Hameed, Ayad; Murugaiah, Chandrika
2017-01-01
Acne vulgaris is an extremely common condition affecting the pilosebaceous unit of the skin and characterized by presence of comedones, papules, pustules, nodules, cysts, which might result in permanent scars. Acne vulgaris commonly involve adolescents and young age groups. Active acne vulgaris is usually associated with several complications like hyper or hypopigmentation, scar formation and skin disfigurement. Previous studies have targeted the efficiency and safety of local and systemic agents in the treatment of active acne vulgaris. Superficial chemical peeling is a skin-wounding procedure which might cause some potentially undesirable adverse events. This study was conducted to review the efficacy and safety of superficial chemical peeling in the treatment of active acne vulgaris. It is a structured review of an earlier seven articles meeting the inclusion and exclusion criteria. The clinical assessments were based on pretreatment and post-treatment comparisons and the role of superficial chemical peeling in reduction of papules, pustules and comedones in active acne vulgaris. This study showed that almost all patients tolerated well the chemical peeling procedures despite a mild discomfort, burning, irritation and erythema have been reported; also the incidence of major adverse events was very low and easily manageable. In conclusion, chemical peeling with glycolic acid is a well-tolerated and safe treatment modality in active acne vulgaris while salicylic acid peels is a more convenient for treatment of darker skin patients and it showed significant and earlier improvement than glycolic acid PMID:28538881
Efficacy and safety of superficial chemical peeling in treatment of active acne vulgaris.
Al-Talib, Hassanain; Al-Khateeb, Alyaa; Hameed, Ayad; Murugaiah, Chandrika
2017-01-01
Acne vulgaris is an extremely common condition affecting the pilosebaceous unit of the skin and characterized by presence of comedones, papules, pustules, nodules, cysts, which might result in permanent scars. Acne vulgaris commonly involve adolescents and young age groups. Active acne vulgaris is usually associated with several complications like hyper or hypopigmentation, scar formation and skin disfigurement. Previous studies have targeted the efficiency and safety of local and systemic agents in the treatment of active acne vulgaris. Superficial chemical peeling is a skin-wounding procedure which might cause some potentially undesirable adverse events. This study was conducted to review the efficacy and safety of superficial chemical peeling in the treatment of active acne vulgaris. It is a structured review of an earlier seven articles meeting the inclusion and exclusion criteria. The clinical assessments were based on pretreatment and post-treatment comparisons and the role of superficial chemical peeling in reduction of papules, pustules and comedones in active acne vulgaris. This study showed that almost all patients tolerated well the chemical peeling procedures despite a mild discomfort, burning, irritation and erythema have been reported; also the incidence of major adverse events was very low and easily manageable. In conclusion, chemical peeling with glycolic acid is a well-tolerated and safe treatment modality in active acne vulgaris while salicylic acid peels is a more convenient for treatment of darker skin patients and it showed significant and earlier improvement than glycolic acid.
Chen, Xueqing; Pei, Yuansheng
2016-10-01
Sodium pentaborate pentahydrate (SPP) is a rare mineral. In this study, SPP was synthesized from boric acid and borax through low-temperature crystallization, and its effects on the growth of the alga, Chlorella vulgaris (C. vulgaris) were assessed. The newly synthesized SPP was characterized by chemical analysis, X-ray diffraction, Fourier-transform infrared spectroscopy, Raman spectroscopy, thermogravimetric analysis, and differential thermal analysis. The changes in C. vulgaris growth, chlorophyll content, and enzyme activities upon exposure to SPP for 168h were evaluated. Results showed that SPP treatment was detrimental to C. vulgaris growth during the first 24-120h of exposure. The harmful effects, however, diminished over time (168h), even at an effective medium concentration of 226.37mg BL(-1) (the concentration of boron applied per liter of culture medium). A similar trend was observed for chlorophyll content (chlorophyll a and b) and indicated that the photosynthesis of C. vulgaris was not affected and that high levels of SPP may even promote chlorophyll synthesis. Superoxide dismutase and catalase activities of C. vulgaris increased during 24-120h exposure to SPP, but these activities gradually decreased as culture time progressed. In other words, the initial detrimental effects of synthetic SPP on C. vulgaris were temporary and reversible. This research provides a scientific basis for applications of SPP in the environment. Copyright © 2016 Elsevier Inc. All rights reserved.
A meta-analysis of association between acne vulgaris and Demodex infestation.
Zhao, Ya-E; Hu, Li; Wu, Li-Ping; Ma, Jun-Xian
2012-03-01
Until now, etiology of acne vulgaris is still uncertain. Although clinicians usually deny the association between Demodex infestation and acne vulgaris, it has been proved in some clinical practices. To confirm the association between Demodex infestation and acne vulgaris, a meta-analysis was conducted. Predefined selection criteria were applied to search all published papers that analyzed the association between Demodex infestation and acne vulgaris (January 1950 to August 2011) in ISI Web of Knowledge, MEDLINE, and China National Knowledge Infrastructure (CNKI) databases. A meta-analysis was performed to calculate odds ratios (ORs) and 95% confidence intervals (CIs) based on fixed effects models or random effects models. We enrolled the 60 Chinese and 3 English papers in this meta-analysis, which covered Turkey and 25 different provinces/municipalities in China and 42130 participants including students and residents, aged from 1 to 78 years. The pooled OR in random effects models is 2.80 (95% CI, 2.34-3.36). Stability is robust according to sensitivity analysis. The fail-safe number is 18477, suggesting that at least 18477 articles with negative conclusions would be needed to reverse the conclusion that acne vulgaris was related to Demodex infestation. So the effect of publication bias was insignificant and could be ignored. It was concluded that acne vulgaris is associated with Demodex infestation. This indicates that when regular treatments for acne vulgaris are ineffective, examination of Demodex mites and necessary acaricidal therapies should be considered.
Shi, Jun; Pandey, Pramod K; Franz, Annaliese K; Deng, Huiping; Jeannotte, Richard
2016-03-01
To identify innovative ways for better utilizing flushed dairy manure wastewater, we have assessed the effect of dairy manure and supplementation with synthetic medium on the growth of Chlorella vulgaris. A series of experiments were carried out to study the impacts of pretreatment of dairy wastewater and the benefits of supplementing dairy manure wastewater with synthetic medium on C. vulgaris growth increment and the ultrastructure (chloroplast, starch, lipid, and cell wall) of C. vulgaris cells. Results showed that the biomass production of C. vulgaris in dairy wastewater can be enhanced by pretreatment and using supplementation with synthetic media. A recipe combining pretreated dairy wastewater (40 %) and synthetic medium (60 %) exhibited an improved growth of C. vulgaris. The effects of dairy wastewater on the ultrastructure of C. vulgaris cells were distinct compared to that of cells grown in synthetic medium. The C. vulgaris growth in both synthetic medium and manure wastewater without supplementing synthetic medium was lower than the growth in dairy manure supplemented with synthetic medium. We anticipate that the results of this study will help in deriving an enhanced method of coupling nutrient-rich dairy manure wastewater for biofuel production.
Quality of life, self-esteem and psychosocial factors in adolescents with acne vulgaris.
Vilar, Gustavo Nunes; Santos, Laís Araújo dos; Sobral Filho, Jader Freire
2015-01-01
Dermatological diseases, among which acne vulgaris, have psychological impact on the affected generating feelings of guilt, shame and social isolation. To compare quality of life, self-esteem and other psychosocial variables amongst adolescents with and without acne vulgaris, and between levels of severity. Cross-sectional observational study in a sample of 355 high school students from the city of João Pessoa. Data collection was performed with questionnaires and clinical-dermatological evaluation. The primary variables were the incidence of AV; quality of life, set by the Children's Dermatology Quality of Life Index and Dermatology Quality of Life Index; and self-esteem, measured by the Rosenberg Self-Esteem Scale. For calculation of statistical tests, we used the SPSS 20.0 software, considering p=0.05. The sample, with an average age of 16, showed 89.3% prevalence of acne vulgaris. The most prevalent psychosocial issue was "afraid that acne will never cease", present in 58% of affected youth. The median score of Quality of Life in Children's Dermatology Index was different amongst students with and without acne vulgaris (p=0.003), as well as the Quality of Life in Dermatology (p=0.038) scores, so that students with acne vulgaris have worse QoL. There was a correlation between the severity of acne vulgaris and worse quality of life. Self-esteem was not significantly associated with the occurrence or severity of acne vulgaris. acne vulgaris assumes significance in view of its high prevalence and the effect on quality of life of adolescents, more severe at the more pronounced stages of disease (p<0.001). The psychosocial impact of acne vulgaris should be valued in the management of patients with this condition.
Quality of life, self-esteem and psychosocial factors in adolescents with acne vulgaris*
Vilar, Gustavo Nunes; dos Santos, Laís Araújo; Sobral Filho, Jader Freire
2015-01-01
Background Dermatological diseases, among which acne vulgaris, have psychological impact on the affected generating feelings of guilt, shame and social isolation. Objectives To compare quality of life, self-esteem and other psychosocial variables amongst adolescents with and without acne vulgaris, and between levels of severity. Methods Cross-sectional observational study in a sample of 355 high school students from the city of João Pessoa. Data collection was performed with questionnaires and clinical-dermatological evaluation. The primary variables were the incidence of AV; quality of life, set by the Children's Dermatology Quality of Life Index and Dermatology Quality of Life Index; and self-esteem, measured by the Rosenberg Self-Esteem Scale. For calculation of statistical tests, we used the SPSS 20.0 software, considering p=0.05. Results The sample, with an average age of 16, showed 89.3% prevalence of acne vulgaris. The most prevalent psychosocial issue was "afraid that acne will never cease", present in 58% of affected youth. The median score of Quality of Life in Children's Dermatology Index was different amongst students with and without acne vulgaris (p=0.003), as well as the Quality of Life in Dermatology (p=0.038) scores, so that students with acne vulgaris have worse QoL. There was a correlation between the severity of acne vulgaris and worse quality of life. Self-esteem was not significantly associated with the occurrence or severity of acne vulgaris. Conclusions acne vulgaris assumes significance in view of its high prevalence and the effect on quality of life of adolescents, more severe at the more pronounced stages of disease (pacne vulgaris should be valued in the management of patients with this condition. PMID:26560206
TNFα gene polymorphisms in the pathogenesis of acne vulgaris.
Szabó, Kornélia; Tax, Gábor; Teodorescu-Brinzeu, Dragos; Koreck, Andrea; Kemény, Lajos
2011-01-01
Inflammation plays an important role in acne pathogenesis, and pro-inflammatory cytokines are key factors in these events. Tumor necrosis factor alpha (TNFα) is a central molecule coded by a gene that shows high level of genetic polymorphisms especially in its promoter region. Single nucleotide polymorphisms (SNPs) of the TNFα gene have been shown to be associated with an increased risk to develop chronic inflammatory diseases. In order to find out if known TNFα regulatory SNPs (-1031T>C, -857C>T, -863C>A, -308G>A, -238G>A) have a role in the development of the inflammatory reactions in acne vulgaris, we analyzed our genomic collection in a retrospective case-control study using the PCR-RFLP method, and we compared the resulting genotype and allele frequencies. There were no significant differences in the observed genotype or allele frequencies between the control and acne group in case of the -1031, -863, -238 SNPs; however, the TNFα -857 minor T allele was found to act as a protective factor in our study population in acne, and a higher occurrence of the minor -308 A allele in female acne patients was also noted. Genetic variants of the TNFα gene may affect the risk of acne vulgaris. Our results can help to elucidate the molecular events leading to acne development.
Topical tretinoin or adapalene in acne vulgaris: an overview.
Jain, S
2004-07-01
Retinoids target several pathoetiologic events of acne vulgaris. The undisputed efficacy of tretinoin, and yet its underutilization, due to apprehension of retinoid dermatitis, triggered a search for newer, well-tolerated retinoids. The discovery of nuclear retinoic acid receptors has provided clues to a rational design of synthetic, receptor-selective retinoic acid agonists. Adapalene is an addition to the arsenal of topical retinoids. It possesses the biological properties of tretinoin, but has a distinct physiochemical profile, including high lipophilicity and increased chemical and photostability. It exhibits selective affinity for nuclear retinoic acid receptors and does not bind to cytosolic retinoic acid binding proteins. It exemplifies the formulation of a novel retinoid with specific pharmacologic profile and clinical objectives. Accordingly, numerous clinical trials have compared adapalene and tretinoin in the management of acne vulgaris and concluded that tretinoin 0.05% gel exhibits a greater anti-acne efficacy than adapalene 0.1% gel, but has higher skin irritation potential. This article reviews the pharmacology of adapalene, including its retinoid receptor binding profile, antiproliferative effects, cell differentiation modulation, comedolytic and anti-inflammatory activity, and specifically focuses on the comparison of the efficacy and irritation profile of adapalene and tretinoin.
Treatment of Aphthous Stomatitis with topical Alchemilla vulgaris in glycerine.
Shrivastava, Ravi; John, Gareth W
2006-01-01
Recurrent aphthous ulceration is the most common oral mucosal disease known. It presents as three types: minor (most prevalent), major and herpetiform. However, there are no well established effective and reliable treatments of this condition. Alchemilla vulgaris (Lady's Mantle) has traditionally been used in oral hygiene and was recently shown to accelerate wound healing when used in combination with glycerine. The objective of this study was to determine whether this combination is effective in the treatment of the most prevalent form of aphthous ulcers. An open-label study was conducted in 48 otherwise healthy male and female patients aged 4-44 years to determine the putative healing properties and tolerability of a standard 3% extract of A. vulgaris in glycerine (Aphtarine) on common minor oral ulcers. Patients with major or herpetiform ulcers were excluded from the study. Topical application three times daily of Aphtarine gel to minor mouth ulcers relieved discomfort and produced complete healing in the majority of patients (60.4%) within 2 days and in 75% within 3 days, compared with 10.4% and 33.3%, respectively, without treatment and 15% and 40%, respectively, with commonly available treatments. Most patients appreciated the product's ease of application, taste and texture. Aphtarine was well tolerated locally and most patients rated the product good to excellent overall. Aphtarine is a safe, well tolerated and highly effective promising new treatment for healing common mouth ulcers.
Predicting dynamic metabolic demands in the photosynthetic eukaryote Chlorella vulgaris
Energy Technology Data Exchange (ETDEWEB)
Zuniga, Cristal; Levering, Jennifer; Antoniewicz, Maciek R.; Guarnieri, Michael T.; Betenbaugh, Michael J.; Zengler, Karsten
2017-09-26
Phototrophic organisms exhibit a highly dynamic proteome, adapting their biomass composition in response to diurnal light/dark cycles and nutrient availability. Here, we used experimentally determined biomass compositions over the course of growth to determine and constrain the biomass objective function (BOF) in a genome-scale metabolic model of Chlorella vulgaris UTEX 395 over time. Changes in the BOF, which encompasses all metabolites necessary to produce biomass, influence the state of the metabolic network thus directly affecting predictions. Simulations using dynamic BOFs predicted distinct proteome demands during heterotrophic or photoautotrophic growth. Model-driven analysis of extracellular nitrogen concentrations and predicted nitrogen uptake rates revealed an intracellular nitrogen pool, which contains 38% of the total nitrogen provided in the medium for photoautotrophic and 13% for heterotrophic growth. Agreement between flux and gene expression trends was determined by statistical comparison. Accordance between predicted fluxes trends and gene expression trends was found for 65% of multi-subunit enzymes and 75% of allosteric reactions. Reactions with the highest agreement between simulations and experimental data were associated with energy metabolism, terpenoid biosynthesis, fatty acids, nucleotides, and amino acids metabolism. Furthermore, predicted flux distributions at each time point were compared with gene expression data to gain new insights into intracellular compartmentalization, specifically for transporters. A total of 103 genes related to internal transport reactions were identified and added to the updated model of C. vulgaris, iCZ946, thus increasing our knowledgebase by 10% for this model green alga.
Treatment of acne vulgaris with fractional radiofrequency microneedling.
Kim, Sang Tae; Lee, Kang Hoon; Sim, Hyung Jun; Suh, Kee Suck; Jang, Min Soo
2014-07-01
Fractional radiofrequency microneedling is a novel radiofrequency technique that uses insulated microneedles to deliver energy to the deep dermis at the point of penetration without destruction of the epidermis. It has been used for the treatment of various dermatological conditions including wrinkles, atrophic scars and hypertrophic scars. There have been few studies evaluating the efficacy of fractional radiofrequency microneedling in the treatment of acne, and none measuring objective parameters like the number of inflammatory and non-inflammatory acne lesions or sebum excretion levels. The safety and efficacy of fractional radiofrequency microneedling in the treatment of acne vulgaris was investigated. In a prospective clinical trial, 25 patients with moderate to severe acne were treated with fractional radiofrequency microneedling. The procedure was carried out three times at 1-month intervals. Acne lesion count, subjective satisfaction score, sebum excretion level and adverse effects were assessed at baseline and at 4, 8 and 12 weeks after the first treatment as well as 4, 8 and 12 weeks after the last treatment. Number of acne lesions (inflammatory and non-inflammatory) decreased. Sebum excretion and subjective satisfaction were more favorable at every time point compared with the baseline values (P treatment. Fractional radiofrequency microneedling is a safe and effective treatment for acne vulgaris. © 2014 Japanese Dermatological Association.
Enhanced Harvesting of Chlorella vulgaris Using Combined Flocculants.
Ma, Xiaochen; Zheng, Hongli; Zhou, Wenguang; Liu, Yuhuan; Chen, Paul; Ruan, Roger
2016-10-01
In this study, a novel flocculation strategy for harvesting Chlorella vulgaris with combined flocculants, poly (γ-glutamic acid) (γ-PGA) and calcium oxide (CaO), has been developed. The effect of flocculant dosage, the order of flocculant addition, mixing speed, and growth stage on the harvesting efficiency was evaluated. Results showed that the flocculation using combined flocculants significantly decreases the flocculant dosage and settling time compared with control. It was also found that CaO and γ-PGA influenced microalgal flocculation by changing the zeta potential of cells and pH of microalgal suspension. The most suitable order of flocculant addition was CaO first and then γ-PGA. The optimal mixing speed was 200 rpm for 0.5 min, followed by 50 rpm for another 4.5 min for CaO and γ-PGA with the highest flocculation efficiency of 95 % and a concentration factor of 35.5. The biomass concentration and lipid yield of the culture reusing the flocculated medium were similar to those when a fresh medium was used. Overall, the proposed method requires low energy input, alleviates biomass and water contamination, and reduces utilization of water resources and is feasible for harvesting C. vulgaris for biofuel and other bio-based chemical production.
Body image disturbance in patients with acne vulgaris.
Bowe, Whitney P; Doyle, Amanda K; Crerand, Canice E; Margolis, David J; Shalita, Alan R
2011-07-01
Psychosocial outcome measures, which attempt to examine acne from the patient's perspective, have become increasingly important in dermatology research. One such measure is the Body Image Disturbance Questionnaire. The authors' primary aim was to determine the validity and internal consistency of the Body Image Disturbance Questionnaire in patients with acne vulgaris. The secondary aim was to investigate the relationship between body image disturbance and quality of life. This cross-sectional investigation included 52 consecutive acne patients presenting to an outpatient dermatology clinic. Subjects completed the Body Image Disturbance Questionnaire, Skindex-16, and other body image and psychosocial functioning measures. An objective assessment of acne was performed. The Body Image Disturbance Questionnaire was internally consistent and converged with other known body image indices. Body Image Disturbance Questionnaire scores also correlated with Skindex-16 scores, confirming that quality of life and body image are related psychosocial constructs. The Body Image Disturbance Questionnaire appears to be an accurate instrument that can assess appearance-related concern and impairment in patients with acne vulgaris. Limitations include a small sample size and the cross-sectional design.
Two endornaviruses show differential infection patterns between gene pools of Phaseolus vulgaris.
Khankhum, Surasak; Valverde, Rodrigo A; Pastor-Corrales, Marcial A; Osorno, Juan M; Sabanadzovic, Sead
2015-04-01
We investigated the occurrence of two plant endornaviruses, Phaseolus vulgaris endornavirus 1 and Phaseolus vulgaris endornavirus 2, in breeding lines, cultivars, landraces, and wild genotypes of common bean (Phaseolus vulgaris) collected from the two centers of common bean domestication: Mesoamerica and the Andes. The two endornaviruses were detected in many genotypes of Mesoamerican origin but rarely in genotypes of Andean origin. The results suggest that these two endornaviruses were introduced into the Mesoamerican modern genotypes during common bean domestication and provide more evidence for the existence of two divergent gene pools of common bean.
Bancin, Berry Eka Parda
2011-01-01
Introduction. Acne vulgaris is a very common disease found in public, especially in adolescence. About 85% of people in their life have had acne vulgaris, so it’s often assumed as a physiological state. High-calorie foods have been long suspected as one of the causes of this disease, this opinion is supported by the increased incidence of acne vulgaris in developing countries today. Since 1946 to 2007 various studies have been conducted on the relationship of food to the occurrence of acne vu...
Oral Spironolactone in Post-teenage Female Patients with Acne Vulgaris
Kim, Grace K.
2012-01-01
Oral spironolactone has been used for over two decades in the dermatological setting. Although it is not generally considered a primary option in the management of female patients with acne vulgaris, the increase in office visits by post-teenage women with acne vulgaris has recently placed a spotlight on the use of this agent in this subgroup of patients. This article reviews the literature focusing on the use of oral spironolactone in this subset of women with acne vulgaris, including discussions of the recommended starting dose, expected response time, adjustments in therapy, potential adverse effects, and patient monitoring. PMID:22468178
Energy Technology Data Exchange (ETDEWEB)
Lee, Minhee, E-mail: heelee@pknu.ac.kr [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of); Yang, Minjune [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of)
2010-01-15
The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 {mu}g/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.
Energy Technology Data Exchange (ETDEWEB)
Hernandes, Nilber Kenup; Vital, Helio de Carvalho [Centro Tecnologico do Exercito (CTEx), Rio de Janeiro, RJ (Brazil). Div. de Defesa Quimica, Biologica e Nuclear (DDQBN)]. E-mail: nilberkenup@ctex.eb.br; vital@ctex.eb.br; Coneglian, Regina Celi Cavestre [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, Rio de Janeiro, RJ (Brazil). Inst.de Agronomia. Dept. de Fitotecnia]. E-mail: rccconeg@ufrrj.br; Godoy, Ronoel Luiz de Oliveira [EMBRAPA Agroindustria de Alimentos, Rio de Janeiro, RJ (Brazil)]. E-mail: ronoel@ctaa.embrapa.br
2007-07-01
This work investigated the effects of gamma irradiation on the shelf-life extension and safety of minimally processed red beet (Beta vulgaris ssp. vulgaris L.) by performing microbiological, chemical and sensory analyses. Red beets were harvested 73 days after transplanting and their tuberous parts were minimally processed and separated in two groups: control (non-irradiated) and irradiated (0.5, 1.0 and 1.5 kGy). Tests for Salmonella sp., total and fecal coliforms, total count of aerobic mesophilic and lactic-acid bacteria were performed during the 21-day storage at 8 deg C. They indicated that the samples irradiated with 1.0 and 1.5 kGy remained in good conditions throughout storage while the unirradiated samples did not last 7 days. Chemical analyses indicated that the concentrations of vitamins B1 and B2 were not affected by irradiation. In contrast the amounts of fructose and glucose increased during storage while the one for sucrose decreased. In addition four series of sensory evaluations including appearance and aroma indicated that the samples irradiated with 1.0 and 1.5 kGy remained good for consumption for 20 days. Therefore it was concluded that the use of the doses of 1.0 and 1.5 kGy produced the best effects on the conservation of the samples without harming the sensory characteristics and nutritional constituents tested. (author)
Transcriptome analysis of salt tolerant common bean (Phaseolus vulgaris L.) under saline conditions
National Research Council Canada - National Science Library
Hiz, Mahmut Can; Canher, Balkan; Niron, Harun; Turet, Muge
2014-01-01
.... Common bean, Phaseolus vulgaris L., a major protein source in developing countries, is highly affected by soil salinity and the information on genes that play a role in salt tolerance is scarce...
Al-Bayati, Firas A
2008-03-28
Essential oils (EOs) and methanol extracts obtained from aerial parts of Thymus vulgaris and Pimpinella anisum seeds were evaluated for their single and combined antibacterial activities against nine Gram-positive and Gram-negative pathogenic bacteria: Staphylococcus aureus, Bacillus cereus, Escherichia coli, Proteus vulgaris, Proteus mirabilis, Salmonella typhi, Salmonella typhimurium, Klebsiella pneumoniae and Pseudomonas aeruginosa. The essential oils and methanol extracts revealed promising antibacterial activities against most pathogens using broth microdilution method. Maximum activity of Thymus vulgaris and Pimpinella anisum essential oils and methanol extracts (MIC 15.6 and 62.5mug/ml) were observed against Staphylococcus aureus, Bacillus cereus and Proteus vulgaris. Combinations of essential oils and methanol extracts showed an additive action against most tested pathogens especially Pseudomonas aeruginosa.
Production of Triterpenoid Sapogenins in Hairy Root Cultures of Silene vulgaris.
Kim, Yeon Bok; Reed, Darwin W; Covello, Patrick S
2015-11-01
Silene vulgaris (Moench) Garcke (Caryophyllaceae) is widely distributed in North America and contains bioactive oleanane-type saponins. In order to investigate in vitro production of triterpenoid saponins, hairy root cultures of S. vulgaris were established by infecting leaf explants with five strains of Agrobacterium rhizogenes (LBA9402, R1000, A4, 13333, and 15834). The A. rhizogenes strain LBA9402 had an infection of 100% frequency and induced the most hairy roots per plant. Methyl jasmonate (MeJA)-induced changes in triterpenoid saponins in S. vulgaris hairy roots were analyzed. Accumulation of segetalic acid and gypsogenic acid after MeJA treatment was 5-and 2-fold higher, respectively, than that of control root. We suggest that hairy root cultures of S. vulgaris could be an important alternative approach to the production of saponins.
National Research Council Canada - National Science Library
Zambrano, Rosaura; Granito, Marisela; Valero, Yolmar
2013-01-01
The objective of this work was to formulate a cereals and legume (Phaseolus vulgaris) bar and assess its impact on the glycemic response of healthy individuals, in order to contribute to the healthy food supply beneficial to consumers...
Cheilitis in acne vulgaris patients with no previous use of systemic retinoid products.
Balighi, Kamran; Daneshpazhooh, Maryam; Lajevardi, Vahideh; Talebi, Shahin; Azizpour, Arghavan
2017-08-01
Isotretinoin is commonly used in the treatment of acne vulgaris. While one of the more common side-effects is cheilitis, we have observed an increased incidence of cheilitis prior to the commencement of systemic isotretinoin. The aim of this study was to assess the prevalence of cheilitis among acne vulgaris patients. A non-interventional cross-sectional study of patients with acne vulgaris. Patients with previous use of systemic retinoids were excluded. The patients were examined for signs and symptoms of cheilitis. Of a total of 400 patients, 134 (34%) had evidence of cheilitis at initial presentation. Two-thirds (63%) were female (P acne excorie, compared with only 8% of patients with no signs of cheilitis. Our findings suggest that cheilitis is quite common among acne vulgaris patients even before treatment with isotretinoin. © 2016 The Australasian College of Dermatologists.
Kong, Weibao; Wang, Yang; Yang, Hong; Xi, Yuqin; Han, Rui; Niu, Shiquan
2015-03-04
We studied the effects of trophic modes related to glucose and light (photoautotrophy, mixotrophy and heterotrophy) on growth, cellular components and carbon metabolic pathway of Chlorella vulgaris. The parameters about growth of algal cells were investigated by using spectroscopy and chromatography techniques. When trophic mode changed from photoautotrophy to mixotrophy and to heterotrophy successively, the concentrations of soluble sugar, lipid and saturated C16/C18 fatty acids in C. vulgaris increased, whereas the concentrations of unsaturated C16, C18 fatty acids, proteins, photosynthetic pigments and 18 relative amino acids decreased. Light and glucose affect the growth, metabolism and the biochemical components biosynthesis of C. vulgaris. Addition of glucose can promote algal biomass accumulation, stimulate the synthesis of carbonaceous components, but inhibit nitrogenous components. Under illumination cultivation, concentration and consumption level of glucose decided the main trophic modes of C. vulgaris. Mixotrophic and heterotrophic cultivation could promote the growth of algal cells.
Directory of Open Access Journals (Sweden)
Ronald Huarachi-Olivera
2018-01-01
Conclusions: These findings suggest that MFCs with C. vulgaris and bacterial community have a simultaneous efficiency in the production of bioelectricity and bioremediation processes, becoming an important source of bioenergy in the future.
Mustafa, Hesham N.
2015-01-01
Chlorella Vulgaris Alleviates Lead-induced Testicular Toxicity Better than Zingiber Officinale: An Ultrastructural Study XXIV International Symposium on Morphological Sciences, Prof. Dr. Cemil Bilsel Congress Hall, Faculty of Science, Istanbul University, Istanbul, Turkey. Oral Presentation; 09/2015
Lupus Vulgaris Erythematoides: report of a patient initially misdiagnosed as dermatitis.
Vazquez-Lopez, Francisco; Fueyo-Casado, Alejandro; Gonzalez-Lara, Leire
2013-05-15
A small percentage of patients with tuberculosis present with cutaneous findings, which may be difficult to diagnose. We present a patient diagnosed with a rare, non-scarring form of cutaneous tuberculosis (CTB), classically termed as lupus vulgaris erythematoides.
Liu, Chien-Hung; Chang, Chin-Yen; Liao, Qiang; Zhu, Xun; Chang, Jo-Shu
2013-10-01
In this work, Chlorella vulgaris ESP6 was used to assimilate the soluble metabolites in the hydrogen fermentation broth of Clostridium butyricum CGS5 to obtain valuable microalgae biomass. The results show that C. vulgaris ESP6 could grow on the 4-fold diluted dark fermentation broth. Acetate was efficiently utilized during the growth of C. vulgaris ESP6, whereas the microalgae growth was inhibited by lactate, butyrate, and HCO3(-) when their concentrations were higher than 0.5, 0.1, and 2.72 g/L, respectively. C. vulgaris ESP6 could completely consume butyrate (the most abundant dark fermentation metabolite) when it was grown on Tris-Acetate-Phosphate medium under a food to microorganism (F/M) ratio of 1.11. Copyright © 2012 Elsevier Ltd. All rights reserved.
Metabolic dynamics of Desulfovibrio vulgaris biofilm grown on a steel surface.
Zhang, Yang; Pei, Guangsheng; Chen, Lei; Zhang, Weiwen
2016-08-01
In this study, a comparative metabolomics approach combining gas chromatography-mass spectrometry (GC-MS) and liquid chromatography-mass spectrometry (LC-MS) was applied first between planktonic cells and biofilms and then between pure cultures and biofilms of Desulfovibrio vulgaris. The results revealed that the overall metabolic level of the biofilm cells was down-regulated, especially for metabolites related to the central carbon metabolism, compared to the planktonic cells and the pure culture of D. vulgaris. In addition, pathway enrichment analysis of the 58 metabolites identified by GC-MS showed that fatty acid biosynthesis in the biofilm cells was up-regulated, suggesting that fatty acids may be important for the formation, maintenance and function of D. vulgaris biofilm. This study offers a valuable perspective on the metabolic dynamics of the D. vulgaris biofilm.
Use of intense pulse light for acne vulgaris in Indian skin--a case series.
Mohanan, Saritha; Parveen, Basheerahmed; Annie Malathy, Priyavathani; Gomathi, Nellainayagam
2012-04-01
Intense pulse light (IPL) has become extremely popular in Indian cosmetology circles. Yet, literature is silent on its effect in heavily melanized skin. A descriptive study to gauge the effect of IPL on acne vulgaris in Indian patients done in a tertiary care center in south India. Patients with moderate to severe acne vulgaris were given a maximum of five sittings of IPL treatment. Lesion counts were performed and photographs compared before and after treatment. IPL was offered to 10 patients with acne vulgaris. Two patients dropped out, seven patients had a good response after a mean of 3.4 sittings; 87.5% patients expressed satisfaction with the procedure. No adverse effects were noted. IPL serves a useful role in the treatment of acne vulgaris and could reduce treatment costs and pill burden. There is no increased risk of side effects with IPL on Indian skin with standard care. © 2012 The International Society of Dermatology.
Cultivo de Chlorella vulgaris sobre residual de soja con la aplicacion de un campo magnetico
National Research Council Canada - National Science Library
Gomez Luna, Liliana; Alvarez, Inaudis; Rivero, Roger
2011-01-01
... vulgaris, obteniendose excelentes valores de densidad celular maxima ([K.sub.max]: 360 x [10.sup.6] cel.[mL.sup.-1]). Posteriormente se evaluan los efectos de la aplicacion de un campo magnetico...
Mayhead, Elyssia; Silkina, Alla; Llewellyn, Carole A; Fuentes-Grünewald, Claudio
2018-01-19
The nutrient removal efficiency of Chlorella vulgaris cultivated in domestic wastewater was investigated, along with the potential to use membrane filtration as a pre-treatment tool during the wastewater treatment process. Chlorella vulgaris was batch cultivated for 12 days in a bubble column system with two different wastewater treatments. Maximum uptake of 94.18% ammonium (NH₄-N) and 97.69% ortho-phosphate (PO₄-P) occurred in 0.2 μm membrane filtered primary wastewater. Membrane filtration enhanced the nutrient uptake performance of C. vulgaris by removing bacteria, protozoa, colloidal particles and suspended solids, thereby improving light availability for photosynthesis. The results of this study suggest that growing C. vulgaris in nutrient rich membrane filtered wastewater provides an option for domestic wastewater treatment to improve the quality of the final effluent.
Directory of Open Access Journals (Sweden)
Elyssia Mayhead
2018-01-01
Full Text Available The nutrient removal efficiency of Chlorella vulgaris cultivated in domestic wastewater was investigated, along with the potential to use membrane filtration as a pre-treatment tool during the wastewater treatment process. Chlorella vulgaris was batch cultivated for 12 days in a bubble column system with two different wastewater treatments. Maximum uptake of 94.18% ammonium (NH4-N and 97.69% ortho-phosphate (PO4-P occurred in 0.2 μm membrane filtered primary wastewater. Membrane filtration enhanced the nutrient uptake performance of C. vulgaris by removing bacteria, protozoa, colloidal particles and suspended solids, thereby improving light availability for photosynthesis. The results of this study suggest that growing C. vulgaris in nutrient rich membrane filtered wastewater provides an option for domestic wastewater treatment to improve the quality of the final effluent.
National Research Council Canada - National Science Library
Mancini, Emilia; Senatore, Federica; Del Monte, Donato; De Martino, Laura; Grulova, Daniela; Scognamiglio, Mariarosa; Snoussi, Mejdi; De Feo, Vincenzo
2015-01-01
This study is aimed at assessing the essential oil composition, total phenolic content, antimicrobial and antioxidant activities of Thymus vulgaris collected in five different area of the Campania Region, Southern Italy...
National Research Council Canada - National Science Library
Al-Bayati, Firas A
2008-01-01
Essential oils (EOs) and methanol extracts obtained from aerial parts of Thymus vulgaris and Pimpinella anisum seeds were evaluated for their single and combined antibacterial activities against nine Gram-positive...
Borji, Hassan; Moosavi, Zahra; Ahmadi, Fatemeh
2014-09-01
Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors' knowledge, a complete cranial mesenteric arterial obstruction due to verminous arteritis has rarely been described in horses and donkeys. Based on recent reports of fatal arterial obstruction due to S. vulgaris infection in donkeys, it may be evident to consider acute colic caused by this pathogenic parasite a re-emerging disease in donkeys and horses.
Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus.
Directory of Open Access Journals (Sweden)
Hassan Borji
2014-09-01
Full Text Available Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors' knowledge, a complete cranial mesenteric arterial obstruction due to verminous arteritis has rarely been described in horses and donkeys. Based on recent reports of fatal arterial obstruction due to S. vulgaris infection in donkeys, it may be evident to consider acute colic caused by this pathogenic parasite a re-emerging disease in donkeys and horses.
Directory of Open Access Journals (Sweden)
Severus D. Covaciu-Marcov
2011-06-01
Full Text Available A Lissotriton vulgaris paedomorph population was identified for the first time ever in south-western Romania. The newts inhabiting a permanent but artificial habitat, surrounded by agricultural fields.
Evaluation of inhomogeneities of repolarization in patients with psoriasis vulgaris.
Soylu, Korhan; İnci, Sinan; Aksan, Gökhan; Nar, Gökay; Yüksel, Esra Pancar; Ocal, Hande Serra; Çapraz, Mustafa; Yüksel, Serkan; Şahin, Mahmut
2016-12-01
The arrhythmia potential has not been investigated adequately in psoriatic patients. In this study, we assessed the ventricular repolarization dispersion, using the Tp-e interval and the Tp-e/QT ratio, and investigated the association with inflammation. Seventy-one psoriasis vulgaris patients and 70 age- and gender-matched healthy individuals were enrolled in the study. The severity of the disease was calculated using Psoriasis Area and Severity Index scoring. The QTd was defined as the difference between the maximum and minimum QT intervals. The Tp-e interval was defined as the interval from the peak of the T wave to the end of the T wave. The Tp-e interval was corrected for heart rate. The Tp-e/QT ratio was calculated using these measurements. There were no significant differences between the groups with respect to basal clinical and laboratory characteristics (p > 0.05). The Tp-e interval, the corrected Tp-e interval (cTp-e) and the Tp-e/QT ratio were also significantly higher in psoriasis patients compared to the control group (78.5 ±8.0 ms vs. 71.4 ±7.6 ms, p < 0.001, 86.3 ±13.2 ms vs. 77.6 ±9.0 ms, p < 0.001 and 0.21 ±0.02 vs. 0.19 ±0.02, p < 0.001 respectively). A significant correlation was detected between the cTp-e time and the Tp-e/QT ratio and the PASI score in the group of psoriatic patients (r = 0.51, p < 0.001; r = 0.59, p < 0.001, respectively). In our study, we detected a significant increase in the Tp-e interval and the Tp-e/QT ratio in patients with psoriasis vulgaris. The Tp-e interval and the Tp-e/QT ratio may be predictors for ventricular arrhythmias in patients with psoriasis vulgaris.
Thiboutot, Diane; Del Rosso, James Q.
2013-01-01
Acne vulgaris is a common dermatological disorder that predominantly affects teenagers, but can also affect preadolescents and post-teen individuals. Despite the fact that acne vulgaris is the most common skin disorder encountered in ambulatory dermatology practice in the United States, there has been limited research on the epidermal permeability barrier in untreated skin of people with acne vulgaris and also after use of acne therapies. This article reviews the research results and discusse...
Expression of a-Amylase in Phaseolus vulgaris and Vigna mungo Plants
Takao, MINAMIKAWA; Daisuke, YAMAUCHI; Sachiko, Wada; Hajime, TAKEUCHI; Department of Biology, Tokyo Metropolitan University
1992-01-01
Levels of starch and soluble sugar in pods of Phaseolus vulgaris and Vigna mungo plants were analyzed during the course of maturation of fruits. The results suggest that the immature pods of P. vulgaris function to some extent as temporary reservoirs of carbohydrates for growth of seeds. A less clear pattern of accumulation of starch was observed in pods of maturing fruits of Vigna mungo. Measurements of a-amylase activites in pods of maturing fruits and immunoblotting with an antiserum again...
Directory of Open Access Journals (Sweden)
Nar'Asha Randall
2017-05-01
Full Text Available This project involved the evaluation of a biosafety level 1 alternative to Proteus vulgaris as a positive control for the production of hydrogen sulfide. We determined that Citrobacter freundii could serve as an excellent substitute for P. vulgaris, and that lead acetate strips used in conjunction with triple sugar iron media allows for consistent results following evaluation after up to one week.
Quality of life, self-esteem and psychosocial factors in adolescents with acne vulgaris
Vilar, Gustavo Nunes; Santos, Laís Araújo dos; Sobral Filho,Jader Freire
2015-01-01
AbstractBackground:Dermatological diseases, among which acne vulgaris, have psychological impact on the affected generating feelings of guilt, shame and social isolation.Objectives:To compare quality of life, self-esteem and other psychosocial variables amongst adolescents with and without acne vulgaris, and between levels of severity.Methods:Cross-sectional observational study in a sample of 355 high school students from the city of João Pessoa. Data collection was performed with questionnai...
Nikolova, Milena; VELICKOVIC, Dragan
2007-01-01
Qualitative and quantitative variations in the surface flavonoids in relation to phenological development of Artemisia vulgaris L. and Artemisia absinthium L. were examined. Plant material was harvested at different phenological stages (vegetative, before budding, floral budding, flowering, and fruiting) of the life cycle of the species. In A. vulgaris and A. absinthium acetone exudates, 6 and 4 flavonoid aglycones were identified, respectively, by TLC analysis. Quercetin 3,7,3'-trim...
Soghra Valizadeh (MSc); Razzagh Mahmoudi (PhD); Tayebeh Fakheri (DVM); Farzad Katiraee (PhD); Vahideh Rahmani (DVM)
2016-01-01
Background and Objective: The aim of this study was to determine the chemical composition, antibacterial and antifungal effects of Thymus vulgaris and Cuminum Cyminum essential oils against foodborne pathogens and Candida species in vitro. Methods: The essential oils were extracted from the aerial parts of Thymus vulgaris and dried Cuminum Cyminum seeds using a Clevenger apparatus for 3 hours. Analysis of the essential oils’ constituents was performed using gas chromatography-mass s...
The genome sequence of Barbarea vulgaris facilitates the study of ecological biochemistry
DEFF Research Database (Denmark)
Byrne, Stephen L.; Erthmann, Pernille Østerbye; Agerbirk, Niels
2017-01-01
The genus Barbarea has emerged as a model for evolution and ecology of plant defense compounds, due to its unusual glucosinolate profile and production of saponins, unique to the Brassicaceae. One species, B. vulgaris, includes two ‘types’, G-type and P-type that differ in trichome density, and t...... deter larvae to the extent that they die. The B. vulgaris genome will promote the study of mechanisms in ecological biochemistry to benefit crop resistance breeding....
Phytochemical analysis and antimicrobial activity of Chorella vulgaris isolated from Unkal Lake
Shakeel Ahmed Adhoni; Shivasharana Chandrabanda Thimmappa; Basappa Basawanneppa Kaliwal
2016-01-01
Objective: To determine the presence of bioactive molecules and to check their antimicrobial activity from green algae Chlorella vulgaris (AS-3) (C. vulgaris) isolated from Unkal Lake in Dharwad District, Karnataka, India. Methods: Based on the polarity, benzene, chloroform, ethyl acetate, ethanol, hexane, methanol, petroleum ether and distilled water were the solvents used for the preparation of algal extracts using Soxhlet apparatus, which were further subjected to phytochemi...
[Textual research on change of medicinal parts and herbal medicine of Prunella vulgaris].
Chen, Yuhang; Guo, Qiaosheng; Wang, Chengya
2010-01-01
To investigate the herbal medicine of Prunella vulgaris by textual researches, and provide a theoretical basis for clinical medication, exploitation and protection of wild P. vulgaris resources. Textual research on medicinal works of past dynasties and field work were adopted. The natural distributions of P. vulgaris were concentrated distribution in Sichuan province, Huaihe river basin, and Middle-Lower Yangtze river valley in Chinese history. The indications of P. vulgaris in ancient and modern times were basically identical. While there were difference between the medicinal parts, harvest period and processing methods existed difference between ancient and modern. Three periods that whole grass of P. vulgaris as medicinal parts (from late Ming dynasty to late Qing dynasty and early stage of Republic of China), both whole grass and spicas as medicinal parts (from mid-term Republic of China to 1963), and the semi-maturity or maturity of spicas as medicinal parts (from 1963 to today) existed. The processing method for medicinal parts of P. vulgaris adopted sun drying and shady drying in ancient China, but only the sun drying was only used in modern times.
Ghrelin in the pilosebaceous unit: alteration of ghrelin in patients with acne vulgaris.
Cicek, Demet; Demir, Betul; Erder, Ilker; Kuloglu, Tuncay; Ucer, Ozlem; Aydin, Suleyman; Ucak, Haydar; Dertlioglu, Selma; Kalayci, Mehmet
2015-01-01
Ghrelin in the pilosebaceous tissues of human skin and ghrelin levels in patients with acne vulgaris have not yet been investigated. The purpose of this study was to screen ghrelin immunoreactivity by immunohistochemistry in human pilosebaceous tissues of human skin and also to determine the quantities of ghrelin in the serum of the patients with acne vulgaris. 30 patients presenting with acne vulgaris and 30 control subjects participated in this study. Ghrelin levels were determined by enzyme linked immunosorbent assay (ELISA). Human hair follicles and sebaceous glands were immunohistochemically examined. Immunohistochemistry results showed that there is a strong ghrelin immunoreactivity in the hair follicles and sebaceous glands in sections of human skin. The mean serum ghrelin levels (27.58 ・} 15.44 pg/mL) in patients with acne vulgaris was significantly lower than those of controls (35.62・}20.46 pg/mL). Ghrelin produced in hair follicles and sebaceous glands of the skin might participate in the pathogenesis of acne vulgaris and also acne vulgaris in humans might be associated with decreased serum ghrelin.
Study of the effect of extract of Thymus vulgaris on anxiety in male rats.
Komaki, Alireza; Hoseini, Faeghe; Shahidi, Siamak; Baharlouei, Negar
2016-07-01
There is some evidence in traditional medicine for the effectiveness of Thymus vulgaris ( bǎi lǐ xiāng) in the treatment of anxiety in humans. The elevated plus-maze (EPM) has broadly been used to investigate anxiolytic and anxiogenic compounds. The present study investigated the effects of extract of T. vulgaris on rat behavior in the EPM. In the present study, the data were obtained from male Wistar rats. Animals were divided into four groups: saline group and T. vulgaris groups (50 mg/kg, 100 mg/kg, and 200 mg/kg infusion for 7 days by feeding). During the test period, the total distance covered by animals, the number of open- and closed-arm entries, and the time spent in open and closed arms of the EPM were recorded. T. vulgaris increased open-arm exploration and open-arm entry in the EPM, whereas extract of this plant has no effects on the total distance covered by animals and the number of closed-arm entries. The results of the present experiment indicate that T. vulgaris may have an anxiolytic profile in rat behavior in the EPM test, which is not influenced by the locomotor activity. Further research is required to determine the mechanisms by which T. vulgaris extract exerts an anxiolytic effect in rats.
Drobot, Kateryna O; Matvieieva, Nadiia A; Ostapchuk, Andriy M; Kharkhota, Maxim A; Duplij, Volodymyr P
2017-09-14
We studied the effect of genetic transformation on biologically active compound (artemisinin and its co-products (ART) as well as sugars) accumulation in Artemisia vulgaris and Artemisia dracunculus "hairy" root cultures. Glucose, fructose, sucrose, and mannitol were accumulated in A. vulgaris and A. dracunculus "hairy" root lines. Genetic transformation has led in some cases to the sugar content increasing or appearing of nonrelevant for the control plant carbohydrates. Sucrose content was 1.6 times higher in A. vulgaris "hairy" root lines. Fructose content was found to be 3.4 times higher in A. dracunculus "hairy" root cultures than in the control roots. The accumulation of mannitol was a special feature of the leaves of A. vulgaris and A. dracunculus control roots. A. vulgaris "hairy" root lines differed also in ART accumulation level. The increase of ART content up to 1.02 mg/g DW in comparison with the nontransformed roots (up to 0.687 mg/g DW) was observed. Thus, Agrobacterium rhizogenes-mediated genetic transformation can be used for obtaining of A. vulgaris and A. dracunculus "hairy" root culture produced ART and sugars in a higher amount than mother plants.
Computational identification of miRNAs and their targets in Phaseolus vulgaris.
Han, J; Xie, H; Kong, M L; Sun, Q P; Li, R Z; Pan, J B
2014-01-21
MicroRNAs (miRNAs) are a class of non-coding small RNAs that negatively regulate gene expression at the post-transcriptional level. Although thousands of miRNAs have been identified in plants, limited information is available about miRNAs in Phaseolus vulgaris, despite it being an important food legume worldwide. The high conservation of plant miRNAs enables the identification of new miRNAs in P. vulgaris by homology analysis. Here, 1804 known and unique plant miRNAs from 37 plant species were blast-searched against expressed sequence tag and genomic survey sequence databases to identify novel miRNAs in P. vulgaris. All candidate sequences were screened by a series of miRNA filtering criteria. Finally, we identified 27 conserved miRNAs, belonging to 24 miRNA families. When compared against known miRNAs in P. vulgaris, we found that 24 of the 27 miRNAs were newly discovered. Further, we identified 92 potential target genes with known functions for these novel miRNAs. Most of these target genes were predicted to be involved in plant development, signal transduction, metabolic pathways, disease resistance, and environmental stress response. The identification of the novel miRNAs in P. vulgaris is anticipated to provide baseline information for further research about the biological functions and evolution of miRNAs in P. vulgaris.
Cannibalistic behavior of octopus (Octopus vulgaris) in the wild.
Hernández-Urcera, Jorge; Garci, Manuel E; Roura, Alvaro; González, Angel F; Cabanellas-Reboredo, Miguel; Morales-Nin, Beatriz; Guerra, Angel
2014-11-01
The first description of cannibalism in wild adult Octopus vulgaris is presented from 3 observations made in the Ría de Vigo (NW Spain), which were filmed by scuba divers. These records document common traits in cannibalistic behavior: (a) it was intercohort cannibalism; (b) attacks were made by both males and females; (c) in 2 of the records, the prey were transported to the den, which was covered with stones of different sizes; (d) the predator started to eat the tip of the arms of its prey; (e) predation on conspecifics occurred even if there were other abundant prey available (i.e., mussels); and (f) the prey/predator weight ratio in the 3 cases ranged from 20% to 25% body weight. The relationships between this behavior and sex, defense of territory, energy balance, food shortage, competition and predation, as well as how the attacker kills its victim are discussed. (PsycINFO Database Record (c) 2014 APA, all rights reserved).
[Preliminary analysis of bitter substances in spica of Prunella vulgaris].
Zhai, Xin; Xi, Meng-Qian; Guo, Qiao-Sheng; Han, Huan-Huan; Zhang, Xiang; Yang, Wei; Zheng, Rong-bo; Huang, Xiao-Dan; Zhu, Huan-Rong
2014-02-01
Volatile oil components and the contents and types of amino acid in spica of Prunella vulgaris were analysed by GC-MS and amino acid analyzer. Esters, fatty acids, aromatic hydrocarbon, ketone and several alcohol compounds were identified by mass spectrum comparison. In these ingredients, beta-ionone smelled aroma of cedar, raspberry, nerolidol showed weak sweet soft orange blossom flavor, neroli tasted sweet and fresh, nerolidol tasted sweet with light aroma of wood, hexadecanal showed a weak aroma of flowers and wax, alpha-sinensal had rich and fresh sweet orange flavor. To some extent, these types of aromatic substances can affect the taste of herbal tea or decoction made of Spica Prunellae. Among amino acids detected, natural amino acids accounted for a larger proportion, and those natural amino acids showed bitterness, slight bitterness, sourness (freshness), sweetness, slight sweetness, sourness (slight freshness). The results indicated that bitter and slightly bitter amino acids have the greatest impacts on the sense of Spica Prunellae.
Leaf conductance response of phaseolus vulgaris to ozone flux density
Amiro, B. D.; Gillespie, T. J.
The effect of ozone flux density on leaf conductance to ozone in Phaseolus vulgaris was examined. The change in conductance was measured within the first two hours of fumigation for mature, fruiting 6-week-old plants of an ozone sensitive cultivar (Seafarer); for young, 14-day-old plants of the same cultivar; and for an ozone resistant cultivar (Gold Crop). Young Seafarer plants showed no change in conductance to ozone over a wide range of ozone flux densities. Gold Crop showed a decrease in conductance of -3.1 % /(mgO 3 m -2 h -1) whereas mature Seafarer plants exhibited a stronger decrease of -7.7% /(mgO 3 m -2 h -1). Diffusion porometer measurements taken on fruiting Seafarer plants in the field illustrated that a decrease in leaf diffusive conductance to water is related to visual ozone injury.
Nootropic Effects of Filipendula Vulgaris Moench Water Extract Fractions.
Shilova, I V; Suslov, N I; Amelchenko, V P
2015-07-01
Nootropic activity of water extract fractions from aerial parts of Filipendula vulgaris Moench was demonstrated on the models of hermetic volume hypoxia, conditioned passive avoidance response, open field test, and forced swimming with a load. The fractions stimulated hypoxic resistance, normalized orientation and exploratory behavior, improved conditioned response reproduction during testing after hypoxic injury, and increased exercise tolerance. Fractionation of the extract led to dissociation of the effect components, which suggests that individual constituents have specific characteristics. Ethylacetate fraction exhibited most pronounced nootropic activity and was superior to plant extract by some characteristics. The detected effects seemed to be caused by modulation of the hippocampus activity the under the effects of phenol and triterpene compounds.
Polyphosphate during the Regreening of Chlorella vulgaris under Nitrogen Deficiency
Directory of Open Access Journals (Sweden)
Fei-Fei Chu
2015-09-01
Full Text Available Polyphosphate (Poly-P accumulation has been reported in Chlorella vulgaris under nitrogen deficiency conditions with sufficient P supply, and the process has been demonstrated to have great impact on lipid productivity. In this article, the utilization of polyphosphates and the regreening process under N resupplying conditions, especially for lipid production reviving, were investigated. This regreening process was completed within approximately 3–5 days. Polyphosphates were first degraded within 3 days in the regreening process, with and without an external P supply, and the degradation preceded the assimilation of phosphate in the media with an external P offering. Nitrate assimilation was markedly influenced by the starvation of P after polyphosphates were exhausted in the medium without external phosphates, and then the reviving process of biomass and lipid production was strictly impeded. It is, thus, reasonable to assume that simultaneous provision of external N and P is essential for overall biodiesel production revival during the regreening process.
Antibacterial activity of Beta vulgaris L. pomace extract
Directory of Open Access Journals (Sweden)
Velićanski Aleksandra S.
2011-01-01
Full Text Available Antibacterial activity of Beta vulgaris L. (beetroot pomace extract (concentration 100 mg/ml was tested against five Gram positive and seven Gram negative bacterial strains (reference cultures and natural isolates. Disc diffusion method with 15 µl of extract and agar-well diffusion method with 50 and 100 µl were used. Antibiotic (cefotaxime/clavulanic acid was used as a control sample. The tested extract showed the highest activity against Staphylococcus aureus and Bacillus cereus, where clear zones (without growth appeared. There was no any activity against other tested Gram-positive bacteria, except for Staphylococcus epidermidis, with a small zone of reduced growth. Growth of all tested Gram-negative bacteria was inhibited usually with 100 µl of extract. The most susceptible were Citrobacter freundii and Salmonella typhymurium. The tested antibiotic gave clear, usually large zones for all tested strains except for Staphylococcus cohni spp. cohni, where only a zone of reduced growth appeared.
The complete mitochondrial genome of Hydra vulgaris (Hydroida: Hydridae).
Pan, Hong-Chun; Fang, Hong-Yan; Li, Shi-Wei; Liu, Jun-Hong; Wang, Ying; Wang, An-Tai
2014-12-01
The complete mitochondrial genome of Hydra vulgaris (Hydroida: Hydridae) is composed of two linear DNA molecules. The mitochondrial DNA (mtDNA) molecule 1 is 8010 bp long and contains six protein-coding genes, large subunit rRNA, methionine and tryptophan tRNAs, two pseudogenes consisting respectively of a partial copy of COI, and terminal sequences at two ends of the linear mtDNA, while the mtDNA molecule 2 is 7576 bp long and contains seven protein-coding genes, small subunit rRNA, methionine tRNA, a pseudogene consisting of a partial copy of COI and terminal sequences at two ends of the linear mtDNA. COI gene begins with GTG as start codon, whereas other 12 protein-coding genes start with a typical ATG initiation codon. In addition, all protein-coding genes are terminated with TAA as stop codon.
Polyphosphate during the Regreening of Chlorella vulgaris under Nitrogen Deficiency.
Chu, Fei-Fei; Shen, Xiao-Fei; Lam, Paul K S; Zeng, Raymond J
2015-09-28
Polyphosphate (Poly-P) accumulation has been reported in Chlorella vulgaris under nitrogen deficiency conditions with sufficient P supply, and the process has been demonstrated to have great impact on lipid productivity. In this article, the utilization of polyphosphates and the regreening process under N resupplying conditions, especially for lipid production reviving, were investigated. This regreening process was completed within approximately 3-5 days. Polyphosphates were first degraded within 3 days in the regreening process, with and without an external P supply, and the degradation preceded the assimilation of phosphate in the media with an external P offering. Nitrate assimilation was markedly influenced by the starvation of P after polyphosphates were exhausted in the medium without external phosphates, and then the reviving process of biomass and lipid production was strictly impeded. It is, thus, reasonable to assume that simultaneous provision of external N and P is essential for overall biodiesel production revival during the regreening process.
PRODUCTIVITY OF MICROALGAE CHLORELLA VULGARIS IN LABORATORY CONDITION
Directory of Open Access Journals (Sweden)
Agnieszka Patyna
2017-06-01
Full Text Available Algae biomass is increasingly regarded as a potential resource that could be used to produce biofuels, electricity and heat. Algae contain a lot of nutrients, so they can be used as food for humans and livestock. Because of their valuable composition (many nutrients they are used as supplements of balanced diet, in turn taking into account their biosorption abbility they are used to detoxification of human body. Algae cultivation does not demand large areas of land to expose cells to sunlight, so their production rate is higher than vascular plants. Moreover algae cultivation lets to achieve high biomass concentration. Important cultivation factors are: illumination (light intensity is an important factor because it drives photosynthesis, CO2 supply, culture medium and mixing. The experimental research was conducted using Chlorella vulgaris BA 002 strain. The aim of this study was to determine the effectiveness of biomass growth in laboratory condition.
Lichen striatus associated with psoriasis vulgaris treated with oral acitretin
Directory of Open Access Journals (Sweden)
Enzo Errichetti
2014-01-01
Full Text Available Lichen striatus (LS is an uncommon dermatosis of unknown etiology that presents as a continuous or interrupted linear band of pink, tan, red or skin-colored papules in a blaschkoid distribution. The lesions are generally solitary and unilateral, but unusual extensive cases with multiple and bilateral lesions have been also described. Albeit LS is typically an asymptomatic and self-limited dermatosis, it may cause a significant psychological distress in some patients, thus requiring an appropriate therapy. Topical steroid is the most commonly used treatment but it is not always effective. We report a case of LS unresponsive to topical steroid therapy associated with psoriasis vulgaris successfully treated with oral acitretin.
Lupus Vulgaris Causing Nasal Destruction: Rare Presentation in Current Time
Directory of Open Access Journals (Sweden)
Md Rokon Uddin
2011-01-01
Full Text Available A 42-year-old lady reported with slowly progressive reddish lesions over the nose, followed by atrophy and ulceration for about 6 years. Clinical examination revealed atrophied, ulcerated, erythematous lesions over central face, forehead and neck destroying whole nose. Mantoux test resulted 16×18 mm on 48 hours observation. Histopathological examination of the lesion showed noncaseating grunuloma along with Langhans giant cells in the upper dermis surrounded by lymphocytes. The conclusive diagnosis was lupus vulgaris based on above findings. Six months therapy with INH 300 mg plus rifampicin 600 mg supplemented by initial 2 months ethambutol 1000 mg plus pyrazinamide 1500 mg daily resulted clean-looking perforation with healthy margin
Pemphigus Vulgaris Confined to the Gingiva: A Case Report
Directory of Open Access Journals (Sweden)
Mitsuhiro Ohta
2011-01-01
Full Text Available Pemphigus Vulgaris (PV is an autoimmune intraepithelial blistering disease involving the skin and mucous membranes. Oral mucosa is frequently affected in patients with PV, and oral lesions may be the first sign of the disease in majority of patients. In some patients, oral lesions may also be followed by skin involvement. Therefore, timely recognition and therapy of oral lesions is critical as it may prevent skin involvement. Early oral lesions of PV are, however, often regarded as difficult to diagnose, since the initial oral lesions may be relatively nonspecific, manifesting as superficial erosions or ulcerations, and rarely presenting with the formation of intact bullae. Lesions may occur anywhere on the oral mucosa including gingiva; however; desquamtive gingivitis is less common with PV than other mucocutaneous conditions such as pemphigoid or lichen planus. This paper describes the case of a patient presenting with a one-year history of painful gingival, who is finally diagnosed as having PV.
Mass propagation and essential oil analysis of Artemisia vulgaris.
Govindaraj, Sujatha; Kumari, Bollipo Diana Ranjitha; Cioni, Pier Luigi; Flamini, Guido
2008-03-01
Artemisia vulgaris L. (Mugwort) is a threatened and valuable medicinal plant. Attempts have been made in this research to mass propagate its plantlets through in vitro liquid culture technology using Murashige and Skoog (MS) basal medium supplemented with 6-benzyl adenine (BA) (0.44-8.88 microM). Initially, 22.6 shoots (99.9% shooting frequency) developed from shoot tip explants cultured in MS with 4.44 microM BA at 100 ml flask capacity. This was further subcultured at increasing flask capacity (150, 250, and 500 ml) for shoot proliferation. Of the different concentrations of BA and flask capacities tested, 4.44 microM BA and 500 ml flask capacity were found to produce a maximum of 85.5 shoots after 30 d of culture. Shoot proliferation was found to increase with increasing flask capacity whereas shoot number decreased with increasing BA concentration (>4.44 microM). Individual shoots were isolated and rooted on MS medium containing 8.56 microM indole-3-acetic acid (IAA). Then the plantlets were acclimatized under standard laboratory conditions and later under greenhouse conditions. Fresh leaves were collected from greenhouse-grown plants and subjected to essential oil analysis by the simultaneous distillation and extraction method. GC-MS results revealed the presence of 88 components and the extracted oil was rich in camphor (16.8%), alpha-thujone (11.3%), germacrene D (7.2%), camphene (6.5%), 1,8-cineole (5.8%) and beta-caryophyllene (5.4%). This in vitro strategy can be a reliable method for the steady production of a large number of plants for essential oil production, which is reported for the first time for A. vulgaris.
Transcriptome Profiling of the Phaseolus vulgaris - Colletotrichum lindemuthianum Pathosystem.
Padder, Bilal A; Kamfwa, Kelvin; Awale, Halima E; Kelly, James D
2016-01-01
Bean (Phaseolus vulgaris) anthracnose caused by the hemi-biotrophic pathogen Colletotrichum lindemuthianum is a major factor limiting production worldwide. Although sources of resistance have been identified and characterized, the early molecular events in the host-pathogen interface have not been investigated. In the current study, we conducted a comprehensive transcriptome analysis using Illumina sequencing of two near isogenic lines (NILs) differing for the presence of the Co-1 gene on chromosome Pv01 during a time course following infection with race 73 of C. lindemuthianum. From this, we identified 3,250 significantly differentially expressed genes (DEGs) within and between the NILs over the time course of infection. During the biotrophic phase the majority of DEGs were up regulated in the susceptible NIL, whereas more DEGs were up-regulated in the resistant NIL during the necrotrophic phase. Various defense related genes, such as those encoding PR proteins, peroxidases, lipoxygenases were up regulated in the resistant NIL. Conversely, genes encoding sugar transporters were up-regulated in the susceptible NIL during the later stages of infection. Additionally, numerous transcription factors (TFs) and candidate genes within the vicinity of the Co-1 locus were differentially expressed, suggesting a global reprogramming of gene expression in and around the Co-1 locus. Through this analysis, we reduced the previous number of candidate genes reported at the Co-1 locus from eight to three. These results suggest the dynamic nature of P. vulgaris-C. lindemuthianum interaction at the transcriptomic level and reflect the role of both pathogen and effector triggered immunity on changes in plant gene expression.
2006-06-09
done to facilitate the transition.52 CRS-12 53 David T. Stanley, Changing Administrations (Washington: Brookings Institution, 1965), p. 6. 54 “Pre...Conference of Mayors; Sharleen Hirsch, an educational administrator; and Jule Sugarman , a public administrator. Staff members were assigned to task forces...Issues,” Washington Post, Nov. 13, 1980, p. Al. 77 David Hoffman, “Bush Names Baker Secretary of State,” Washington Post, Nov. 10, 1988, pp. Al and
Yang, Minjune; Jawitz, James W; Lee, Minhee
2015-02-01
Laboratory scale rhizofiltration experiments were performed to investigate uranium and cesium accumulation in bean (Phaseolus vulgaris L. var. vulgaris) and its potential for treatment of uranium contaminated groundwater. During 72 h of rhizofiltration, the roots of the bean accumulated uranium and cesium to concentrations 317-1019 times above the initial concentrations, which ranged from 100 to 700 μg l(-1) in artificially contaminated solutions. When the pH of the solution was adjusted to 3, the ability to accumulate uranium was 1.6 times higher than it was for solutions of pH 7 and pH 9. With an initial uranium concentration of 240 μg l(-1) in genuine groundwater at pH 5, the bean reduced the uranium concentration by 90.2% (to 23.6 μg l(-1)) within 12 h and by 98.9% (to 2.8 μg l(-1)) within 72 h. A laboratory scale continuous clean-up system reduced uranium concentrations from 240 μg l(-1) to below 10 μg l(-1) in 56 h; the whole uranium concentration in the bean roots during system operation was more than 2600 μg g(-1) on a dry weight basis. Using SEM and EDS analyses, the uranium removal in solution at pH 7 was determined based on adsorption and precipitation on the root surface in the form of insoluble uranium compounds. The present results demonstrate that the rhizofiltration technique using beans efficiently removes uranium and cesium from groundwater as an eco-friendly and cost-effective method. Copyright © 2014 Elsevier Ltd. All rights reserved.
Khan, Mohd Sajjad Ahmad; Ahmad, Iqbal; Cameotra, Swaranjit Singh
2014-01-01
Emergence of drug-resistant strains has demanded for alternative means of combating fungal infections. Oils of Carum copticum and Thymus vulgaris have long been used in ethnomedicine for ailments of various fungal infections. Since their activity has not been reported in particular against drug-resistant fungi, this study was aimed to evaluate the effects of oils of C. copticum and T. vulgaris on the growth and virulence of drug-resistant strains of Aspergillus spp. and Trichophyton rubrum. The gas chromatography-mass spectrometry analysis revealed thymol constituting 44.71% and 22.82% of T. vulgaris and C. copticum, respectively. Inhibition of mycelial growth by essential oils was recorded in the order of thymol > T. vulgaris > C. copticum against the tested strains. RBC lysis assay showed no tested oils to be toxic even up to concentration two folds higher than their respective MFCs. Thymol exhibited highest synergy in combination with fluconazole against Aspergillus fumigatus MTCC2550 (FICI value 0.187) and T. rubrum IOA9 (0.156) as determined by checkerboard method. Thymol and T. vulgaris essential oil were equally effective against both the macro and arthroconidia growth (MIC 72 μg/mL). A > 80% reduction in elastase activity was recorded for A. fumigatus MTCC2550 by C. copticum, T. vulgaris oils and thymol. The effectiveness of these oils against arthroconidia and synergistic interaction of thymol and T. vulgaris with fluconazole can be exploited to potentiate the antifungal effects of fluconazole against drug-resistant strains of T. rubrum and Aspergillus spp.
Hot water extract of Chlorella vulgaris induced DNA damage and apoptosis
Directory of Open Access Journals (Sweden)
Yasmin Anum Mohd Yusof
2010-01-01
Full Text Available OBJECTIVES: The aim of this study was to determine the antiproliferative and apoptotic effects of hot water extracts of Chlorella vulgaris on hepatoma cell line HepG2. INTRODUCTION: The search for food and spices that can induce apoptosis in cancer cells has been a major study interest in the last decade. Chlorella vulgaris, a unicellular green algae, has been reported to have antioxidant and anti-cancer properties. However, its chemopreventive effects in inhibiting the growth of cancer cells have not been studied in great detail. METHODS: HepG2 liver cancer cells and WRL68 normal liver cells were treated with various concentrations (0-4 mg/ml of hot water extract of C. vulgaris after 24 hours incubation. Apoptosis rate was evaluated by TUNEL assay while DNA damage was assessed by Comet assay. Apoptosis proteins were evaluated by Western blot analysis. RESULTS: Chlorella vulgaris decreased the number of viable HepG2 cells in a dose dependent manner (p < 0.05, with an IC50 of 1.6 mg/ml. DNA damage as measured by Comet assay was increased in HepG2 cells at all concentrations of Chlorella vulgaris tested. Evaluation of apoptosis by TUNEL assay showed that Chlorella vulgaris induced a higher apoptotic rate (70% in HepG2 cells compared to normal liver cells, WRL68 (15%. Western blot analysis showed increased expression of pro-apoptotic proteins P53, Bax and caspase-3 in the HepG2 cells compared to normal liver cells WRL68, and decreased expression of the anti-apoptotic protein Bcl-2. CONCLUSIONS: Chlorella vulgaris may have anti-cancer effects by inducing apoptosis signaling cascades via an increased expression of P53, Bax and caspase-3 proteins and through a reduction of Bcl-2 protein, which subsequently lead to increased DNA damage and apoptosis.
Li, Ming; Liu, Hong; Tong, Ling; Fu, Yuming; He, Wenting; Hu, Enzhu; Hu, Dawei
The Integrative Experimental System (IES) was established as a tool to evaluate the rela-tionship of the subsystems in Bioregenerative Life Support System, and Multibiological Life Support System Experiments (MLSSE) have been conducted in the IES. The IES consists of a higher plant chamber, an animal chamber and a plate photo bioreactor (PPB) which cultivated lettuce (Lactuca sativa L.), silkworm (Bombyx Mori L.) and microalgae (Chlorella vulgaris), respectively. In MLSSE, four volunteers took turns breathing the system air through a tube connected with the animal chamber periodically. According to the CO2 concentration in the IES, the automotive control system of the PPB changed the light intensity regulating the photosynthesis of Chlorella vulgaris to make CO2 /O2 in the system maintain at stable levels. Chlorella vulgaris grew with human urine by carrying certain amount of alga liquid out of the bioreactor every day with synthetic urine replenished into the system, and O2 was regenerated, at the same time human urine was purified. Results showed that this IES worked stably and Chlorella vulgaris grew well; The culture of Chlorella vulgaris could be used to keep the balance of CO2 and O2 , and the change of light intensity could control the gas composition in the IES; Microalgae culture could be used in emergency in the system, the culture of Chlorella vulgaris could recover to original state in 5 days; 15.6 ml of condensation water was obtained every day by the culture of Chlorella vulgaris; The removal efficiencies of N, P in human urine could reach to 98.2% and 99.5%.
Hot water extract of Chlorella vulgaris induced DNA damage and apoptosis
Yusof, Yasmin Anum Mohd; Md. Saad, Suhana; Makpol, Suzana; Shamaan, Nor Aripin; Ngah, Wan Zurinah Wan
2010-01-01
OBJECTIVES: The aim of this study was to determine the antiproliferative and apoptotic effects of hot water extracts of Chlorella vulgaris on hepatoma cell line HepG2. INTRODUCTION: The search for food and spices that can induce apoptosis in cancer cells has been a major study interest in the last decade. Chlorella vulgaris, a unicellular green algae, has been reported to have antioxidant and anti‐cancer properties. However, its chemopreventive effects in inhibiting the growth of cancer cells have not been studied in great detail. METHODS: HepG2 liver cancer cells and WRL68 normal liver cells were treated with various concentrations (0‐4 mg/ml) of hot water extract of C. vulgaris after 24 hours incubation. Apoptosis rate was evaluated by TUNEL assay while DNA damage was assessed by Comet assay. Apoptosis proteins were evaluated by Western blot analysis. RESULTS: Chlorella vulgaris decreased the number of viable HepG2 cells in a dose dependent manner (p Chlorella vulgaris tested. Evaluation of apoptosis by TUNEL assay showed that Chlorella vulgaris induced a higher apoptotic rate (70%) in HepG2 cells compared to normal liver cells, WRL68 (15%). Western blot analysis showed increased expression of pro‐ apoptotic proteins P53, Bax and caspase‐3 in the HepG2 cells compared to normal liver cells WRL68, and decreased expression of the anti‐apoptotic protein Bcl‐2. CONCLUSIONS: Chlorella vulgaris may have anti‐cancer effects by inducing apoptosis signaling cascades via an increased expression of P53, Bax and caspase‐3 proteins and through a reduction of Bcl‐2 protein, which subsequently lead to increased DNA damage and apoptosis. PMID:21340229
Carum copticum and Thymus vulgaris oils inhibit virulence in Trichophyton rubrum and Aspergillus spp
Khan, Mohd Sajjad Ahmad; Ahmad, Iqbal; Cameotra, Swaranjit Singh
2014-01-01
Emergence of drug-resistant strains has demanded for alternative means of combating fungal infections. Oils of Carum copticum and Thymus vulgaris have long been used in ethnomedicine for ailments of various fungal infections. Since their activity has not been reported in particular against drug-resistant fungi, this study was aimed to evaluate the effects of oils of C. copticum and T. vulgaris on the growth and virulence of drug-resistant strains of Aspergillus spp. and Trichophyton rubrum. The gas chromatography-mass spectrometry analysis revealed thymol constituting 44.71% and 22.82% of T. vulgaris and C. copticum, respectively. Inhibition of mycelial growth by essential oils was recorded in the order of thymol > T. vulgaris > C. copticum against the tested strains. RBC lysis assay showed no tested oils to be toxic even up to concentration two folds higher than their respective MFCs. Thymol exhibited highest synergy in combination with fluconazole against Aspergillus fumigatus MTCC2550 (FICI value 0.187) and T. rubrum IOA9 (0.156) as determined by checkerboard method. Thymol and T. vulgaris essential oil were equally effective against both the macro and arthroconidia growth (MIC 72 μg/mL). A > 80% reduction in elastase activity was recorded for A. fumigatus MTCC2550 by C. copticum, T. vulgaris oils and thymol. The effectiveness of these oils against arthroconidia and synergistic interaction of thymol and T. vulgaris with fluconazole can be exploited to potentiate the antifungal effects of fluconazole against drug-resistant strains of T. rubrum and Aspergillus spp. PMID:25242937
Aslan, İbrahim; Özcan, Filiz; Karaarslan, Taner; Kıraç, Ebru; Aslan, Mutay
2017-01-01
This study aimed to determine circulating levels of polyunsaturated fatty acids (PUFAs), secretory phospholipase A2 (sPLA2), lipoprotein lipase (LPL) and measure circulating protein levels of angiopoietin-like protein 3 (ANGPTL3), ANGPTL4, cyclooxygenase-2 (COX-2) and prostaglandin E2 (PGE2) in patients with acne vulgaris. Serum from 21 control subjects and 31 acne vulgaris patients were evaluated for levels of arachidonic acid (AA, C20:4n- 6), dihomo-gamma-linolenic acid (DGLA, C20:3n-6), eicosapentaenoic acid (EPA, C20:5n-3) and docosahexaenoic acid (DHA, C22:6n-3). PUFA levels were determined by an optimized multiple reaction monitoring (MRM) method using ultra fast-liquid chromatography (UFLC) coupled with tandem mass spectrometry (MS/MS). Lipid profile, routine biochemical and hormone parameters were assayed by standard kit methods Serum EPA levels were significantly decreased while AA/EPA and DGLA/EPA ratio were significantly increased in acne vulgaris patients compared to controls. Serum levels of AA, DGLA and DHA showed no significant difference while activity of sPLA2 and LPL were significantly increased in acne vulgaris compared to controls. Results of this study reveal the presence of a proinflammatory state in acne vulgaris as shown by significantly decreased serum EPA levels and increased activity of sPLA2, AA/EPA and DGLA/EPA ratio. Increased LPL activity in the serum of acne vulgaris patients can be protective through its anti-dyslipidemic actions. This is the first study reporting altered EPA levels and increased sPLA2 activity in acne vulgaris and supports the use of omega-3 fatty acids as adjuvant treatment for acne patients. Copyright © 2016 Elsevier Inc. All rights reserved.
Farida Tabri, Farida Tabri
2016-01-01
- Abstract: Topical tretinoin is used by the dermatolovenereologist and aesthetic physicians in patients with mild acne vulgaris, so it is necessary to be investigated. The aim of the study was to assess the effectiveness of benzoyl peroxide gel compared to tretinoin gel on persons with mild acne vulgaris and identify Propionibacterium acnes in patients with mild acne vulgaris. The research method was a clinical trial, double blind randomization. Patients with mild acne vulgaris were rando...
Energy Technology Data Exchange (ETDEWEB)
Hamrin, J.G.
1980-01-01
Solar energy programs are entering a critical transitional period as we move from the initial marketing of solar technologies into a phase of widespread commercialization. We face the dual challenge of trying to get enough solar systems in place fast enough to prove solar is a viable alternative, while trying to ensure the systems are designed and installed properly, proving the energy savings as promised. This is a period of both great opportunity and high risk as the field becomes crowded with new solar cheerleaders and supporters but seldom enough competent players. The status of existing and proposed programs for the accelerated commercialization of solar energy in California is described.
DEFF Research Database (Denmark)
Raahauge, Kirsten Marie
2008-01-01
This article deals with representations of one specific city, Århus, Denmark, especially its central district. The analysis is based on anthropological fieldwork conducted in Skåde Bakker and Fedet, two well-off neighborhoods. The overall purpose of the project is to study perceptions of space...... and the interaction of cultural, social, and spatial organizations, as seen from the point of view of people living in Skåde Bakker and Fedet. The focus is on the city dwellers’ representations of the central district of Århus with specific reference to the concept of transit space. When applied to various Århusian...
Inhibition of lentivirus replication by aqueous extracts of Prunella vulgaris
Directory of Open Access Journals (Sweden)
Hauck Cathy
2009-01-01
Full Text Available Abstract Background Various members of the mint family have been used historically in Chinese and Native American medicine. Many of these same family members, including Prunella vulgaris, have been reported to have anti-viral activities. To further characterize the anti-lentiviral activities of P. vulgaris, water and ethanol extractions were tested for their ability to inhibit equine infectious anemia virus (EIAV replication. Results Aqueous extracts contained more anti-viral activity than did ethanol extracts, displaying potent anti-lentiviral activity against virus in cell lines as well as in primary cell cultures with little to no cellular cytotoxicity. Time-of-addition studies demonstrated that the extracts were effective when added during the first four h of the viral life cycle, suggesting that the botanical constituents were targeting the virion itself or early entry events. Further analysis revealed that the extracts did not destroy EIAV virion integrity, but prevented viral particles from binding to the surface of permissive cells. Modest levels of anti-EIAV activity were also detected when the cells were treated with the extracts prior to infection, indicating that anti-EIAV botanical constituents could interact with both viral particles and permissive cells to interfere with infectivity. Size fractionation of the extract demonstrated that eight of the nine fractions generated from aqueous extracts displayed anti-viral activity. Separation of ethanol soluble and insoluble compounds in the eight active fractions revealed that ethanol-soluble constituents were responsible for the anti-viral activity in one fraction whereas ethanol-insoluble constituents were important for the anti-viral activity in two of the other fractions. In three of the five fractions that lost activity upon sub-fractionation, anti-viral activity was restored upon reconstitution of the fractions, indicating that synergistic anti-viral activity is present in several
Protective Effect of Zizphus Vulgaris Extract, on Liver Toxicity in Laboratory Rats
Directory of Open Access Journals (Sweden)
S Ebrahimi
2011-06-01
Full Text Available Introduction & Objective: Some of natural and synthetic products have antioxidant properties which protect the liver against the destructive factors. This study aimed to investigate the effect of Zizphus Vulgaris extracts on mice liver. Materials & Methods: This experimental study was conducted at Yasouj University of Medical Sciences in 2010 on 30 healthy adult male Wistar rats. Animals were randomly divided into five equal groups: the control group (receiving, olive oil, control group (receiving olive oil and carbon tetrachloride and three intervention groups (receiving different dose of carbon tetrachloride and olive oil groups. The intervention group was given daily doses of 200, 400 and 600 mg per Kg of Zizphus Vulgaris extract by gavage respectively. After 45 days, the amount of liver enzymes, total protein, albumin and bilirubin in animal’s sera were measured. Data were analyzed by the SPSS software, using ANOVA and t-test. Results: The concentration of total protein, albumin, AST, ALT, ALP in test groups I, II and III receiving Z.Vulgaris extract (200, 400 and 600 mg/kg weight compared with control group were statistically not significant. Consumption of Z.Vulgaris reduced the bilirubin concentration in test groups I and II but this decrease was significant only in the test group I Increasing of Z.Vulgaris dose in the test group III (600 mg Z.Vulgaris per kg body weight showed increase in the level of serum bilirubin. Increase in the ratio of liver weight to body weight of rats in groups I and III in comparison with control groups was noticed although this difference was not statistically significant. Findings of this study revealed that dosage of 600 mg/kg extract of Z.Vulgaris caused significant improvements in CCl4 induced liver necrosis (P <0.01 and reduced portal cells inflammation (P <0.01. Dose of 400 mg/kg of Z.Vulgaris induced some destruction and necrosis of liver cells in animals but significant reduction of portal cells
Treatment of Active Acne Vulgaris by Chemical Peeling Using 88% Lactic Acid
Directory of Open Access Journals (Sweden)
Khalifa E. Sharquie
2014-10-01
Full Text Available Introduction: The etiopathogenesis of acne vulgaris is multifactorial, and its therapy is prolonged course that might be not accepted by many patients. Most recently TCA 35% one session peeling gave complete clearance and full remission for active acne vulgaris. Lactic acid has been used effectively as therapeutic topical agents for many skin diseases. Aim: To evaluate the efficacy and safety of chemical peeling using 88% lactic acid solution in the treatment of active acne vulgaris. Material and Methods: This clinical, interventional, therapeutic study was done at the Department of Dermatology, Baghdad Teaching Hospital, during the period from October 2012 to October 2013. Twenty five patients with active acne vulgaris were included, 15 (60% females and 10 (40% males and their ages ranged from 16-36 (21.5000± 5.46279 years. Fifteen patients were associated with acne scars. Three chemical peels using 88% lactic acid solution was carried out two weeks apart for patients with active acne vulgaris with or without scarring. Scoring for active acne vulgaris and acne scar was done for each case before and after operation to evaluate the severity of acne and the degree of scar before and after treatment. All patients were with Fitzpatrick’s skin types III and IV. Patients were followed up every two weeks during period of therapy and monthly for 3 months after stopping the treatment. Results: Twenty five patients with active acne vulgaris were treated with 3 sessions of lactic acid, fifteen patients had associated acne scar. Scoring for active acne vulgaris including papules and pustules showed highly statistically significant reduction after 2 weeks of therapy (p=0.0001, after 4 weeks (p=0.0001and after 6 weeks (p=0.0001, with percent reduction 87.2% for papules and 94% for pustules after end of sessions while after 3 months follow up the reduction rate for papules 93.8% and p-value (p=0.001 and for pustules 97.6% and (p=0.0001. While the scarring
Energy Technology Data Exchange (ETDEWEB)
Zhang, Weiwen; Culley, David E.; Gritsenko, Marina A.; Moore, Ronald J.; Nie, Lei; Scholten, Johannes C.; Petritis, Konstantinos; Strittmatter, Eric F.; Camp, David G.; Smith, Richard D.; Brockman, Fred J.
2006-11-03
ABSTRACT In the previous study, the whole-genome gene expression profiles of D. vulgaris in response to oxidative stress and heat shock were determined. The results showed 24-28% of the responsive genes were hypothetical proteins that have not been experimentally characterized or whose function can not be deduced by simple sequence comparison. To further explore the protecting mechanisms employed in D. vulgaris against the oxidative stress and heat shock, attempt was made in this study to infer functions of these hypothetical proteins by phylogenomic profiling along with detailed sequence comparison against various publicly available databases. By this approach we were ableto assign possible functions to 25 responsive hypothetical proteins. The findings included that DVU0725, induced by oxidative stress, may be involved in lipopolysaccharide biosynthesis, implying that the alternation of lipopolysaccharide on cell surface might service as a mechanism against oxidative stress in D. vulgaris. In addition, two responsive proteins, DVU0024 encoding a putative transcriptional regulator and DVU1670 encoding predicted redox protein, were sharing co-evolution atterns with rubrerythrin in Archaeoglobus fulgidus and Clostridium perfringens, respectively, implying that they might be part of the stress response and protective systems in D. vulgaris. The study demonstrated that phylogenomic profiling is a useful tool in interpretation of experimental genomics data, and also provided further insight on cellular response to oxidative stress and heat shock in D. vulgaris.
Evaluating of Life Quality in Patients with Acne Vulgaris Using Generic and Specific Questionnaires
Directory of Open Access Journals (Sweden)
Reza Ghaderi
2013-01-01
Full Text Available Background. Acne vulgaris is a common skin disease that can adversely affect the quality of life of patients. Objective. The aim of this study was to determine the quality of life in patients with acne vulgaris. Methods. This study was carried out on 70 patients with acne vulgaris (28 males, 42 females. All the patients filled out two Persian versions of questionnaires: short form 36 (SF-36 and Dermatology Life Quality Index (DLQI. The obtained data were analyzed by using SPSS software (version 17. Results. The scores for physical functioning, social functioning, and bodily pain domains in patients were over 70%, but the scores for role physical, general health, vitality, role emotional, and mental health in patients were under 70%. Scores on the DLQI in patients with acne vulgaris ranged from 0 to 22 (mean ± SD, 8.18 ± 4.83. After comparing mean score of DLQI with respect to gender and age, it was found that the difference between the two groups was not statistically significant. Conclusion. Acne vulgaris has a significant effect on the quality of life. There was not any significant gender or age related difference in QOL.
Quality of life in acne vulgaris: Relationship to clinical severity and demographic data
Directory of Open Access Journals (Sweden)
Aayush Gupta
2016-01-01
Full Text Available Background: Acne vulgaris is known to impair many aspects of quality of life. However, the correlation of this impairment with clinical severity remains equivocal despite various school, community and hospital-based studies. Aim: A hospital-based study was undertaken to measure the impairment of quality of life of patients of acne vulgaris and correlate it with the severity of lesions. Methods: This was a cross-sectional, questionnaire-based study in a cohort of 100 patients of acne vulgaris attending the outpatient department of our referral hospital. A physician measured the severity of lesions using the global acne grading system, and patients assessed quality of life by completing a questionnaire (Cardiff acne disability index. A correlation of these two was done; some additional correlations were brought out through demographic data collected from the patients. Results: There was no correlation between the severity of acne vulgaris and an impaired quality of life. Patients who consumed alcohol and/or smoked cigarettes were found to have an impaired quality of life. While the severity of acne progressively lessened in older patients, the impact on quality of life increased. Limitations: The sample size was small and there was a lack of guaranteed reliability on the self-reported quality of life. Conclusion: The severity of acne vulgaris does not correlate with impairment in quality of life.
Effect of polyacetylenic acids from Prunella vulgaris on various plant pathogens.
Yoon, M-Y; Choi, G J; Choi, Y H; Jang, K S; Park, M S; Cha, B; Kim, J-C
2010-11-01
This study is aiming at characterizing antifungal substances from the methanol extract of Prunella vulgaris and at investigating those substances' antifungal and antioomycete activities against various plant pathogens. Two polyacetylenic acids were isolated from P. vulgaris as active principles and identified as octadeca-9,11,13-triynoic acid and trans-octadec-13-ene-9,11-diynoic acid. These two compounds inhibited the growth of Magnaporthe oryzae, Rhizoctonia solani, Phytophthora infestans, Sclerotinia sclerotiorum, Fusarium oxysporum f. sp. raphani, and Phytophthora capsici. In addition, these two compounds and the wettable powder-type formulation of an n-hexane fraction of P. vulgaris significantly suppressed the development of rice blast, tomato late blight, wheat leaf rust, and red pepper anthracnose. These data show that the extract of P. vulgaris and two polyacetylenic acids possess antifungal and antioomycete activities against a broad spectrum of tested plant pathogens. This is the first report on the occurrence of octadeca-9,11,13-triynoic acid and trans-octadec-13-ene-9,11-diynoic acid in P. vulgaris and their efficacy against plant diseases. The crude extract containing the two polyacetylenic acids can be used as a natural fungicide for the control of various plant diseases. © 2010 The Authors. © 2010 The Society for Applied Microbiology.
Chlorella vulgaris Induces Apoptosis of Human Non-Small Cell Lung Carcinoma (NSCLC) Cells.
Zhang, Zhi-Dong; Liang, Kai; Li, Kun; Wang, Guo-Quan; Zhang, Ke-Wei; Cai, Lei; Zhai, Shui-Ting; Chou, Kuo-Chen
2017-01-01
Chlorella vulgaris (C. vulgaris), a unicellular green microalga, has been widely used as a food supplement and reported to have antioxidant and anticancer properties. The current study was designed to assess the cytotoxic, apoptotic, and DNA-damaging effects of C. vulgaris growth factor (CGF), hot water C. vulgaris extracts, inlung tumor A549 and NCI-H460 cell lines. A549 cells, NCI-H460 cells, and normal human fibroblasts were treated with CGF at various concentrations (0-300 μg/ml) for 24 hr. The comet assay and γH2AX assay showed DNA damage in A549 and NCI-H460 cells upon CGF exposure. Evaluation of apoptosis by the TUNEL assay and DNA fragmentation analysis by agarose gel electrophoresis showed that CGF induced apoptosis in A549 and NCI-H460 cells. Chlorella vulgaris hot water extract induced apoptosis and DNA damage in human lung carcinoma cells. CGF can thus be considered a potential cytotoxic or genotoxic drug for treatment of lung carcinoma. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Effect of humic acids on the metabolism of Chlorella vulgaris in a model experiment
Toropkina, M. A.; Ryumin, A. G.; Kechaikina, I. O.; Chukov, S. N.
2017-11-01
The effect of humic acids (HAs) on physiological processes (photosynthesis, respiration, and abundance) of green microalga Chlorella vulgaris has been studied, and the relationships between the physiological activity of HAs and their structural parameters have been investigated. It has been found that the optimum range of HA concentrations for the growth of C. vulgaris is 0.01-0.03%. In this range, the highest positive effect on total photosynthesis increment is due to hydrophilic HA preparations from fallow soddypodzolic soil (Albic Retisol) and virgin gray soil (Luvic Greyzemic Phaeozem). The minimum stimulation of respiration is noted for all HA preparations in the region of the maximum photosynthesis stimulation. At concentrations above 0.003%, all HA preparations have a negative effect: the rate of photosynthesis in C. vulgaris cells decreases, and their respiration is strongly enhanced. The abundance of C. vulgaris under the effect of all of the studied preparations under illumination increases more rapidly than in the dark. A high positive coefficient of correlation is found between the hydrophilicity of HAs calculated from 13C NMR data and the photosynthesis rate in C. vulgaris.
Magnesium Uptake by the Green Microalga Chlorella vulgaris in Batch Cultures.
Ben Amor-Ben Ayed, Hela; Taidi, Behnam; Ayadi, Habib; Pareau, Dominique; Stambouli, Moncef
2016-03-01
The accumulation (internal and superficial distribution) of magnesium ions (Mg(2+)) by the green freshwater microalga Chlorella vulgaris (C. vulgaris) was investigated under autotrophic culture in a stirred photobioreactor. The concentrations of the three forms of Mg(2+) (dissolved, extracellular, and intracellular) were determined with atomic absorption spectroscopy during the course of C. vulgaris growth. The proportions of adsorbed (extracellular) and absorbed (intracellular) Mg(2+) were quantified. The concentration of the most important pigment in algal cells, chlorophyll a, increased over time in proportion to the increase in the biomass concentration, indicating a constant chlorophyll/biomass ratio during the linear growth phase. The mean-average rate of Mg(2+) uptake by C. vulgaris grown in a culture medium starting with 16 mg/l of Mg(2+) concentration was measured. A clear relationship between the biomass concentration and the proportion of the Mg(2+) removal from the medium was observed. Of the total Mg(2+) present in the culture medium, 18% was adsorbed on the cell wall and 51% was absorbed by the biomass by the end of the experiment (765 h). Overall, 69% of the initial Mg(2+) were found to be removed from the medium. This study supported the kinetic model based on a reversible first-order reaction for Mg(2+) bioaccumulation in C. vulgaris, which was consistent with the experimental data.
Phylogenetic diversity of rhizobial species and symbiovars nodulating Phaseolus vulgaris in Iran.
Rouhrazi, Kiomars; Khodakaramian, Gholam; Velázquez, Encarna
2016-03-01
The phylogenetic diversity of 29 rhizobial strains nodulating Phaseolus vulgaris in Iran was analysed on the basis of their core and symbiotic genes. These strains displayed five 16S rRNA-RFLP patterns and belong to eight ERIC-PCR clusters. The phylogenetic analyses of 16S rRNA, recA and atpD core genes allowed the identification of several strains as Rhizobium sophoriradicis, R. leguminosarum, R. tropici and Pararhizobium giardinii, whereas other strains represented a new phylogenetic lineage related to R. vallis. These strains and those identified as R. sophoriradicis and R. leguminosarum belong to the symbiovar phaseoli carrying the γ nodC allele distributed in P. vulgaris endosymbionts in America, Europe, Africa and Asia. The strain identified as R. tropici belongs to the symbiovar tropici carried by strains of R. tropici, R. leucaenae, R. lusitanum and R. freirei nodulating P. vulgaris in America, Africa and Asia. The strain identified as P. giardinii belongs to the symbiovar giardinii together with the type strain of this species nodulating P. vulgaris in France. It is remarkable that the recently described species R. sophoriradicis is worldwide distributed in P. vulgaris nodules carrying the γ nodC allele of symbiovar phaseoli harboured by rhizobia isolated in the American distribution centers of this legume. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus.
Pensel, P E; Maggiore, M A; Gende, L B; Eguaras, M J; Denegri, M G; Elissondo, M C
2014-01-01
The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.
Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus
Directory of Open Access Journals (Sweden)
P. E. Pensel
2014-01-01
Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.
DEFF Research Database (Denmark)
Nielsen, Martin Krarup; Peterson, David S.; Monrad, Jesper
2008-01-01
Strongylus vulgaris is an important strongyle nematode with high pathogenic potential infecting horses world-wide. Several decades of intensive anthelminitic use has virtually eliminated clinical disease caused by S. vulgaris, but has also causes high levels of anthelmintic resistance in equine...
Hashmi, Laila Salim Al; Hossain, Mohammad Amzad; Weli, Afaf Mohammed; Al-Riyami, Qasim; Al-Sabahi, Jamal Nasser
2013-01-01
To isolate and analyze the chemical composition in different crude extracts of from the leaves of locally grown of Thymus vulgaris L (T. vulgaris) by gas chromatography-mass spectrometry (GC-MS). The shade dried leaves powder was extracted with methanol by using Soxhlet extractor. Methanol crude extracts of T. vulgaris and the derived fractions of hexane, chloroform, ethyl acetate and butanol were obtained. Qualitative analyses of various organic crude extracts of T. vulgaris by using GC-MS showed that there were different types of high and low molecular weight compounds. Most of the isolated and identified compounds by GC-MS in the crude extracts are basically biologically important. Further, the T. vulgaris leaf possessed certain characteristics that can be ascribed to cultivation on a domestic plantation. The crude extracts were prepared from the powder leaves of T. vulgaris for respective compounds can be chosen on the basis of above GC-MS analysis. All the major compounds were identified and characterized by spectroscopic method in different organic crude extracts of T. vulgaris are biologically active molecules. Thus the identification of a good number of compounds in various crude extracts of T. vulgaris might have some ecological role.
Mohsenipour, Zeinab; Hassanshahian, Mehdi
2015-01-01
Microorganisms are responsible for many problems in industry and medicine because of biofilm formation. Therefore, this study was aimed to examine the effect of Thymus vulgaris (T. vulgaris) extracts on the planktonic form and biofilm structures of six pathogenic bacteria. Antimicrobial activities of the plant extracts against the planktonic form of the bacteria were determined using the disc diffusion method. MIC and MBC values were evaluated using macrobroth dilution technique. Anti-biofilm effects were assessed by microtiter plate method. According to disc diffusion test (MIC and MBC), the ability of Thymus vulgaris (T. vulgaris ) extracts for inhibition of bacteria in planktonic form was confirmed. In dealing with biofilm structures, the inhibitory effect of the extracts was directly correlated to their concentration. Except for the inhibition of biofilm formation, efficacy of each extract was independent from type of solvent. According to the potential of Thymus vulgaris (T. vulgaris) extracts to inhibit the test bacteria in planktonic and biofilm form, it can be suggested that Thymus vulgaris (T. vulgaris) extracts can be applied as antimicrobial agents against the pathogenic bacteria particularly in biofilm forms.
Common crupina (Crupina vulgaris) is an annual plant of major importance in the Western United States. There are two varieties of crupina, i.e., var. vulgaris and var. brachypappa that occur in North America. Only by artificial plant vernalization, is it possible to synchronize bolting between var...
Directory of Open Access Journals (Sweden)
Zinab Mohsenipour
2015-06-01
Full Text Available Objective: Microorganisms are responsible for many problems in industry and medicine because of biofilm formation. Therefore, this study was aimed to examine the effect of Thymus vulgaris (T. vulgaris extracts on the planktonic form and biofilm structures of six pathogenic bacteria. Materials and methods: Antimicrobial activities of the plant extracts against the planktonic form of the bacteria were determined using the disc diffusion method. MIC and MBC values were evaluated using macrobroth dilution technique. Anti-biofilm effects were assessed by microtiter plate method. Results: According to disc diffusion test (MIC and MBC, the ability of Thymus vulgaris (T. vulgaris extracts for inhibition of bacteria in planktonic form was confirmed. In dealing with biofilm structures, the inhibitory effect of the extracts was directly correlated to their concentration. Except for the inhibition of biofilm formation, efficacy of each extract was independent from type of solvent. Conclusion: According to the potential of Thymus vulgaris (T. vulgaris extracts to inhibit the test bacteria in planktonic and biofilm form, it can be suggested that Thymus vulgaris(T. vulgaris extracts can be applied as antimicrobial agents against the pathogenic bacteria particularly in biofilm forms.
Loi, Barbara; Fantini, Noemi; Colombo, Giancarlo; Gessa, Gian Luigi; Riva, Antonella; Bombardelli, Ezio; Morazzoni, Paolo; Carai, Mauro A M
2013-02-01
Extracts from Phaseolus vulgaris and Cynara scolymus may reduce food intake and/or postprandial glycemia. This study investigated the effect of standardized extracts of P. vulgaris and C. scolymus and their combination on food intake and glycemia in rats. P. vulgaris and C. scolymus extracts, and their 1:2 combination, were administered acutely to rats (a) given access to regular food and water, (b) given access to regular food, water, and a chocolate-flavored beverage, or (c) infused with a starch bolus. P. vulgaris extract and the combination produced comparable reductions in intake of regular food and chocolate-flavored beverage; conversely, C. scolymus extract was ineffective on both parameters. P. vulgaris and C. scolymus extracts additively contributed to the reducing effect of the combination on glycemic rise. These results suggest that a mixture of P. vulgaris and C. scolymus extracts is preferable over each single extract, as it combines the anorectic effect of the P. vulgaris extract with the hypoglycemic effect of both extracts. These data support the recent clinical use of the combination of P. vulgaris and C. scolymus extracts in the control of appetite, food intake, and postprandial glycemia and represent a successful example of translational research in the nutraceutical field. Copyright © 2012 John Wiley & Sons, Ltd.
Structure and mechanical properties of Octopus vulgaris suckers.
Tramacere, Francesca; Kovalev, Alexander; Kleinteich, Thomas; Gorb, Stanislav N; Mazzolai, Barbara
2014-02-06
In this study, we investigate the morphology and mechanical features of Octopus vulgaris suckers, which may serve as a model for the creation of a new generation of attachment devices. Octopus suckers attach to a wide range of substrates in wet conditions, including rough surfaces. This amazing feature is made possible by the sucker's tissues, which are pliable to the substrate profile. Previous studies have described a peculiar internal structure that plays a fundamental role in the attachment and detachment processes of the sucker. In this work, we present a mechanical characterization of the tissues involved in the attachment process, which was performed using microindentation tests. We evaluated the elasticity modulus and viscoelastic parameters of the natural tissues (E ∼ 10 kPa) and measured the mechanical properties of some artificial materials that have previously been used in soft robotics. Such a comparison of biological prototypes and artificial material that mimics octopus-sucker tissue is crucial for the design of innovative artificial suction cups for use in wet environments. We conclude that the properties of the common elastomers that are generally used in soft robotics are quite dissimilar to the properties of biological suckers.
Vanadium, rubidium and potassium in Octopus vulgaris (Mollusca: Cephalopoda
Directory of Open Access Journals (Sweden)
Sónia Seixas
2005-06-01
Full Text Available The levels of vanadium, rubidium and potassium were determined in Octopus vulgaris caught during commercial fishing activities at three locations (Cascais, Santa Luzia and Viana do Castelo in Portugal in autumn and spring. We determined the concentration of these elements in digestive gland, branchial heart, gills, mantle and arms in males and females. At least five males and five females were assessed for each season/location combination. Elemental concentrations were determined by Particle Induced X-ray Emission (PIXE. Vanadium was detectable only in digestive gland and branchial heart samples. Its concentration was not correlated with total weight, total length or mantle length. There were no differences in concentrations of V, Rb and K between sexes. There were significant differences in vanadium concentrations in branchial hearts in autumn between samples from Viana do Castelo and those from the other two sites. We found a significant positive relationship between the concentration of vanadium and those of potassium and rubidium in branchial hearts. Branchial hearts appear to play an important role in decontamination of V.
Loss of normal anagen hair in pemphigus vulgaris.
Daneshpazhooh, M; Mahmoudi, H R; Rezakhani, S; Valikhani, M; Naraghi, Z S; Mohammadi, Y; Habibi, A; Chams-Davatchi, C
2015-07-01
Pemphigus vulgaris (PV) is a known cause of loss of 'normal' anagen hair; that is, shedding of intact anagen hairs covered by root sheaths. However, studies on this subject are limited. To investigate anagen hair shedding in patients with PV, and ascertain its association with disease severity. In total, 96 consecutive patients with PV (new patients or patients in relapse) who were admitted to the dermatology wards of a tertiary hospital were enrolled in this study. Demographic data, PV phenotype, disease severity and presence of scalp lesions were recorded. A group of 10-20 hairs were pulled gently from different areas of the scalp (lesional and nonlesional skin) in all patients, and anagen hairs were counted. Disease severity was graded according to Harman score. Anagen hair was obtained by pull test in 59 of the 96 patients (61.5%), of whom 2 had normal scalp. The mean ± SD anagen hair count was 5.9 ± 7.6 (range 0-31). In univariate analysis, anagen hair loss (P hair count was significantly higher in the severe (mean 6.83 ± 7.89) than the moderate (mean 1.06 ± 1.94) subgroup (P hair loss (OR = 1.16, 95% CI = 1.05-1.28, P hair loss was an independent predictor of the disease severity. © 2015 British Association of Dermatologists.
Management of Severe Acne Vulgaris With Topical Therapy.
Stein Gold, Linda; Baldwin, Hilary E; Lin, Tina
2017-11-01
Acne vulgaris (acne) is the most common skin disease we see in dermatology practice. Although rare in childhood, severe acne can affect up to 12% of the adolescent population. A chronic disease, it requires both aggressive management and effective maintenance strategies. Oral antibiotics, in combination with topical agents are recommended for treatment, with topical agents being continued as maintenance therapy to minimize resistance and recurrence. However, concerns with systemic side effects have recently resulted in a greater focus on the potential of fixed combination topical therapies to treat severe acne. Here we review the available clinical evidence. There are no studies investigating the use of fixed combination topical therapy exclusively in severe acne. However, studies assessing the treatment of moderate-to-severe acne include subpopulation data in severe patients. Adapalene 0.3%-benzoyl peroxide (BP) 2.5% was found to be effective in patients with severe acne, whereas the fixed combination with a lower concentration of adapalene (0.1%) was no more effective than vehicle. Clindamycin-BP 1.2%/3.75% gel and clindamycin-BP 1.2%/2.5% gel were both found to be effective in severe acne with an apparent BP-dose response. Clindamycin phosphate 1.2%-tretinoin 0.025% demonstrated similar efficacy in severe acne, but with little benefit over individual monads. Realistic topical treatment options now exist for the management of severe acne where patient and physician preference can impact positive outcomes. J Drugs Dermatol. 2017;16(11):1134-1138..
Antinociceptive effects of hydroalcoholic extract of Thymus vulgaris.
Taherian, Abbas Ali; Babaei, Mahdi; Vafaei, Abbas Ali; Jarrahi, Morteza; Jadidi, Majid; Sadeghi, Hassan
2009-01-01
Previous investigation has shown that Thymus Vulgaris (TV) modulates pain. The aim of this work was to examine the role of TV on acute and chronic pain and compares its effect with dexamethasone (DEX) and stress (ST) by using hot plate, tail flick and formalin tests in mice. In this study male albino mice (25-30 g.) in 21 groups (n=147) were used. TV (100, 500 and 1000 mg/kg), DEX (0.5, 1 and 2 mg/kg) and vehicle (VEH) were injected 30 minutes before pain assessment tests. Stress was applied by 1 min swimming in cold water (18-22 degrees ). Acute and chronic pain was assessed by hot plate, tail flick and formalin tests. For assessment of the role of opioid receptors in antinoceception of TV extract, Naloxon (NAL, 2mg/kg, ip) as opioid receptor antagonist was injected before the injection of the more effective dose (500 mg/kg) of TV extract. Results indicated that TV, DEX and ST have analgesic effects in all tests (P<0.01 in comparison with control group). Above findings showed that TV extract, DEX and ST have modulatory effects on acute and chronic pain. Further research is required to determine the mechanisms by which TV extract has an inhibitory effect on pain sensation.
Activity of Thymus vulgaris essential oil against Anisakis larvae.
Giarratana, F; Muscolino, D; Beninati, C; Giuffrida, A; Panebianco, A
2014-07-01
Anisakiasis is an important food-borne disease especially in countries with high fish consumption. The increase of cases of human disease and the virtual absence of effective treatments have prompted the research on new active compounds against Anisakis larvae. As well known, the disease is related to the consumption of raw or almost raw seafood products, but also marinated and/or salted fishery products, if the processing is insufficient to destroy nematode larvae can represent a risks for the consumers. In the light of the biocidal efficacy against different pathogens demonstrated for various essential oils, the aim of this work is to evaluate the effect of Thymus vulgaris essential oil (TEO) against anisakidae larvae. The TEO at 10% and 5% concentration in oil sunflower seeds, caused in vitro the death of all larvae within 14 h, with cuticle and intestinal wall damages. The results obtained showing a significant activity against Anisakis larvae, suggest further investigation on TEO as a larvicidal agent and on its potential use in the industrial marinating process. Copyright © 2014 Elsevier Inc. All rights reserved.
Antioxidative effect of thyme (Thymus vulgaris) in sunflower oil.
Zaborowska, Zofia; Przygoński, Krzysztof; Bilska, Agnieszka
2012-01-01
Lipid oxidation is a main problem during food processing, storage and consumption leading to losses of quality, stability, safety and nutritive value. Antioxidants have been used to prevent oxidation changes and off - flavor development in food products. Aim of the research was to evaluate antioxidative effect of thyme ethanol extract on sunflower oil during its storage in different temperature conditions. Oil samples were stored in darkness at 4°C, 18°C, 38°C. Samples of thyme (thymus vulgaris) were purchased at a local pharmacy in Poznań, Poland and sunflower oil was acquired from a local supermarket. Thyme extract was characterized by total polyphenol content. Antioxidant activity was estimated with use of DPPH and ABTS radicals scavenging methods. Ethanol extract of thyme at 1% level was added to sunflower oil. Peroxide value (PV), anisidine value (AV), totox value (TxV) and fatty acids (FA) content were taken as parameters for evaluation of effectiveness of thyme extract in stabilization of sunflower oil. High polyphenol content, DPPH and ABTS radicals scavenging activity of ethanol thyme extract were evaluated. Results from different parameters were in agreement with other researchers, suggesting the antioxidant effect of thyme on antioxidant stability. Results show that thyme extract prolonged stability of sunflower oil and it may be a potent antioxidant for its stabilization. Ethanol thyme extract may be used as a natural antioxidant to prolong stability of oils.
Evaluation of solar dried thyme (Thymus vulgaris Linne) herbs
Energy Technology Data Exchange (ETDEWEB)
Balladin, Derrick A.; Headley, Oliver [University of the West Indies, Center for Resource Management and Environmental Studies, St Michael (Barbados)
1999-07-01
Thyme (Thymus vulgaris Linne) herbs can be dried at about 50degC reached an equilibrium moisture content after 12 h and 9.5 h using the wire basket solar dryer and oven drying method respectively. The initial moisture content (wet wt. basis), (final moisture content, dry wt. basis (dwb)) determined by the Dean-Stark toluene method, oven and microwave were 75.15% (10.0%), 75.12% (11.85%) and 72.31% (12.50%) respectively. Paired t-test ({alpha} = 0.05, 10 degrees of freedom) showed no significant difference between the Dean-Stark toluene and the oven methods, but a significant difference between these two methods and the microwaves method. The % essential oils extracted after drying by the oven and the wire basket solar methods were 0.5 and 0.6% (per 100 g dwb) respectively. The % oleoresin and ash content were 27% for both drying methods and 1.60, 2.03 and 2.25% for the fresh, oven dried and the wire basket solar dried herb respectively. (Author)
Atividade antimicrobiana de Struthanthus vulgaris (erva-de-passarinho
Directory of Open Access Journals (Sweden)
O.M.C. Vieira
Full Text Available As plantas do gênero Struthanthus são conhecidas como ervas-de-passarinho e parasitam pomares no Brasil, principalmente os de laranjeiras e goiabeiras. Na medicina popular são usadas nas afecções das vias respiratórias. O extrato hidroetanólico a 70% de folhas frescas de Struthanthus vulgaris apresentou atividade antimicrobiana contra amostras bacterianas Gram positiva e Gram negativa. Este extrato não apresentou, nas condições testadas, atividade contra fungos. As amostras bacterianas mais sensíveis ao extrato foram Bacillus cereus (ATCC 11778, Micrococcus luteus (ATCC 9341, Staphylococcus aureus (ATCC 6538, S. epidermidis (ATCC 12228 e P. aeruginosa (ATCC 27853, usando o método de difusão em agar. As frações obtidas, pela partição líquido-líquido do extrato hidroetanólico a 70%, com solventes de polaridades crescentes (clorofórmio, acetato de etila, n-butanol e água, apresentaram diferentes atividades inibitórias. A fração que apresentou a maior atividade contra bactéria Gram positiva (B. cereus e Gram negativa (P. aeruginosa foi aquela obtida com n-butanol. Nessa fração foram detectados flavonóides, taninos condensados (proantocianidinas e saponinas.
Isolation and identification of mosquito repellents inArtemisia vulgaris.
Hwang, Y S; Wu, K H; Kumamoto, J; Axelrod, H; Mulla, M S
1985-09-01
The mugwortArtemisia vulgaris L. (Compositae: Anthemideae) contains insect repellents which can be released from the plant tissues by combustion. Work was carried out to isolate and identify the repellent compounds. The dried, pulverized whole plants were steam-distilled to give a repellent essential oil which was fractionated by column chromatography. Active fractions were analyzed by capillary GC and by combined GC-MS. A number of compounds, mainly monoterpenoids, were identified. When tested as repellents against the yellow fever mosquitoAedes aegypti L. (Diptera: Culicidae), (±)-linalool, (±)-camphor, (+)-camphor, (-)-camphor, isoborneol, (-)-borneol, terpinen-4-ol, and isobornyl acetate were active at 0.14 mg/cm2 or higher. Nonanone-3, (α+β)-thujone, and bornyl acetate were active at 0.28 mg/cm(2) or higher. β-Pinene, myrcene, α-terpinene, (+)- limonene, and cineole were active at 1.4 mg/cm(2). Of the repellent compounds identified, terpinen-4-ol was the most active and was as effective as dimethyl phthalate.
The Effect of Radiation on Phaseolus vulgaris and Aerogel
Durham, Stephanie; Boylan, Derek
2013-10-01
Radiation affects human life in disparately subtle and dramatic ways. For instance, nuclear reactions in the Sun produce light and heat that are essential for human existence, while recent research implies that the flux of cosmic ray particles may also have an impact on humans' daily lives. According to the EPA the average American receives 310 mrems of radiation per year, well under a total dose of 50,000 mrems and higher doses that cause symptoms ranging from nausea to death. However, scientists hypothesize that exposure to low doses of ionizing radiation (Phaseolus vulgaris was tested. The same radiation was also tested on the performance of aerogel, a material used in particle detectors. Aerogel will be used in experiments at the 12 GeV Jefferson Laboratory and has been previously observed to change its optical characteristics after being used in experiments. To determine the level of cosmic ray flux and possible contribution to our experiments a detector was created using scintillator material and 2-inch phototubes. Results from our experiments will be presented. Supported in part by NSF grant 1019521 and 1039446.
The Effect of Radiation on Phaseolus vulgaris growth and Aerogel
Boylan, Derek; Durham, Stephanie
2013-10-01
Radiation affects human life in disparately subtle and dramatic ways. For instance, nuclear reactions in the Sun produce light and heat that are essential for human existence, while recent research implies that the flux of cosmic ray particles may also have an impact on humans' daily lives. According to the EPA the average American receives 310 mrems of radiation per year, well under a total dose of 50,000 mrems and higher doses that cause symptoms ranging from nausea to death. However, scientists hypothesize that exposure to low doses of ionizing radiation (Phaseolus vulgaris was tested. The same radiation was also tested on the performance of aerogel, a material used in particle detectors. Aerogel will be used in experiments at the 12 GeV Jefferson Laboratory and has been previously observed to change its optical characteristics after being used in experiments. To determine the level of cosmic ray flux and possible contribution to our experiments a detector was created using scintillator material and 2-inch phototubes. Results from our experiments will be presented. Supported in part by NSF grant 1019521 and 1039446.
Redox Enzymes of Red Beetroot Vacuoles (Beta vulgaris L.
Directory of Open Access Journals (Sweden)
E.V. Pradedova
2014-12-01
Full Text Available Years of research have shown that some of the redox elements (enzymes, coenzymes, and co-substrate are isolated from each other kinetic and spatial manner (compartmentalization in the eukaryotic cells. The redox elements forming the "highly" and "widely" specialized redox system are found in all cell structures: mitochondria, plastids, peroxisomes, apoplast, nucleus etc. In recent years the active involvement of the central vacuole in the maintenance of the plant cell redox homeostasis is discussed, actually the information about the vacuolar redox system is very small. The high-priority redox processes and "redox-specialization" of the vacuolar compartment are not known. We have begun a study of red beet-root vacuole redox systems (Beta vulgaris L. and have identified redox enzymes such as: phenol peroxidase (EC 1.11.1.7, superoxide dismutase (EC 1.15.1.1 and glutathione reductase (EC 1.8.1.7. This paper presents some of the characteristics of these enzymes and considers the probable ways of their functioning in vacuolar redox chains.
Molecular Characterization of a Catalase from Hydra vulgaris
Dash, Bhagirathi; Phillips, Timothy D.
2012-01-01
Catalase, an antioxidant and hydroperoxidase enzyme protects the cellular environment from harmful effects of hydrogen peroxide by facilitating its degradation to oxygen and water. Molecular information on a cnidarian catalase and/or peroxidase is, however, limited. In this work an apparent full length cDNA sequence coding for a catalase (HvCatalase) was isolated from Hydra vulgaris using 3’- and 5’- (RLM) RACE approaches. The 1859 bp HvCatalase cDNA included an open reading frame of 1518 bp encoding a putative protein of 505 amino acids with a predicted molecular mass of 57.44 kDa. The deduced amino acid sequence of HvCatalase contained several highly conserved motifs including the heme-ligand signature sequence RLFSYGDTH and the active site signature FXRERIPERVVHAKGXGA. A comparative analysis showed the presence of conserved catalytic amino acids [His(71), Asn(145), and Tyr(354)] in HvCatalase as well. Homology modeling indicated the presence of the conserved features of mammalian catalase fold. Hydrae exposed to thermal, starvation, metal and oxidative stress responded by regulating its catalase mRNA transcription. These results indicated that the HvCatalase gene is involved in the cellular stress response and (anti)oxidative processes triggered by stressor and contaminant exposure. PMID:22521743
Chlorella vulgaris triggers apoptosis in hepatocarcinogenesis-induced rats*
Mohd Azamai, Emey Suhana; Sulaiman, Suhaniza; Mohd Habib, Shafina Hanim; Looi, Mee Lee; Das, Srijit; Abdul Hamid, Nor Aini; Wan Ngah, Wan Zurinah; Mohd Yusof, Yasmin Anum
2009-01-01
Chlorella vulgaris (CV) has been reported to have antioxidant and anticancer properties. We evaluated the effect of CV on apoptotic regulator protein expression in liver cancer-induced rats. Male Wistar rats (200~250 g) were divided into eight groups: control group (normal diet), CDE group (choline deficient diet supplemented with ethionine in drinking water to induce hepatocarcinogenesis), CV groups with three different doses of CV (50, 150, and 300 mg/kg body weight), and CDE groups treated with different doses of CV (50, 150, and 300 mg/kg body weight). Rats were sacrificed at various weeks and liver tissues were embedded in paraffin blocks for immunohistochemistry studies. CV, at increasing doses, decreased the expression of anti-apoptotic protein, Bcl-2, but increased the expression of pro-apoptotic protein, caspase 8, in CDE rats, which was correlated with decreased hepatoctyes proliferation and increased apoptosis as determined by bromodeoxy-uridine (BrdU) labeling and terminal deoxynucleotidyl transferase mediated dUTP nick-end labeling (TUNEL) assay, respectively. Our study shows that CV has definite chemopreventive effect by inducing apoptosis via decreasing the expression of Bcl-2 and increasing the expression of caspase 8 in hepatocarcinogenesis-induced rats. PMID:19198018
Use of diluted urine for cultivation of Chlorella vulgaris.
Jaatinen, Sanna; Lakaniemi, Aino-Maija; Rintala, Jukka
2016-01-01
Our aim was to study the biomass growth of microalga Chlorella vulgaris using diluted human urine as a sole nutrient source. Batch cultivations (21 days) were conducted in five different urine dilutions (1:25-1:300), in 1:100-diluted urine as such and with added trace elements, and as a reference, in artificial growth medium. The highest biomass density was obtained in 1:100-diluted urine with and without additional trace elements (0.73 and 0.60 g L(-1), respectively). Similar biomass growth trends and densities were obtained with 1:25- and 1:300-diluted urine (0.52 vs. 0.48 gVSS L(-1)) indicating that urine at dilution 1:25 can be used to cultivate microalgal based biomass. Interestingly, even 1:300-diluted urine contained sufficiently nutrients and trace elements to support biomass growth. Biomass production was similar despite pH-variation from < 5 to 9 in different incubations indicating robustness of the biomass growth. Ammonium formation did not inhibit overall biomass growth. At the beginning of cultivation, the majority of the biomass consisted of living algal cells, while towards the end, their share decreased and the estimated share of bacteria and cell debris increased.
Physiological and biochemical responses of Chlorella vulgaris to Congo red.
Hernández-Zamora, Miriam; Perales-Vela, Hugo Virgilio; Flores-Ortíz, César Mateo; Cañizares-Villanueva, Rosa Olivia
2014-10-01
Extensive use of synthetic dyes in many industrial applications releases large volumes of wastewater. Wastewaters from dying industries are considered hazardous and require careful treatment prior to discharge into receiving water bodies. Dyes can affect photosynthetic activities of aquatic flora and decrease dissolved oxygen in water. The aim of this study was to evaluate the effect of Congo red on growth and metabolic activity of Chlorella vulgaris after 96h exposure. Exposure of the microalga to Congo red reduced growth rate, photosynthesis and respiration. Analysis of chlorophyll a fluorescence emission showed that the donor side of photosystem II was affected at high concentrations of Congo red. The quantum yield for electron transport (φEo), the electron transport rate (ETR) and the performance index (PI) also decreased. The reduction in the ability to absorb and use the quantum energy increased non-photochemical (NPQ) mechanisms for thermal dissipation. Overall, Congo red affects growth and metabolic activity in photosynthetic organisms in aquatic environments. Copyright © 2014 Elsevier Inc. All rights reserved.
A Rare Case of Cranial Osteomyelitis Caused by Proteus Vulgaris
Directory of Open Access Journals (Sweden)
Hakan Uslu
2011-03-01
Full Text Available Osteomyelitis of the calvarial bones can cause serious complications such as brain abscess, due to the close proximity to adjacent brain structures. Development of the purulent secretion in surgery and traumatic scalp injuries must be considered as a possibility of osteomyelitis possibility. Generally gram positive, rarely gram negative bacteria and mix agents, can be isolated in infection. Especially chronic pyogenic osteomyelitis agents can be isolated from chronic infections such as tuberculosis. In cranial osteomyelitis diagnosis, radiological diagnosis has a very important place together with the clinical diagnosis. However, infection can usually show late findings radiologically. In treatment, antibiotic treatment is absolutely essential as well as removal of the infected part of the bone. Due to antibiotic treatment lasting between 6-12 weeks, organizing the antibiotic protocols according to the results of culture-antibiograms, which were provided from purulent secretions, has the most important role in the success of surgical treatment. In Proteus sp. infections, for choice of suitable treatment, determination of the type of bacteria is important. For exact diagnosis, histopathological examination of the bone tissue must be carried out. In this report, a case with cranial osteomyelitis caused by Proteus vulgaris which is a gram negative bacteria causing anaerobic infections and classified in the Enterobacteriaceae family is presented. The patient was treated with surgery and appropriate antibiotics. Early recognition of this condition, planning the best treatment strategy and taking precautions to prevent complications, is mandatory for a better outcome.
Efficient in vitro micropropagation and regeneration of Artemisia vulgaris L.
Directory of Open Access Journals (Sweden)
Sujatha Govindaraj
2007-01-01
Full Text Available This paper describes efficient propagation of Artemisia vulgaris using shoot tip explants isolated from 35 daysold in vitro grown seedlings. Optimum proliferation was obtained on Murashige and Skoogs salts and B5 vitamins supplementedwith 3% sucrose, 4.44 μM BA, and 0.7% agar. Shoot proliferation was maximal (99.8% with 14-23 shoots per explant after6 weeks of culture. Shoots with a minimum length of 1.5 cm were transferred to shoot elongation medium supplemented with0.44 μM BA and 1.44 μM GA3. The successfully elongated shoots with a height of 7.2-12.1 cm were transferred to rootingmedium augmented with 8.56 μM IAA. Rooted plantlets were transferred to plastic cups containing autoclaved garden soil,farmyard soil and sand (2:1:1 for hardening. Plantlets were initially maintained under culture room conditions (5 weeks,followed by normal laboratory conditions (4 weeks and finally transferred to a Botanical Evaluation Garden and maintainedthere.
Landscape genetics, adaptive diversity and population structure in Phaseolus vulgaris.
Rodriguez, Monica; Rau, Domenico; Bitocchi, Elena; Bellucci, Elisa; Biagetti, Eleonora; Carboni, Andrea; Gepts, Paul; Nanni, Laura; Papa, Roberto; Attene, Giovanna
2016-03-01
Here we studied the organization of genetic variation of the common bean (Phaseolus vulgaris) in its centres of domestication. We used 131 single nucleotide polymorphisms to investigate 417 wild common bean accessions and a representative sample of 160 domesticated genotypes, including Mesoamerican and Andean genotypes, for a total of 577 accessions. By analysing the genetic spatial patterns of the wild common bean, we documented the existence of several genetic groups and the occurrence of variable degrees of diversity in Mesoamerica and the Andes. Moreover, using a landscape genetics approach, we demonstrated that both demographic processes and selection for adaptation were responsible for the observed genetic structure. We showed that the study of correlations between markers and ecological variables at a continental scale can help in identifying local adaptation genes. We also located putative areas of common bean domestication in Mesoamerica, in the Oaxaca Valley, and the Andes, in southern Bolivia-northern Argentina. These observations are of paramount importance for the conservation and exploitation of the genetic diversity preserved within this species and other plant genetic resources. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.
Fungi associated with Phaseolus vulgaris L. seeds cultivated in Cuba
Directory of Open Access Journals (Sweden)
Einar Martínez de la Parte
2014-04-01
Full Text Available Common bean (Phaseolus vulgaris L., is the most important legume specie for Cuba, 123 434 ha were harvested for a production of 127 100 t during 2012. Most of phytopathogenic fungi associated to beans used seeds to move their inoculum to new areas, which under favorable condition can cause considerable yield losses. The objective of the present study was to identify fungi associated with bean seeds, their frequency and incidence for bean variety. 102 seed bean lots of 16 varieties for Pinar del Río, Mayabeque and Artemisa provinces were studied. For each seed lot 400 seed were analyzed by blotter test. 679 fungal isolates belonging to 34 species of 20 genera were detected. Penicillium sp. (78.4%, Rhizoctonia solani (77.5%, Aspergillus niger (68.6% and Fusarium solani (51.0% were the predominant species. Nine Fusarium species and six Aspergillus species were identified. Sclerotinia sclerotiorum was detected in BAT-58, BAT-93 and Delicia-365 varieties, on which higher infected seed percent was detected in BAT-93. This paper is the first report of S. sclerotiorum incidence on Cuban seed bean. Key words: Aspergillus, Fusarium, mycobiota, Phaseolus, Sclerotinia
Serological diagnosis of Strongylus vulgaris infection: use of a recombinant protein
DEFF Research Database (Denmark)
Andersen, Ulla Vestergaard; Howe, Daniel K.; Olsen, Susanne Nautrup
the pathogenic migrating larval stages of S. vulgaris ante mortem. A cDNA library was constructed from RNA extracted from migrating S. vulgaris larvae. Excretory-secretory antigens from S. vulgaris adult specimens were used to immunise a rat. Hyperimmune serum was used to immunoscreen the cDNA library......, an immunoreactive cDNA clone was subcloned into E. coli and the plasmid sequenced, the open reading frame encoding the mature protein was cloned into a pET22b expression vector and expressed as a His-tagged recombinant protein in BL21 expression cells. The recombinant protein was used in an indirect enzyme...... infection in suspected clinical cases, measuring herd level exposure, and as a potentially useful research tool for investigating possible risk factors associated with development of disease....
Antispasmodic effect of hydroalcoholic extract of Thymus vulgaris on the guinea-pig ileum.
Babaei, Mehdi; Abarghoei, Mitra Emmami; Ansari, Reza; Vafaei, Abbas Ali; Taherian, Abbas Ali; Akhavan, Maziar Mohammad; Toussy, Gafar; Mousavi, Shahrokh
2008-01-01
The effects of Thymus vulgaris hydroalcoholic extract on the contractile responses of the isolated guinea-pig ileum were investigated. Contraction changes in the terminal ileum of guinea pigs were monitored using a force displacement transducer amplifier connected to a physiograph. Thymus vulgaris extract inhibited the contractile responses in a dose-dependent manner and also decreased the amplitude of peristaltic waves. It is concluded that T. vulgaris has an antispasmodic action on guinea pig ileum by decreasing the amplitudes of the muscle contractions during peristalsis. The EC50 was calculated as 1.7 mg mL(-1). In guinea-pig ileum the extract led to an antispasmodic effect, possibly by affecting the anticholinergic and serotoninergic pathways.
Centeno, S; Calvo, M A; Adelantado, C; Figueroa, S
2010-05-01
The antifungal activity of ethanolic extracts of Rosmarinus officinalis and Thymus vulgaris were tested against strains of Aspergillus flavus and A. ochraceus, since these two species are common contaminants of cereals and grains and are able to produce and accumulate mycotoxins. The methodology used is based on measuring the inhibition halos produced by discs impregnated with the extracts and establishing their Minimum Inhibitory Concentration (MIC) as well as the Minimum Fungicide Concentration (MFC). The results obtained suggest that the assayed extracts affect the proper development of A. flavus and A. ochraceus; leading to a lower MIC (1200 ppm) and MFC (2400 ppm) for T. vulgaris extract against A. ochraceus than against A. flavus. The results show, that the extracts of Rosmarinus officinalis and Thymus vulgaris used at low concentrations could have significant potential for the biological control of fungi in foodstuffs.
Badari Nath, A. R. S.; Sivaramakrishna, A.; Marimuthu, K. M.; Saraswathy, Radha
2015-01-01
Phytohaemagglutinin (PHA) is a lectin obtained from Phaseolus vulgaris (red kidney beans), that acts as a mitogen in human leucocyte culture and is commercially available from Gibco®. This PHA (Gibco®) was found to be very expensive, hence other inexpensive sources that can be used in all kinds of cytogenetics labs (rich and poor), were attempted. One such successful attempt was PHA extract from seeds of P.vulgaris. This paper details the methodology of extraction and application of PHA from seeds of P.vulgaris. Attempts has been made to identify the chemical and physical properties of the products in the extract, analyzed by various spectroscopic and analytical techniques. The analysis clearly indicates that the product from Phaseolus seeds extract was found to be similar to the commercially available PHA (Gibco®) in the cytogenetic study of human leucocyte cultures. The present study enforces the possible utility of the plant extract directly for human leucocyte cultures.
Topical, Biological and Clinical Challenges in the Management of Patients with Acne Vulgaris
Directory of Open Access Journals (Sweden)
Anwar Al-Hammadi
2016-05-01
Full Text Available Acne vulgaris is one of the most common chronic inflammatory skin disorders among adolescents and young adults. It is associated with substantial morbidity and, rarely, with mortality. The exact worldwide incidence and prevalence are currently unknown. Current challenges involve improving understanding of the underlying pathophysiology of acne vulgaris and developing a practical treatment consensus. Expert panel discussions were held in 2013 and 2014 among a group of scientists and clinicians from the Omani and United Arab Emirate Dermatology Societies to ascertain the current optimal management of acne vulgaris, identify clinically relevant end-points and construct suitable methodology for future clinical trial designs. This article reviews the discussions of these sessions and recent literature on this topic.
Removal Cu(II ions from water using sulphuric acid treated Lagenaria vulgaris Shell (Cucurbitaceae
Directory of Open Access Journals (Sweden)
Ljupković, R.B.
2011-09-01
Full Text Available Removal of Cu(II ions from water solutions by sulphuric acid treated Lagenaria vulgaris shell (ccLVB was studied. Batch experiments were done by shaking a fixed mass of biosorbent (1.0 g with 250 cm3 of 50.0 mg dm–3 Cu(II solutions, at pH ranged from 2 up to 6. Metal concentration in the filtrates as well as in the initial solution was determined by flame atomic absorption spectrometry. Results show that efficiency of Cu(II ions uptake by sulphuric acid treated Lagenaria vulgaris shell is significantly greater than raw Lagenaria vulgaris biosorbent. In addition, there is no significant effect of initial pH of solution on Cu(II ions uptake by ccLVB and obtained biosorbent can be applied in a wide range of pH.
Visually augmented targeted combination light therapy for acne vulgaris: a case report.
Yazdi, Alireza; Lyons, Colin-William; Roberts, Niamh
2017-10-31
Acne vulgaris is a common skin disease. Pharmacological modalities for treatment are proven to be efficacious but have limitations. Light therapy for acne vulgaris has shown promise in previous studies. This case report and its accompanying images show how a novel approach of visually augmented high fluence light therapy has been used to good effect. A 26-year-old Caucasian woman with acne vulgaris resistant to treatment with topical therapy underwent three sessions of combination potassium titanyl phosphate laser (532 nm)/neodymium-doped: yttrium aluminum garnet laser (1064 nm) light therapy with visually augmented narrow spot size and high fluence. A 73% reduction in total inflammatory lesions was evident 6 months after the initial treatment. This case report illustrates that there may be utility in this novel approach of narrow spot size, magnification-assisted, high fluence targeted combination laser therapy for inflammatory acne.
Anti-inflammatory activity of the leaf extacts of Gendarussa vulgaris Nees.
Saleem, T K Mohamed; Azeem, A K; Dilip, C; Sankar, C; Prasanth, N V; Duraisami, R
2011-04-01
To evaluate the anti-inflammatory property of the leaf exacts of Gendarussa vulgaris (G. vulgaris) Nees. G. vulgaris Nees of the family Apocynaceae is a medium sized tree grown in semishade or no shade and is common in the Ernad and Nilambur taluks of Kerala.Various parts of this plant have been used in the treatment of ulcers, sores, inflammation, dyspepsia, healing of wounds, etc. The present study aimed at the evaluation of anti-inflammatory property of the aqueous and alcoholic extracts of the leaves by both in vitro and in vivo methods. In vitro method was estimated by human red blood cell membrane stabilisation (HRBC) method and in vivo method was estimated on the carrageenan induced paw oedima. Both the methods showed significant anti-inflammatory property of the different extracts tested. The alcoholic extract at a concentration of 300 mg/mL showed potent activity on comparing with the standard drug diclofenac sodium.
Improvement of acne vulgaris by topical fullerene application: unique impact on skin care.
Inui, Shigeki; Aoshima, Hisae; Nishiyama, Aki; Itami, Satoshi
2011-04-01
Oxidative stress plays a major role in acne formation, suggesting that oxygen radical scavengers are potential therapeutic agents. Fullerene is a spherical carbon molecule with strong radical sponge activity; therefore, we studied the effectiveness of fullerene gel in treating acne vulgaris. We performed an open trial using a fullerene gel twice a day; at 4 and 8 weeks, the mean number of inflammatory lesions (erythematous papules and pustules) significantly (P fullerene inhibits sebum production, suggesting that fullerene suppresses acne through decreasing neutrophil infiltration and sebum production. After treatment for 8 weeks, the water content of the skin significantly (P fullerene gel may help in controlling acne vulgaris with skin care benefit. Fullerenes, spherical carbon cages with strong oxygen radical scavenging, with formulated into a gel and used to successfully treat acne vulgaris, an inflammatory disease associated oxidative stress. Copyright © 2011 Elsevier Inc. All rights reserved.
Caleosin from Chlorella vulgaris TISTR 8580 is salt-induced and heme-containing protein.
Charuchinda, Pairpilin; Waditee-Sirisattha, Rungaroon; Kageyama, Hakuto; Yamada, Daisuke; Sirisattha, Sophon; Tanaka, Yoshito; Mahakhant, Aparat; Takabe, Teruhiro
2015-01-01
Physiological and functional properties of lipid droplet-associated proteins in algae remain scarce. We report here the caleosin gene from Chlorella vulgaris encodes a protein of 279 amino acid residues. Amino acid sequence alignment showed high similarity to the putative caleosins from fungi, but less to plant caleosins. When the C. vulgaris TISTR 8580 cells were treated with salt stress (0.3 M NaCl), the level of triacylglycerol increased significantly. The mRNA contents for caleosin in Chlorella cells significantly increased under salt stress condition. Caleosin gene was expressed in E. coli. Crude extract of E. coli cells exhibited the cumene hydroperoxide-dependent oxidation of aniline. Absorption spectroscopy showed a peak around 415 nm which was decreased upon addition of cumene hydroperoxide. Native polyacrylamide gel electrophoresis suggests caleosin existed as the oligomer. These data indicate that a fresh water C. vulgaris TISTR 8580 contains a salt-induced heme-protein caleosin.
Luque, Luis; Orr, Valerie C A; Chen, Sean; Westerhof, Roel; Oudenhoven, Stijn; Rossum, Guus van; Kersten, Sascha; Berruti, Franco; Rehmann, Lars
2016-08-01
This study evaluated the suitability of pinewood pyrolysates as a carbon source for lipid production and cultivation of the oleaginous yeast Rhodosporidium diobovatum and the microalgae Chlorella vulgaris. Thermal decomposition of pinewood and fractional condensation were used to obtain an oil rich in levoglucosan which was upgraded to glucose by acid hydrolysis. Blending of pyrolytic sugars with pure glucose in both nitrogen rich and nitrogen limited conditions was studied for R. diobovatum, and under nitrogen limited conditions for C. vulgaris. Glucose consumption rate decreased with increasing proportions of pyrolytic sugars increasing cultivation time. While R. diobovatum was capable of growth in 100% (v/v) pyrolytic sugars, C. vulgaris growth declined rapidly in blends greater than 20% (v/v) until no growth was detected in blends >40%. Finally, the effects of pyrolysis sugars on lipid composition was evaluated and biodiesel fuel properties were estimated based on the lipid profiles. Copyright © 2016 Elsevier Ltd. All rights reserved.
Potential of the green alga Chlorella vulgaris for biodegradation of crude oil hydrocarbons.
Xaaldi Kalhor, Aadel; Movafeghi, Ali; Mohammadi-Nassab, Adel Dabbagh; Abedi, Ehsan; Bahrami, Ahmad
2017-10-15
Oil production and/or transportation can cause severe environmental pollution and disrupt the populations of living organisms. In the present study, biodegradation of petroleum hydrocarbons is investigated using Chlorella vulgaris as a green algal species. The microalga was treated by 10 and 20g/l crude oil/water concentrations at two experimental durations (7 and 14days). Based on the results obtained, C. vulgaris owned not only considerable resistance against the pollutants but also high ability in remediation of crude oil hydrocarbons (~94% of the light and ~88% of heavy compounds in 14days). Intriguingly, dry weight of C. vulgaris increased by the rising crude oil concentration indicating the positive effect of crude oil on the growth of the algal species. This biodegradation process is remarkably a continuous progression over a period of time. Copyright © 2017 Elsevier Ltd. All rights reserved.
Lupus vulgaris mimicking hemangioma diagnosed 42 years after onset: a case report.
Yaldız, Mahizer; Erdem, Teoman; Dikicier, Bahar Sevimli; Dilek, Fatma Hüsniye
2015-09-16
Lupus vulgaris is the most common form of cutaneous tuberculosis. It may easily be overlooked if a proper differential diagnosis is omitted. A 46-year-old Turkish woman presented with a 42-year history of erythamatous plaque on her left arm. Ziehl-Neelsen and periodic acid-Schiff stains did not show any acid-fast bacilli. Culture from a biopsy specimen was negative for Mycobacterium tuberculosis. The result of a polymerase chain reaction-based assay for Mycobacterium was negative. Histopathologic findings revealed a tuberculoid granuloma containing epithelioid cells, lymphocytes and Langerhans-type giant cells. A diagnosis of lupus vulgaris was made by clinical and histopathologic findings. The lesion improved after antituberculous therapy, confirming the diagnosis of lupus vulgaris.
Mimmo, Tanja; Sciortino, Marco; Ghizzi, Massimiliano; Gianquinto, Giorgio; Gessa, Carlo E
2009-01-01
Aluminium toxicity is one of the major limiting factors of crop productivity on acid soils. High levels of available aluminium in soil may induce phosphorus deficiency in plants. This study investigates the influence of Aluminium (Al) on the phosphate (P(i)) uptake of two Phaseolus species, Phaseolus vulgaris L. var. Red Kidney and Phaseolus lunatus L. The two bean species were treated first with solutions of Al at different concentrations (0, 25, 50 and 100microM, pH 4.50) and second with solutions of P(i) (150microM) at pH 4.50. The higher the Al concentration the higher the Al concentration sorbed but P. vulgaris L var. Red Kidney adsorbed significantly more Al than P. lunatus L. Both species released organic acids: P. vulgaris L var. Red Kidney released fumaric acid and P. lunatus L. fumaric and oxalic acids which could have hindered further Al uptake. The two bean species showed a sigmoid P(i) uptake trend but with two different mechanisms. P. vulgaris L var. Red Kidney showed a starting point of 3h whereas P. lunatus L. adsorbed P(i) immediately within the first minutes. In addition, P. vulgaris L var. Red Kidney presented significantly higher P(i) uptake (higher uptake rate 'k' and higher maximum adsorption 'a' of the kinetic uptake model). The Al treatments did not significantly influence P(i) uptake. Results suggest that P. lunatus L. might adopt an external Al detoxification mechanism by the release of oxalic acid. P. vulgaris L var. Red Kidney on the other hand seemed to adopt an internal detoxification mechanism even if the Al sorbed is poorly translocated into the shoots. More detailed studies will be necessary to better define Al tolerance and/or resistance of Phaseolus spp.
Evaluation of leptin, adiponectin, and ghrelin levels in patients with acne vulgaris.
Ozuguz, P; Kacar, S D; Asik, G; Ozuguz, U; Karatas, S
2016-02-09
The research evaluating adipokines are very few in patients with acne vulgaris. The hypothesis that hyperinsulinemic and high glycemic index diet plays a role in the pathogenesis of acne is still controversial. In this study, we aimed to evaluate adipokines such as leptin (L), adiponectin (A), ghrelin and A levels, and A/L rates that indicate insulin resistance in nonobese patients with severe acne vulgaris. Thirty patients who are nonobese with moderate acne vulgaris, aged 18 to 25 years, and 15 age-sex compatible controls were included in our study. The acne lesions were assessed using the Global Acne Grading Scale (GAGS). All participants were evaluated for the parameters that may affect the metabolism of serum L, A, and ghrelin levels in blood, and their body mass index were calculated. The significance level was determined as p ≤ 0.05. Of the 30 patients, 17 were women and 13 were men. The mean age was 20.60 years and the mean duration of the disease were 2.8 years. All of patients had moderate acne vulgaris (GAGS 19-30). Of the 15 controls, 11 were women and 4 were men. The mean age was 21.20 years. There were not a statistically significant difference in L, ghrelin, A levels, and A/L ratio between the two groups. Adipokines may have a role in the pathogenesis of acne vulgaris. L, A, ghrelin, and insulin resistance may not participate in the responsible mechanisms in nonobese patients with moderate acne vulgaris. © The Author(s) 2016.
[Depression in patients with facial acne vulgaris and the influential factors].
Kang, Liyang; Liu, Jiaoyan; An, Rujun; Huang, Jinhua; Huang, Hui; Yi, Qifeng
2015-10-01
To understand the influential factors for depression in patients with facial acne vulgaris and to provide scientific evidence for a comprehensive and systematic treatment for acne vulgaris. A total of 287 outpatients with facial acne vulgaris, who visited the dermatology of the Third Xiangya Hospital, were surveyed by Beck Depression Inventory (BDI). The data was collected by Epidata software (version 3.1) and processed by SPSS software package (version 18.0). The influential factors for the depression of outpatients with facial acne vulgaris were analyzed by multinomial logistic regression. A total of 181 patients with facial acne vulgaris showed various degrees of depression (BDI score≥5) and the rate was 63.1%. The symptoms for depression included sad and pessimistic attitude as well as the decreased attention to others (social withdrawal). The influential factors for mild, moderate or severe depression were gender, the degree and the course of acne. Female patients were more likely to suffer mild, moderate or severe depression (OR=3.62, 2.63, respectively); the risk of depression in acne patients was increased with the increase in degree of the severity (OR=2.31, 4.51, respectively); the patients with the acne course more than a year were more likely to show mild depression than those with a course less than a year (OR=4.30, 7.44, respectively). The patients with acne course more than 3 years were more likely to show moderate or severe depression compared to those with a course less than a year (OR=3.60). Most of facial acne patients show a different degree of depression. The acne course is longer in female patients. The more severe the acne vulgaris is, the more suffering of the depression is. Psychological care should be considered to improve the treatment and quality of life.
Effects of copper on reserve mobilization in embryo of Phaseolus vulgaris L.
Karmous, Inès; Bellani, Lorenza M; Chaoui, Abdelilah; El Ferjani, Ezzedine; Muccifora, Simonetta
2015-07-01
The present research reports a biochemical and micro-submicroscopic analysis of copper effect on reserve mobilization during germination of Phaseolus vulgaris L. var. soisson nain hatif seeds. Dry embryonic cells are rich in protein bodies and little starch grains. In Cu-treated embryos copper inhibited 50% of albumin and globulin mobilization after 72 h imbibition. The severe alterations in treated embryo cells, observed by electron microscope, were probably the cause of the inability to utilize the amino acids freed by protein mobilization and so possibly the cause of the inhibition of P. vulgaris embryonic axis elongation.
The genome sequence of Barbarea vulgaris facilitates the study of ecological biochemistry
DEFF Research Database (Denmark)
Byrne, Stephen L.; Erthmann, Pernille Østerbye; Agerbirk, Niels
2017-01-01
The genus Barbarea has emerged as a model for evolution and ecology of plant defense compounds, due to its unusual glucosinolate profile and production of saponins, unique to the Brassicaceae. One species, B. vulgaris, includes two ‘types’, G-type and P-type that differ in trichome density...... candidate genes underlying glucosinolate diversity, trichome density, and study the genetics of biochemical variation for glucosinolate and saponins. B. vulgaris is resistant to the diamondback moth, and may be exploited for “dead-end” trap cropping where glucosinolates stimulate oviposition and saponins...
Static and dynamic superheated water extraction of essential oil components from Thymus vulgaris L.
Dawidowicz, Andrzej L; Rado, Ewelina; Wianowska, Dorota
2009-09-01
Superheated water extraction (SWE) performed in both static and dynamic condition (S-SWE and D-SWE, respectively) was applied for the extraction of essential oil from Thymus vulgaris L. The influence of extraction pressure, temperature, time, and flow rate on the total yield of essential oil and the influence of extraction temperature on the extraction of some chosen components are discussed in the paper. The SWE extracts are related to PLE extracts with n-hexane and essential oil obtained by steam distillation. The superheated water extraction in dynamic condition seems to be a feasible option for the extraction of essential oil components from T. vulgaris L.
Thiago José de Souza Alves
2013-01-01
O controle biológico natural do bicudo-do-algodoeiro, no Brasil, é realizado principalmente por parasitoides. Entre eles, Bracon vulgaris Ashmead (Hymenoptera: Braconidae), um ectoparasitoide larval, constitui o principal agente biológico responsável pela redução natural das populações do bicudo no agroecossistema algodoeiro no Nordeste brasileiro. Embora possua importância na cotonicultura, são escassos os dados referentes à ação de parasitismo de B.vulgaris sobre Anthonomus grandis Boh. ...
da R. Costa, S. dos S.; de A. Santos, M. S. N.; Ryan, M F
2003-01-01
The activity of an ethanolic rhizome extract of Artemisia vulgaris against hatching, mortality, host plant infectivity, and galling of the root-knot nematode Meloidogyne megadora was investigated. The extract inhibited egg hatch (50% inhibition by 2.35mg/ml) and caused second-stage juvenile mortality (50% lethality at 12 hours' exposure to 55.67 mg/ml), both in a dose-dependent manner. Nematode infectivity on Phaseolus vulgaris 'Bencanta Trepar', a susceptible host, decreased in a dose-respon...
DEFF Research Database (Denmark)
Rodriguez Algaba, Julian; Walter, Stephanie; Sørensen, Chris Khadgi
An effort to develop an experimental genetic system for the stripe (yellow) rust fungus using Berberis vulgaris as an alternate host has been made by INRA Grignon (F) and GRRC (DK). The first attempts to achieve infection using European isolates and B. vulgaris plants from France were unsuccessful...... and to study genotypic diversity. The markers confirmed the parental origin and markers that were heterozygous in the parent generally segregated in the S1 progenies. A largest number of multilocus genotypes observed among the progeny isolates confirmed successful sexual recombination. Segregation...
Radiation-induced pemphigus vulgaris of the breast; Pemphigus vulgaire radio-induit du sein
Energy Technology Data Exchange (ETDEWEB)
Vigna-Taglianti, R.; Russi, E.G. [Department of radiotherapy, Santa Croce e Carle general hospital, Via M. Coppino, 12100 Cuneo (Italy); Denaro, N. [Oncology department, university of Messina, Via consolare Valeria no 1, 98100 Messina (Italy); Numico, G. [Department of medical oncology, U. Parini hospital, 11100 Aosta (Italy); Brizio, R. [Department of histopathology, Santa Croce e Carle general hospital, Via M. Coppino, 12100 Cuneo (Italy)
2011-07-15
Pemphigus vulgaris is a rare autoimmune muco-cutaneous bullous disease. Patients with a history of pemphigus vulgaris - who need radiotherapy - may show a long lasting bullous cutaneous manifestation, typical of pemphigus, within radiation fields. The literature describes fewer than 20 radio-induced cases. While systematic corticosteroid therapy has proven to be useful, topical treatment used in association with corticosteroid therapy is rarely described. To our knowledge the use of modern dressing products has never been described. We report our experience in a case in which modern dressing products were usefully associated to systemic therapy. (authors)
CO2 capture from air by Chlorella vulgaris microalgae in an airlift photobioreactor.
Sadeghizadeh, Aziz; Farhad Dad, Farid; Moghaddasi, Leila; Rahimi, Rahbar
2017-11-01
In this work, hydrodynamics and CO2 biofixation study was conducted in an airlift bioreactor at the temperature of 30±2°C. The main objective of this work was to investigate the effect of high gas superficial velocity on CO2 biofixation using Chlorella vulgaris microalgae and its growth. The study showed that Chlorella vulgaris in high input gas superficial velocity also had the ability to grow and remove the CO2 by less than 80% efficiency. Copyright © 2017 Elsevier Ltd. All rights reserved.
Current Pathophysiological Aspects and Therapeutic Modalities for Pemphigus Vulgaris : A Review
Directory of Open Access Journals (Sweden)
J Raviraj
2007-01-01
Full Text Available Pemphigus vulgaris (PV is an autoimmune disorder manifesting primarily as blisters involving the mucocutaneous systems. The current medical literature indicates many breakthroughs in the research of pathophysiology and treatment aspects of PV. This article tries to describe some of the novel aspects briefing the role of nondesmoglein antibodies and the role of TNF-alpha in the etiopathogenesis of pemphigus vulgaris and the role of newer therapeutic modalities like Rituximab, Etanercept, intravenous Immunoglobulins, cholinergic drugs, arid the like in the treatment of PV.
Directory of Open Access Journals (Sweden)
Jäger, Peter
2002-05-01
Full Text Available Specimens of T. vulgaris were recently introduced in Germany with cricket boxes from southern United States. The species has been sent within Germany with post packages to different pet dealers. These samples represent probably the first confirmed records of T. vulgaris for Germany. Further observation could show, whether the populations are stabile in synanthropic habitats, especially inside bulidings. Female genitalia are illustrated. One structure is recognized as a glandular part of the spermathecae. Terminology of female genitalia is given in comparison of terms used in the past by different authors.
MAO-A inhibitory activity of quercetin from Calluna vulgaris (L.) Hull
DEFF Research Database (Denmark)
Saaby, Lasse; Rasmussen, Hasse Bonde; Jäger, Anna Katharina
2009-01-01
AIM OF THE STUDY: This study investigated MAO-A inhibitory activity of methanol extract of Calluna vulgaris (L.) Hull., which traditionally has been used as a nerve calming remedy. MATERIALS AND METHODS: A methanolic extract of Calluna vulgaris was partitioned against heptane, ethyl acetate...... and water. The three fractions were tested in a photometric peroxidase linked MAO-A bioassay. The ethyl acetate phase showed the highest MAO-A inhibitory activity. Quercetin was isolated by VLC through bioassay-guided fractionation and purified by re-crystallisation. The structure was elucidated by LC...
Vin, Harina; Seyfer, Sarah J; McClain, Colt M; Hsu, Sylvia
2016-01-15
Pemphigus and pemphigoid are two unique acquired immunobullous diseases with distinct clinical presentations, histological findings, and characteristic serology; they are rarely reported to coexist in the same patient. Herein we present a 29-year-old woman with a history of pemphigus vulgaris, diagnosed by histology and positive desmoglein-3 antibodies on ELISA. She presented to our clinic shortly after the delivery of her first child with tense vesicles and bullae on an erythematous base on her abdomen. Biopsy was consistent with pemphigoid gestationis and direct immunofluorescence confirmed the diagnosis. To our knowledge, there are no other reported cases of pemphigoid gestationis occurring in a patient with pemphigus vulgaris.
Bindi Tuberculosis - Lupus Vulgaris Associated with Bindi Use: A Case Report.
Mishra, Gyanshankar; Rathi, Sushil; Mulani, Jasmin
2015-05-01
Cutaneous lesions are relatively uncommon manifestations of tuberculosis (TB). A 40-year-old female presented with skin lesion over the forehead since two months. She used to apply bindi over the same area since past 25 years. Based on skin biopsy and other ancillary investigations, she was diagnosed as a case of lupus vulgaris and initiated on anti TB medications following which, the lesion regressed. Thus, we herein report the first case of cutaneous tuberculosis (lupus vulgaris) associated with long term use of bindi.
I Know My Neighbour: Individual Recognition in Octopus vulgaris
Tricarico, Elena; Borrelli, Luciana; Gherardi, Francesca; Fiorito, Graziano
2011-01-01
Background Little is known about individual recognition (IR) in octopuses, although they have been abundantly studied for their sophisticated behaviour and learning capacities. Indeed, the ability of octopuses to recognise conspecifics is suggested by a number of clues emerging from both laboratory studies (where they appear to form and maintain dominance hierarchies) and field observations (octopuses of neighbouring dens display little agonism between each other). To fill this gap in knowledge, we investigated the behaviour of 24 size-matched pairs of Octopus vulgaris in laboratory conditions. Methodology/Principal Findings The experimental design was composed of 3 phases: Phase 1 (acclimatization): 12 “sight-allowed” (and 12 “isolated”) pairs were maintained for 3 days in contiguous tanks separated by a transparent (and opaque) partition to allow (and block) the vision of the conspecific; Phase 2 (cohabitation): members of each pair (both sight-allowed and isolated) were transferred into an experimental tank and were allowed to interact for 15 min every day for 3 consecutive days; Phase 3 (test): each pair (both sight-allowed and isolated) was subject to a switch of an octopus to form pairs composed of either familiar (“sham switches”) or unfamiliar conspecifics (“real switches”). Longer latencies (i.e. the time elapsed from the first interaction) and fewer physical contacts in the familiar pairs as opposed to the unfamiliar pairs were used as proxies for recognition. Conclusions Octopuses appear able to recognise conspecifics and to remember the individual previously met for at least one day. To the best of our knowledge, this is the first experimental study showing the occurrence of a form of IR in cephalopods. Future studies should clarify whether this is a “true” IR. PMID:21533257
Management of acne vulgaris: an evidence-based update.
Ingram, J R; Grindlay, D J C; Williams, H C
2010-06-01
This review summarizes clinically important findings from 3 systematic reviews, 1 updated guideline and a selection from the 62 randomized controlled trials (RCTs) published between February 2007 and January 2009 on the topic of acne vulgaris. Low glycaemic-load diets might reduce acne severity but this remains unproven. Written patient information leaflets have not been surpassed by other communication methods. New combination topical treatments have not shown convincing advantages over current combination products such as clindamycin/benzoyl peroxide. Topical dapsone is superior to placebo but has yet to be compared with standard topical treatments. Long-term topical tretinoin to prevent nonmelanoma skin cancer in elderly men was associated with higher all-cause mortality, but there is currently no evidence of increased mortality for topical retinoid use when treating acne. All oral tetracyclines have similar efficacy, yet minocycline is the most costly. Oral isotretinoin monotherapy remains the gold-standard treatment for severe acne. Flutamide plus the oral contraceptive pill is beneficial for acne associated with polycystic ovary syndrome. Photodynamic therapy, phototherapy and laser therapy cannot be recommended universally for acne until minimal postinflammatory pigmentation and longer-term benefit can be shown, especially with current high costs. Development of non-antibiotic therapies is preferable to minimize the risk of community antibiotic resistance. Future trials should use active comparators at optimum doses and avoid noninferiority comparisons unless appropriately powered. Trials need to shift from using multiple, unvalidated outcome measures to including patient-reported and quality-of-life outcomes, and all trials should be registered on a public clinical-trials database.
Autoantibodies other than anti-desmogleins in pemphigus vulgaris patients
Directory of Open Access Journals (Sweden)
Marwah Adly Saleh
2017-01-01
Full Text Available Background: Pemphigus vulgaris (PV is an immunoglobulin G-mediated autoimmune bullous skin disease. Nonorgan-specific antibodies were detected in Tunisian and Brazilian pemphigus patients with different prevalence. Materials and Methods: Fifty PV patients and fifty controls were screened for antinuclear antibodies (ANAs, anti-smooth muscle antibodies (ASMAs, anti-parietal antibodies (APAs, anti-mitochondrial antibodies, and Anti-nuclear cytoplasmic antibodies (ANCA by indirect immunofluorescence. Results: Thirty-nine patients were female and 11 were male. Fifteen patients did not receive treatment before while 35 patients were on systemic steroid treatment ± azathioprine. Twenty (40% of the PV patients and 1 (2% control had positive ANA. ANA was significantly higher in PV patients than controls, P< 0.0001. ASMAs were detected in 20 (40% PV patients and none of the controls. ASMA was significantly higher in PV patients than controls, P< 0.0001. No significant difference was detected between treated and untreated regarding ANA, P - 0.11. However, there was a significant difference between treated and untreated regarding ASMA, P- 0.03. Six patients (12% and none of the controls had positive APA. There was a significant difference between the patients and the controls in APA. P- 0.027. Conclusion: Egyptian PV patients showed more prevalent ANA, ASMA, and APA than normal controls. Follow-up of those patients is essential to detect the early development of concomitant autoimmune disease. Environmental factors might account for the variability of the nonorgan-specific antibodies among different populations.
Dissecting Phaseolus vulgaris Innate Immune System against Colletotrichum lindemuthianum Infection
Chowdhury, Bablu; Caldas, Danielle Gregório Gomes; Tsai, Siu Mui; Camargo, Luis Eduardo Aranha; Melotto, Maeli
2012-01-01
Background The genus Colletotrichum is one of the most economically important plant pathogens, causing anthracnose on a wide range of crops including common beans (Phaseolus vulgaris L.). Crop yield can be dramatically decreased depending on the plant cultivar used and the environmental conditions. This study aimed to identify potential genetic components of the bean immune system to provide environmentally friendly control measures against this fungus. Methodology and Principal Findings As the common bean is not amenable to reverse genetics to explore functionality and its genome is not fully curated, we used putative Arabidopsis orthologs of bean expressed sequence tag (EST) to perform bioinformatic analysis and experimental validation of gene expression to identify common bean genes regulated during the incompatible interaction with C. lindemuthianum. Similar to model pathosystems, Gene Ontology (GO) analysis indicated that hormone biosynthesis and signaling in common beans seem to be modulated by fungus infection. For instance, cytokinin and ethylene responses were up-regulated and jasmonic acid, gibberellin, and abscisic acid responses were down-regulated, indicating that these hormones may play a central role in this pathosystem. Importantly, we have identified putative bean gene orthologs of Arabidopsis genes involved in the plant immune system. Based on experimental validation of gene expression, we propose that hypersensitive reaction as part of effector-triggered immunity may operate, at least in part, by down-regulating genes, such as FLS2-like and MKK5-like, putative orthologs of the Arabidopsis genes involved in pathogen perception and downstream signaling. Conclusions/Significance We have identified specific bean genes and uncovered metabolic processes and pathways that may be involved in the immune response against pathogens. Our transcriptome database is a rich resource for mining novel defense-related genes, which enabled us to develop a model of
Mechanisms of Mitochondrial Damage in Keratinocytes by Pemphigus Vulgaris Antibodies*
Kalantari-Dehaghi, Mina; Chen, Yumay; Deng, Wu; Chernyavsky, Alex; Marchenko, Steve; Wang, Ping H.; Grando, Sergei A.
2013-01-01
The development of nonhormonal treatment of pemphigus vulgaris (PV) has been hampered by a lack of clear understanding of the mechanisms leading to keratinocyte (KC) detachment and death in pemphigus. In this study, we sought to identify changes in the vital mitochondrial functions in KCs treated with the sera from PV patients and healthy donors. PV sera significantly increased proton leakage from KCs, suggesting that PV IgGs increase production of reactive oxygen species. Indeed, measurement of intracellular reactive oxygen species production showed a drastic increase of cell staining in response to treatment by PV sera, which was confirmed by FACS analysis. Exposure of KCs to PV sera also caused dramatic changes in the mitochondrial membrane potential detected with the JC-1 dye. These changes can trigger the mitochondria-mediated intrinsic apoptosis. Although sera from different PV patients elicited unique patterns of mitochondrial damage, the mitochondria-protecting drugs nicotinamide (also called niacinamide), minocycline, and cyclosporine A exhibited a uniform protective effect. Their therapeutic activity was validated in the passive transfer model of PV in neonatal BALB/c mice. The highest efficacy of mitochondrial protection of the combination of these drugs found in mitochondrial assay was consistent with the ability of the same drug combination to abolish acantholysis in mouse skin. These findings provide a theoretical background for clinical reports of the efficacy of mitochondria-protecting drugs in PV patients. Pharmacological protection of mitochondria and/or compensation of an altered mitochondrial function may therefore become a novel approach to development of personalized nonhormonal therapies of patients with this potentially lethal autoimmune blistering disease. PMID:23599429
Extraocular spectral photosensitivity in the tentacles of Hydra vulgaris.
Guertin, S; Kass-Simon, G
2015-06-01
Previous electrophysiological studies on the cnidarian Hydra vulgaris have shown that hydra have a highly developed and specific photoresponse despite their lack of any structure recognizable as a traditional photoreceptor. In an effort to identify the site of hydra's photoreceptors, we recorded extracellularly from single excised tentacles and from ablated hypostomes lacking tentacles in absolute darkness and during exposure to light of various wavelengths. During recording, after an initial period of absolute darkness, tentacles or hypostomes were exposed to light from 450nm to 600nm, red, and white light. Exposure to light caused a change in the pattern and frequency of impulses in the tentacles that varied with color. The number of large tentacle pulses (TPs) increased at 550 and 600nm relative to darkness, whereas the number of small tentacle pulses (STPs) tended to decrease in 500nm light. Impulse frequency was significantly different among the different wavelengths. In addition to bursts of tentacle contraction pulses, long trains of pulses were observed. A change in lighting caused a switch from bursting to trains or vice versa. In contrast to excised tentacles, no change in electrical activity was seen in ablated hypostomes at any of the wavelengths relative to each other or relative to darkness. These results indicate that isolated tentacles can distinguish among and respond to various colors across the visible spectrum and suggest that electromagnetic information is transmitted from the tentacles to the hypostome where it may be integrated by the hypostomal nervous system, ultimately contributing to hydra's photoreceptive behavior. Copyright © 2015 Elsevier Inc. All rights reserved.
Diversification and population structure in common beans (Phaseolus vulgaris L..
Directory of Open Access Journals (Sweden)
Matthew W Blair
Full Text Available Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13 for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican, Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru. The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of
Dissecting Phaseolus vulgaris innate immune system against Colletotrichum lindemuthianum infection.
Directory of Open Access Journals (Sweden)
Paula Rodrigues Oblessuc
Full Text Available BACKGROUND: The genus Colletotrichum is one of the most economically important plant pathogens, causing anthracnose on a wide range of crops including common beans (Phaseolus vulgaris L.. Crop yield can be dramatically decreased depending on the plant cultivar used and the environmental conditions. This study aimed to identify potential genetic components of the bean immune system to provide environmentally friendly control measures against this fungus. METHODOLOGY AND PRINCIPAL FINDINGS: As the common bean is not amenable to reverse genetics to explore functionality and its genome is not fully curated, we used putative Arabidopsis orthologs of bean expressed sequence tag (EST to perform bioinformatic analysis and experimental validation of gene expression to identify common bean genes regulated during the incompatible interaction with C. lindemuthianum. Similar to model pathosystems, Gene Ontology (GO analysis indicated that hormone biosynthesis and signaling in common beans seem to be modulated by fungus infection. For instance, cytokinin and ethylene responses were up-regulated and jasmonic acid, gibberellin, and abscisic acid responses were down-regulated, indicating that these hormones may play a central role in this pathosystem. Importantly, we have identified putative bean gene orthologs of Arabidopsis genes involved in the plant immune system. Based on experimental validation of gene expression, we propose that hypersensitive reaction as part of effector-triggered immunity may operate, at least in part, by down-regulating genes, such as FLS2-like and MKK5-like, putative orthologs of the Arabidopsis genes involved in pathogen perception and downstream signaling. CONCLUSIONS/SIGNIFICANCE: We have identified specific bean genes and uncovered metabolic processes and pathways that may be involved in the immune response against pathogens. Our transcriptome database is a rich resource for mining novel defense-related genes, which enabled us to
Acne vulgaris in women: prevalence across the life span.
Perkins, Alexis C; Maglione, Jessica; Hillebrand, Greg G; Miyamoto, Kukizo; Kimball, Alexa B
2012-02-01
Acne vulgaris is a common skin disease with a large quality of life impact, characterized by comedones, inflammatory lesions, secondary dyspigmentation, and scarring. Although traditionally considered a disease of adolescence, reports suggest it is also a disease of adults, especially adult women. Our objectives were to determine acne prevalence in a large, diverse group of women and to examine acne by subtype and in relation to other skin findings, measurements, and lifestyle factors. We recruited 2895 women aged 10-70 from the general population. Photographs were graded for acne lesions, scars, and dyspigmentation. Measurements were taken of sebum excretion and pore size, and survey data were collected. Of the women studied, 55% had some form of acne: 28% had mild acne, and 27% had clinical acne, 14% of which was primarily inflammatory and 13% of which was primarily comedonal. Acne peaked in the teenage years, but 45% of women aged 21-30, 26% aged 31-40, and 12% aged 41-50 had clinical acne. Women with inflammatory acne were younger than those with comedonal acne (p≤0.001), and postmenopausal women had less acne than age-matched peers (pAcne was associated with facial hirsutism (p=0.001), large pores (p=0.001), and sebum excretion (p=0.002). Smokers had more, primarily comedonal, acne than nonsmokers. The cross-sectional design precludes conclusions about progression of acne with age. Participation was restricted to women. The photographic nature of the study imposes general limitations. Techniques used in this study were not sufficiently sensitive to identify cases of subclinical acne. More than a quarter of women studied had acne, which peaked in the teens but continued to be prevalent through the fifth decade.
Importance of the dentist in early diagnosis of pemphigus vulgaris
Directory of Open Access Journals (Sweden)
Thiago de Santana Santos
2009-10-01
Full Text Available The vulgar pemphigus is a chronic, rare, vesicle-bubble disease of autoimmune origin and with a possibility of following a dangerous clinical course when it is not diagnosed and treated in its initial stage. It usually affects people from 40 to 60 years old, being rare in children. In the majority of cases, oral manifestations are the first signs of the disease, so that dentists play an important rol in its early diagnosis. The authors present a case report of vulgar pemphigus in a 17 year-old patient, attended by the Bucco-Maxillo-Facial Surgery Service of the “Fundação de Beneficência Hospital de Cirurgia” in Aracaju-SE, Brazil. The patient was admitted with a complaint of the presence of numerous scattered painful ulcers in the mouth that had developed in approximately two months, and reported that at first, blisters that broke quickly appeared, leading to extremely painful ulcerations. Incisional biopsies were performed in the jugal mucosa and retromolar regions, and also a complete hemogram to discard the hypothesis of leukemia. In view of the clinical and histopathological findings, the final diagnosis of pemphigus vulgaris was made. Before receiving specialized treatment, the patient presented marked worsening of the clinical condition, with exacerbation of intraoral signs and symptoms and development of skin lesions around the body surface. The patient was hospitalized in the “Hospital Universitário da Universidade Federal de Sergipe” and treated with prednisone, cimetidine and nystatin, showing significant improvement of symptoms in approximately two weeks. At present, the patient is under the care of an interdisciplinary team that includes dermatologists and dentists.
Effect of the glycemic index of carbohydrates on Acne vulgaris.
Reynolds, Rebecca C; Lee, Stephen; Choi, James Y J; Atkinson, Fiona S; Stockmann, Karola S; Petocz, Peter; Brand-Miller, Jennie C
2010-10-01
Acne vulgaris may be improved by dietary factors that increase insulin sensitivity. We hypothesized that a low-glycemic index diet would improve facial acne severity and insulin sensitivity. Fifty-eight adolescent males (mean age ± standard deviation 16.5 ± 1.0 y and body mass index 23.1 ± 3.5 kg/m(2)) were alternately allocated to high or low glycemic index diets. Severity of inflammatory lesions on the face, insulin sensitivity (homeostasis modeling assessment of insulin resistance), androgens and insulin-like growth factor-1 and its binding proteins were assessed at baseline and at eight weeks, a period corresponding to the school term. Forty-three subjects (n = 23 low glycemic index and n = 20 high glycemic index) completed the study. Diets differed significantly in glycemic index (mean ± standard error of the mean, low glycemic index 51 ± 1 vs. high glycemic index 61 ± 2, p = 0.0002), but not in macronutrient distribution or fiber content. Facial acne improved on both diets (low glycemic index -26 ± 6%, p = 0.0004 and high glycemic index -16 ± 7%, p = 0.01), but differences between diets did not reach significance. Change in insulin sensitivity was not different between diets (low glycemic index 0.2 ± 0.1 and high glycemic index 0.1 ± 0.1, p = 0.60) and did not correlate with change in acne severity (Pearson correlation r = -0.196, p = 0.244). Longer time frames, greater reductions in glycemic load or/and weight loss may be necessary to detect improvements in acne among adolescent boys.
Acne vulgaris: Perceptions and beliefs of Saudi adolescent males
Al-Natour, Sahar H.
2017-01-01
INTRODUCTION: Although acne vulgaris is common in adolescents, information on their understanding of acne is minimal. OBJECTIVES: To evaluate the perceptions and beliefs of Saudi youth on acne. MATERIALS AND METHODS: Three hundred twenty-nine male students (aged 13–22 years) from 6 secondary schools in the Eastern Saudi Arabia completed a self-reported questionnaire on knowledge, causation, exacerbating and relieving factors of acne. Data were analyzed by SPSS version 15.0. Results of subjects with acne, a family history of acne, and parents' educational levels were compared. Differences between the analyzed groups were assessed by a Chi-square test; p ≤ 0.05 was considered statistically significant. RESULTS: Over half (58.9%) of the participants considered acne a transient condition not requiring therapy. Only 13.1% knew that the proper treatment of acne could take a long time, even several years. Over half (52%) thought acne can be treated from the first or after few visits to the doctor. Popular sources of information were television/radio (47.7%), friends (45.6%), and the internet (38%). Only 23.4% indicated school as a source of knowledge. Reported causal factors included scratching (88.5%) and squeezing (82.1%) of pimples, poor hygiene (83.9%), poor dietary habits (71.5%), and stress (54.1%). Ameliorating factors included frequent washing of the face (52.9%), exercise (41.1%), sunbathing (24.1%), and drinking of mineral water (21%). The correlations of these facts are discussed. CONCLUSION: Results of this study point out that misconceptions of acne are widespread among Saudi youth. A health education program is needed to improve the understanding of the condition. PMID:28163574
Psychosocial Impact of Postinflammatory Hyperpigmentation in Patients with Acne Vulgaris
Darji, Kavita; Varade, Reena; West, Daniel; Armbrecht, Eric S.
2017-01-01
Background: Acne vulgaris is a common, often socially distressing skin condition primarily seen in young adults. Quality of life studies have shown that people with acne are more introverted with increased social setting anxiety compared to a control group. Unfortunately, patients with acne may have residual postinflammatory hyperpigmentation, amplifying impaired psychosocial effects. Objective: To quantify the impact of postinflammatory hyperpigmentation in patients with acne using a psychometric scale. Design: A clinic-based survey was conducted among US adults with facial acne and postinflammatory hyperpigmentation. Outcomes included age, race, gender, and acne-related quality of life. A board-certified dermatologist rated each patient’s acne severity and postinflammatory hyperpigmentation. Setting: Dermatology clinic, Anheuser Busch Institute and Des Peres Hospital, Saint Louis, Missouri. Participants: 48 subjects (25 patients with acne and postinflammatory hyperpigmentation; 23 with acne only). Measurements: Acne Quality of Life survey, dermatologist rating of acne and postinflammatory hyperpigmentation severity. Results: Subjects with postinflammatory hyperpigmentation reported statistically significant poorer mean scores on the Acne Quality of Life survey than subjects with acne only. Sixty percent of patients with postinflammatory hyperpigmentation had a “very markedly” impact to at least one aspect of the Acne Quality of Life survey scale compared to none of the acne only patients. There was no association between provider-reported hyperpigmentation severity and psychosocial impact. No differences in psychosocial impact were noted between males and females. Conclusion: Patients with acne and postinflammatory hyperpigmentation had poorer quality-of-life scores compared to patients with only acne. Having postinflammatory hyperpigmentation with acne negatively impacted self-perceptions and social/emotional functioning, especially in groups. PMID
Akan, Zafer; Dikilidal, Melek; Ozdemir, Hulya; Oto, Gokhan; Yilmaz, Ahmet
2014-01-01
Aim: Diabetes mellitus (DM) is a metabolic disease due to increased blood glucose, with multiple organ involvement. Although various oral drugs are used to treat DM, they do not prevent the development of DM related diseases such as cognitive disorder, neuropathy and vascular diseases. Thus novel strategies for the prevention and treatment of DM are urgently needed. This research aimed to reveal the effects of Thymus Vulgaris Lamiaceae (TVL) and Thymbra Spicata Lamiaceae (TSL) on the damaging...
Carai, Mauro A M; Fantini, Noemi; Loi, Barbara; Colombo, Giancarlo; Gessa, Gian Luigi; Riva, Antonella; Bombardelli, Ezio; Morazzoni, Paolo
2011-09-01
Previous lines of experimental evidence have suggested that Phaseolus vulgaris extracts reduce food intake, body weight, lipid accumulation, hedonic properties of food, carbohydrate absorption and metabolism, and glycaemia in rats. The present study was designed to assess the effect of multiple cycles of repeated treatments with a standardised P. vulgaris dry extract on daily food intake and body weight in genetically obese Zucker fa/fa rats (Expt 1). Additionally, the study tested the effect of acute treatment with P. vulgaris dry extract on postprandial glycaemia in Zucker fa/fa rats (Expt 2). In Expt 1, P. vulgaris dry extract was administered daily, at doses of 50 and 500 mg/kg, in three 5 d treatment periods followed by three 20 d off-treatment periods. Administration of P. vulgaris dry extract resulted in dose-dependent decreases in daily food intake and body weight in each treatment phase. Reductions in food intake were of comparable magnitude in each treatment phase. In Expt 2, food-deprived rats were acutely treated with 50 and 500 mg P. vulgaris dry extract per kg immediately before access to a fixed amount of a starch-enriched chow. Treatment with P. vulgaris dry extract resulted in a dose-dependent suppression of glycaemia. These results extend previous data on the anorectic and hypoglycaemic effects of the P. vulgaris dry extract to a validated animal model of obesity. Together with data published previously in the literature, these results strengthen the hypothesis that potentially effective, novel pharmacotherapies for obesity and related disorders may originate from extracts and derivatives of P. vulgaris.
Sakamoto, Fernanda H; Lopes, José Daniel; Anderson, R Rox
2010-08-01
The first-line treatments for acne vulgaris are conventional topical and/or oral medications. However, many patients have contraindications, only partial response, significant adverse effects, or recurrence. Light-based treatments and photodynamic therapy (PDT) using topical precursors of porphyrins are off-label alternative treatments for acne vulgaris, with their own advantages and disadvantages. To date, there is no consensus on PDT methodology and parameters. An understanding of pathophysiology of acne, light-tissue interactions, and PDT mechanisms of action is helpful whenever PDT is considered as an alternative treatment. In general, blue light alone improves acne because of its antiinflammatory effects. PDT using 5-aminolevulenic acid (ALA) or ALA derivatives induces transient antimicrobial and antiinflammatory effects. At high doses, red light PDT may induce inhibition or destruction of sebaceous glands, resulting in clinical improvement. After completing this learning activity, participants should be able to compare different treatments of acne, recognize when photodynamic therapy may be a useful off-label treatment for acne vulgaris, and identify variables that may affect the efficacy of photodynamic therapy. Copyright 2010 American Academy of Dermatology, Inc. Published by Mosby, Inc. All rights reserved.
Transitions: A Personal Perspective.
Wood, Ann Stace
1995-01-01
Distinguishes between unchosen transitions (children maturing and leaving, parents aging, companies downsizing) and chosen ones (moving, divorce, marriage, career changes). Describes the steps one goes through: uneasiness, renewed energy, complaining, exploration, partial transition, and the completed transition. (JOW)
Zhu, X J; Tu, P; Zhen, J; Duan, Y Q
2001-10-01
Acne vulgaris is a common dermatologic disease in Asian populations, as well as in Caucasians. Our objective was to evaluate the safety and efficacy of adapalene gel 0.1% in comparison with tretinoin gel 0.025% in Chinese patients with acne vulgaris. We used an 8-week, multicenter, randomized, controlled, investigator-masked, parallel group design study of adapalene gel 0.1% and tretinoin gel 0.025% in 150 Chinese patients with mild-to-moderate acne vulgaris. Our results showed that adapalene gel 0.1% had efficacy equivalent to tretinoin gel 0.025% against acne lesions in Chinese patients, with a more acceptable tolerability profile.
Margaretha, Charoina
2014-01-01
Acne Vulgaris is one of the common diseases of the skin that suffered in public. High-calorie diets have been suspected for a long periode as one of the causes of this disease. It has been supported by the increased number of Acne Vulgaris incidences in developing countries nowadays. Since 1946 to 2007 various studies have been conducted on the relationship of dietary consumption to the occurrence of acne vulgaris and they have come up with variety of results among the researchers.The purpose...
Learning and memory in Octopus vulgaris: a case of biological plasticity.
Zarrella, Ilaria; Ponte, Giovanna; Baldascino, Elena; Fiorito, Graziano
2015-12-01
Here we concisely summarize major aspects of the learning capabilities of the cephalopod mollusc Octopus vulgaris, a solitary living marine invertebrate. We aim to provide a backdrop against which neurobiology of these animals can be further interpreted and thus soliciting further interest for one of the most advanced members of invertebrate animals. Copyright © 2015 Elsevier Ltd. All rights reserved.
Aigner, Birgit Angela; Ollert, Markus; Seifert, Florian; Ring, Johannes; Plötz, Sabine Gisela
2011-08-01
Octopus vulgaris is a common marine animal that can be found in nearly all tropical and semitropical waters around the world. It is a peaceful sea dweller with a parrotlike beak, and its primary defense is to hide through camouflaging adjustments. Bites from animals of the class Cephalopoda are very rare. We describe a boy who was bitten on his forearm by an Octopus vulgaris. A 9 -year-old boy was bitten by an Octopus vulgaris while snorkeling. There was no strong bleeding or systemic symptoms; however, 2 days later, a cherry-sized, black, ulcerous lesion developed, surrounded by a red circle that did not heal over months and therefore had to be excised. Histologic examination showed ulceration with extensive necrosis of the dermis and the epidermis. A microbial smear revealed Pseudomonas (formerly known as Flavimonas) oryzihabitans. After excision, the wound healed within 2 weeks, without any complications or signs of infection. To the best of our knowledge, this case represents the first report of an Octopus vulgaris bite resulting in an ulcerative lesion with slow wound healing owing to P oryzihabitans infection. We recommend greater vigilance regarding bacterial contamination when treating skin lesions caused by marine animals.
Introduction history and population genetics of Falcaria vulgaris (Apiaceae) in the United States
Sarbottam Piya
2013-01-01
Falcaria vulgaris Bernh. (sickleweed), native to Eurasia, occurs disjunctly in the Midwest and the East Coast of the United States. In parts of Iowa, Nebraska and South Dakota, it is an aggressive weed potentially turning to invasive. The main objectives of this study were (1) to reconstruct the introduction history and spread of the plant, (2) to develop and apply...
Dietary glycemic factors, insulin resistance, and adiponectin levels in acne vulgaris.
Çerman, Aslı Aksu; Aktaş, Ezgi; Altunay, İlknur Kıvanç; Arıcı, Janset Erkul; Tulunay, Aysın; Ozturk, Feyza Yener
2016-07-01
There is increasing evidence to support the relationship between acne vulgaris and diet. The aim of this study was to investigate possible associations among dietary glycemic index, glycemic load, milk consumption, insulin resistance, and adiponectin levels in the pathogenesis of acne vulgaris. The dietary glycemic index, glycemic load, milk consumption, fasting glucose, insulin, insulin-like growth factor)-1, insulin-like growth factor binding protein-3, adiponectin, and homeostasis model assessment of insulin resistance values of 50 patients with acne vulgaris and 36 healthy control subjects were measured. Glycemic index and glycemic load levels were significantly higher (P = .022 and P = .001, respectively) and serum adiponectin levels were significantly lower (P = .015) in patients with acne than in the control subjects. There was an inverse correlation between serum adiponectin concentration and glycemic index (P = .049, r = -0.212). This study used a cross-sectional design and the study population was limited to young, nonobese adults. A high-glycemic-index/-load diet was positively associated with acne vulgaris. Adiponectin may be a pathogenetic cofactor contributing to the development of the disease. Further research on adiponectin levels in patients with acne in terms of development of insulin resistance might be important in this possible relationship. Copyright © 2016 American Academy of Dermatology, Inc. Published by Elsevier Inc. All rights reserved.
A HPTLC densitometric determination of luteolin in Thymus vulgaris and its extracts.
Bazylko, A; Strzelecka, H
2007-09-01
Luteolin content in Thymus vulgaris and its extracts have been compared. Luteolin was separated on a thin- layer of silica gel with three-step gradient elution and determined by HPTLC-photodensitometry. The proposed method is simple and sensitive and can be used for the routine assay of luteolin in phytomedicines containing thyme extracts.
Directory of Open Access Journals (Sweden)
Jamshid Tabeshpour
2017-05-01
Full Text Available Metabolic syndrome (MetS, characterized by a cluster of metabolic abnormalities including hypertension, obesity, type 2 diabetes mellitus (T2DM and dyslipidemia, is a well-known cardiovascular risk factor (CVRF. Cardiovascular disease (CVD represents a massive healthcare burden worldwide. In recent years, with regard to the adverse effects of synthetic drugs, increasing attention has been paid by researchers to herbal medicines for a variety of disorders such as CVD. A large body of literature supports different pharmacological actions of Berberis vulgaris (B. vulgaris and its active component, berberine (BBR, such as antidiabetic, antiobesity, hypotensive and hypolipidemic properties that could be interesting in the management of MetS associated with high CVD risk. Numerous preclinical in vitro and in vivo studies support all these effects. In this review, we evaluated the most related original articles to discover the role of B. vulgaris on various constituents of MetS and CVRF comprising dyslipidemia, obesity, high blood pressure and high blood glucose. This review suggests a potential role of B. vulgaris and BBR in the managing of MetS; nevertheless more investigations, especially reliable clinical trials, need to be accomplished to evaluate their effectiveness.
Assimilation of dietary proteins is critical to insect survival; therefore, inhibition of digestive proteolytic enzymes presents itself as an effective strategy for control of insect pests. To specifically target proteases of several insect pests of sugar beet, Beta vulgaris, we used PCR and gene s...
Cheng, D.; Kirk, H.; Mulder, P.P.J.; Vrieling, K.; Klinkhamer, P.G.L.
2011-01-01
Hybridization can lead to novel qualitative or quantitative variation of secondary metabolite (SM) expression that can have ecological and evolutionary consequences.•We measured pyrrolizidine alkaloid (PA) expression in the shoots and roots of a family including one Jacobaea vulgaris genotype and
Sneller, F.E.C.; Noordover, E.C.M.; ten Bookum, W.M.; Schat, H.; Bedaux, J.J.M.; Verkley, J.A.C.
1999-01-01
Phytochelatins (PCs) are known to detoxify heavy metals in plants. This study aimed to investigate the possibility of using PCs as a biomarker for chronic Cd toxicity in Silene vulgaris. For this purpose, the effects of Cd on growth rate, related to plant weight, and the PC concentrations were
Effect of essential oils of Thymus vulgaris and Mentha piperita on the ...
African Journals Online (AJOL)
Effect of essential oils of Thymus vulgaris and Mentha piperita on the control of green mould and postharvest quality of Citrus Sinensis cv. Valencia. ... The highest total acid value was observed in non- inoculated fruits of thyme treatment with 100 ppm concentration (1.49 mg). The highest soluble solid content was observed ...
Den ecology of Octopus vulgaris Cuvier, 1797, on soft sediment: availability and types of shelter
Directory of Open Access Journals (Sweden)
Stelios Katsanevakis
2004-03-01
Full Text Available To avoid predation, octopuses select and actively modify shelters (also called dens in the substratum, where they remain most of the time, especially during daylight hours. The main questions that this study deals with are: Is den availability a significant constraint for the distribution of Octopus vulgaris on soft sediment? What kind of dens does O. vulgaris use on soft sediment and what factors affect the selection of one type instead of another? With population density measurements by SCUBA diving and enrichment experiments with artificial dens, we concluded that the availability of solid materials necessary for den construction is a limiting factor for the distribution of O. vulgaris on soft sediment. O. vulgaris used four different types of den on soft sediment: well (a vertical hole in the sediment, rock/stone (the octopus uses a rock or a large stone to dig a cavity under it, shell (an empty shell is used, human origin (a solid material of human origin is used. The relative proportion of the four types of den in the areas studied was: 38.7% human origin, 29.7% well, 21.5% rock/stone, 2.9% shell. Also, 7.3% of the octopuses were found outside their den. The main types of den were found in different relative proportions in relation to the depth, the distance from shore, the octopus size and the granulometry of the sediment.
Draft Genome Sequence of Nitrobacter vulgaris Strain Ab1, a Nitrite-Oxidizing Bacterium.
Mellbye, Brett L; Davis, Edward W; Spieck, Eva; Chang, Jeff H; Bottomley, Peter J; Sayavedra-Soto, Luis A
2017-05-04
Here, we present the 3.9-Mb draft genome sequence of Nitrobacter vulgaris strain Ab1, which was isolated from a sewage system in Hamburg, Germany. The analysis of its genome sequence will contribute to our knowledge of nitrite-oxidizing bacteria and acyl-homoserine lactone quorum sensing in nitrifying bacteria. Copyright © 2017 Mellbye et al.
Draft Genome Sequence of Nitrobacter vulgaris Strain Ab1, a Nitrite-Oxidizing Bacterium
Brett L. Mellbye; Davis, Edward W.; Spieck, Eva; Jeff H Chang; Bottomley, Peter J.; Sayavedra-Soto, Luis A.
2017-01-01
ABSTRACT Here, we present the 3.9-Mb draft genome sequence of Nitrobacter vulgaris strain Ab1, which was isolated from a sewage system in Hamburg, Germany. The analysis of its genome sequence will contribute to our knowledge of nitrite-oxidizing bacteria and acyl-homoserine lactone quorum sensing in nitrifying bacteria.
Evaluation of social anxiety, self-esteem, life quality in adolescents with acne vulgaris.
Unal, Dilek; Emiroğlu, Nazan; Cengiz, Fatma Pelin
2016-08-05
Acne vulgaris is a visible skin disease commonly seen in adolescence. As it affects the appearance, it is likely to bring stress to the adolescent's life regarding sensitivity about their appearance. The aim of the study was to investigate the social anxiety level, acne-specific life quality, and self-esteem among adolescents with acne vulgaris. In addition, we evaluated the relationship between these parameters, clinical severity, and sociodemographic data. One hundred and two adolescents with acne vulgaris, aged 12-17 years without any psychiatric or medical comorbidity were recruited. The control group consisted of 83 adolescents in the same age range, who had neither psychiatric disease nor acne. Sociodemographic form (SDF), Capa Social Phobia Scale for Children and Adolescents (CSPSCA), and Rosenberg Self-esteem Scale (RSES) were applied to both groups. Additionally, the severity of acne was determined with Global Acne Grading System (GAGS), and life quality of the patients was evaluated with Acne Quality of Life Scale (AQOL). There was no significant difference in social anxiety levels and self-esteem between the study and control groups. Life quality impairment and high social anxiety levels, as well as low self-esteem, were found to be associated regardless of the clinical severity. Clinicians should be aware of the psychiatric comorbidities when treating adolescents with acne vulgaris. Especially, low self-esteem and life quality impairment should warn clinicians to predict high social anxiety levels in adolescent acne patients.
Respiratory water loss during rest and flight in European Starlings (Sturnus vulgaris)
Engel, Sophia; Suthers, Roderick A.; Biebach, Herbert; Visser, G. Henk
2006-01-01
Respiratory water loss in Starlings (Sturnus vulgaris) at rest and during flight at ambient temperatures (T-amb) between 6 and 25 degrees C was calculated from respiratory airflow and exhaled air temperature. At rest, breathing frequency f(1.4 +/- 0.3 Hz) and tidal volume V-t (1.9 +/- 0.4 ml) were
Virulence of Macrophomina phaseolina isolates in common bean (Phaseolus vulgaris) genotypes
Charcoal rot caused by Macrophomina phaseolina (Tassi) Goid, is an important disease in common beans (Phaseolus vulgaris) in the dry and warmer areas of Puerto Rico and in much of the tropics and subtropics worldwide. The virulence of three isolates from Isabela (Mph-ISA-TARS), Juana Diaz (Mph-JD) a...
Growth, sucrose synthase, and invertase activities of developing Phaseolus vulgaris L. fruits
Shi-Jean S. Sung; W.J. Sheih; D.R. Geiger; C.C. Black
1994-01-01
Activities of sucrose-cleaving enzymes, acid and neutral invertase and sucrose synthase, were measured in pods and seeds of developing snap bean (Phaseolus vulgaris L.) fruits, and compared with 14C-import, elongation and dry weight accumulation. The data supports the association of specific sucrose-cleaving enzymes with the specific processes that occur in the...
Demonstrating a nutritional advantage to the fast cooking dry bean (Phaseolus vulgaris L.)
Dry beans (Phaseolus vulgaris L.) are a nutrient dense food rich in protein and micronutrients. Despite their nutritional benefits, long cooking times limit the consumption of dry beans worldwide, especially in nations where fuelwood for cooking is often expensive or scarce. This study evaluated the...
Formation of adventitious roots on green leaf cuttings of Phaseolus vulgaris L.
Oppenoorth, Johanna Margriet
1980-01-01
n this thesis the development of adventitious roots on green leaf cuttings of Phaseolus vulgaris L. is studies. The use of green leaf cuttings has the advantage that the leaf blade provides the developing roots inthe petiole with all the nutrients required, a disadvantage is that the composition of
Acanthoscelides obtectus (Say) (Coleoptera: Chrysomelidae), is an economically important pest of common bean Phaseolus vulgaris L. (Fabaceae) in the tropics and subtropics. It is difficult to detect the presence of A. obtectus because the larvae are cryptic and spend most of their developmental time...
Horst, G.J. ter; Karst, H.; Luiten, P.G.M.
1984-01-01
The autoradiographic pattern of anterograde labeling as a result from injections with tritiated amino acids is compared to the labeling of efferents with Phaseolus vulgaris leuco-agglutinin after lectin injections in the same nucleus visualized by immunohistochemical methods. This comparison is made
Medicinal Plants for the Treatment of Acne Vulgaris: A Review of Recent Evidences
Nasri, Hamid; Bahmani, Mahmoud; Shahinfard, Najmeh; Moradi Nafchi, Atefeh; Saberianpour, Shirin; Rafieian Kopaei, Mahmoud
2015-01-01
Context: Acne vulgaris affects about 85% of teenagers and may continue to adulthood. There are about two million visits to physicians per year for teenagers and the direct cost of acne treatment in the US exceeds $1 billion per year. Evidence Acquisition: A wide variety of treatment regimens exist for acne vulgaris including benzoil peroxide, retinoids, isotretinoids, keratolytic soaps, alpha hydroxy acids, azelaic acid, salicilic acid as well as hormonal, anti-androgen or antiseborrheic treatments. However, none of these methods is free of side effects and their exact role in therapy is not clear. In this paper apart from presenting the possible causes of acne vulgaris and its available drugs, recently published papers about medicinal plants used in the treatment of acne vulgaris were reviewed. Results: Consumption of alternative and complementary medicine, including medicinal plants, is increasing and is common amongst patients affected by acne and infectious skin diseases. Medicinal plants have a long history of use and have been shown to possess low side effects. These plants are a reliable source for preparation of new drugs. Conclusions: Many plants seem to have inhibitory effects on the growth of bacteria, fungi and viruses in vitro. However, there are a few clinical evidences about the effectiveness and safety of these plants in the treatment of acne and other skin infections. PMID:26862380
Reliability and validity of the Psoriasis Itch Visual Analog Scale in psoriasis vulgaris.
Pedersen, Claus Bang; McHorney, Colleen A; Larsen, Lotte Seiding; Lophaven, Katja Wendicke; Moeller, Anders Holmen; Reaney, Matthew
2017-05-01
The single-item Psoriasis Itch VAS was developed to measure itch intensity within the last 24 hours in psoriasis vulgaris to assess treatment benefit. Its psychometric properties were explored in two trials. Data from two randomized, parallel-group phase 3 trials with subjects suffering from psoriasis vulgaris on the body (n = 426, 463) were analyzed. Cross-sectional distributional properties and construct validity of the Psoriasis Itch VAS as well as longitudinal test-retest reliability and sensitivity to change of the Psoriasis Itch VAS were investigated. All statistical tests were two-tailed. Across both trials, acceptable distributional properties were observed. Convergent-validity correlations between the Psoriasis Itch VAS and other patient-reported and clinician-reported outcomes provided strong endorsement for construct validity as did tests of known-groups validity. Longitudinal measurement properties, involving test-retest reliability and sensitivity to change, also offered evidence for the measurement integrity of the Psoriasis Itch VAS. Results from the assessment of validity, reliability, and sensitivity to change support the use of the Psoriasis Itch VAS to measure itch intensity in psoriasis vulgaris. Data from two trials provided evidence that the Psoriasis Itch VAS is well-defined and reliable for measuring itch in psoriasis vulgaris to assess treatment benefit (i.e. therapeutic response).
Directory of Open Access Journals (Sweden)
Iulia Bara
2006-08-01
Full Text Available Our study is focused on the influence of the UV-B irradiation, at the level of hidric balance, methabolic activity, and in the content of minerals, polyphenols, pigments, nucleic acids, proteins, of five romanian cultivars: Diva, Star, Vera, Ami, Avans of Phaseolus vulgaris, sawn after germination in enreached UV-B environment in natural field condition.
Callus induction and plant regeneration in the metallophyte Silene vulgaris (Caryophyllaceae).
Jack, E.M.; Atanasova, S; Verkley, J.A.C.
2005-01-01
Zinc tolerant and non-tolerant ecotypes of Silene vulgaris (Moench) Garcke were examined for their suitability to provide an efficient and reproducible callus formation and regeneration system. Successful and rapid regeneration of adventitious shoots from callus was achieved in leaf tissue but not
Phenotypic variation in a core collection of common bean (Phaseolus vulgaris L.) in the Netherlands
Zeven, A.C.; Waninge, J.; Hintum, van Th.J.L.; Singh, S.P.
1999-01-01
Forty accessions, forming a core collection of mainly bush type of the common bean (Phaseolus vulgaris L.) germplasm in the Netherlands, were evaluated for 14 qualitative and quantitative traits at the Agricultural University, Wageningen (WAU), the Netherlands in 1992. These and an additional 117
MODELLING OF HYDRATION OF BEAN (PHASEOLUS VULGARIS L.): EFFECT OF THE LOW-FREQUENCY ULTRASOUND
National Research Council Canada - National Science Library
L R López López; J A Ulloa; P Rosas Ulloa; J C Ramírez Ramírez; Y Silva Carrillo; A Quintero Ramos
2017-01-01
..., mathematical modelling, ultrasound, water diffusivity, Weibull's model 1. INTRODUCTION Common beans (Phaseolus vulgaris L.) are a grain legumes that belong to the family of Fabaceae. They provide an affordable source of protein (16-33%), almost two to three times that of cereals), and also are a rich source of dietary fibre, starch, minerals...
Directory of Open Access Journals (Sweden)
Márquez-Benavides Liliana
2014-08-01
Full Text Available Appropriate solid waste management includes leachate management, an effluent that results from the degradation of solid waste, moisture content and pluvial additions to the disposal site. Due to poor management of the landfill, sometimes leachate is likely to reach nearby areas, affecting soil water and vegetal area. A powerful tool to assess the pollution potential of a given leachate is the leachate pollution index (LPI developed by Kummar & Alappat (2005 that evaluates 18 parameters in order to calculate a value between 5-100 being 100 the highest in pollution potential. The LPI allows the comparison between leachates from different sites and ages, and also assists in the decision making process on leachate treatment. However, it is currently unknown if this value can also be related to the fitotóxico effect of a leachate on Phaseolus vulgaris L. The aim of this work was to calculate the LPI of two leachates and compare the effect on P. vulgaris L (common bean. A greenhouse scale experiment was set up, the studied variables were seed germination per cent (% and phenotype of P. vulgaris at seedling step after treated with several leachate concentrations from Guanajuato (GTO and Toluca (TOL, México. Results showed that a greater LPI (34.8 from GTO did not correspond to a largest fitotoxic effect on P. vulgaris. This bioassay could be a completely tool with LPI to evaluate pollution potential of leachate approaching to normal environmental conditions.
Zambrano, Rosaura; Granito, Marisela; Valero, Yolmar
2013-06-01
The objective of this work was to formulate a cereals and legume (Phaseolus vulgaris) bar and assess its impact on the glycemic response of healthy individuals, in order to contribute to the healthy food supply beneficial to consumers. A mixture of cereals (corn and oats) and different percentages (20 and 30%) of Phaseolus vulgaris was used to formulate the bar. Additionally, a legume cereal bar without legumes (bar control) was prepared. The bar with 30% of Phaseolus vulgaris was selected through sensory evaluation, being scored with better flavor and texture. This combination of cereals and legumes aminoacid improves complementation and reaches the formulation criteria previously established. Chemical characterization indicated a higher protein content in the bar with 30% of Phaseolus vulgaris (13.55%) relative to the bar control (8.5%). The contents of fat, ash and dietary fiber did not differ between the two bars evaluated. However, the soluble fiber and resistant starch of the selected bar was a 32.05% and 18.67%, respectively, than in the control bar; this may contribute to decreasing the rate of glucose uptake. The selected bar presented a low glycemic index (49) and intermediate glycemic load (12.0) in healthy volunteers, which could lead to a possible reduction in the rate of absorption of glucose into the bloodstream, associated with a carbohydrate content of slow absorption. This bar represents a proposal of a healthy snack for the consumer.
Medicinal Plants for the Treatment of Acne Vulgaris: A Review of Recent Evidences.
Nasri, Hamid; Bahmani, Mahmoud; Shahinfard, Najmeh; Moradi Nafchi, Atefeh; Saberianpour, Shirin; Rafieian Kopaei, Mahmoud
2015-11-01
Acne vulgaris affects about 85% of teenagers and may continue to adulthood. There are about two million visits to physicians per year for teenagers and the direct cost of acne treatment in the US exceeds $1 billion per year. A wide variety of treatment regimens exist for acne vulgaris including benzoil peroxide, retinoids, isotretinoids, keratolytic soaps, alpha hydroxy acids, azelaic acid, salicilic acid as well as hormonal, anti-androgen or antiseborrheic treatments. However, none of these methods is free of side effects and their exact role in therapy is not clear. In this paper apart from presenting the possible causes of acne vulgaris and its available drugs, recently published papers about medicinal plants used in the treatment of acne vulgaris were reviewed. Consumption of alternative and complementary medicine, including medicinal plants, is increasing and is common amongst patients affected by acne and infectious skin diseases. Medicinal plants have a long history of use and have been shown to possess low side effects. These plants are a reliable source for preparation of new drugs. Many plants seem to have inhibitory effects on the growth of bacteria, fungi and viruses in vitro. However, there are a few clinical evidences about the effectiveness and safety of these plants in the treatment of acne and other skin infections.
Sanclemente, Gloria; Acosta, Jorge-Luis; Tamayo, Maria-Eulalia; Bonfill, Xavier; Alonso-Coello, Pablo
2014-04-01
A significant number of clinical practice guidelines (CPGs) about the treatment of acne vulgaris in adolescents and adults have been published worldwide. However, little is known about the quality of CPGs in this field. The aim of this study was to appraise the methodological quality of published acne vulgaris CPGs. We performed a systematic review of published CPGs on acne vulgaris therapy from July 2002 to July 2012. Three reviewers independently assessed each CPG using the AGREE II instrument. A standardized score was calculated for each of the six domains. Our search strategy identified 103 citations but just six met our inclusion criteria. Agreement among reviewers was very good: 0.981. The domains that scored better were: "scope and purpose" and "clarity and presentation". Those that scored worse were "stakeholder involvement", "rigor of development", and "applicability". The European and the Malaysian CPGs were the only recommended with no further modifications. In addition, the Mexican, Colombian and the United States guidelines were recommended with provisos, with lower scores regarding stakeholder involvement, rigor of development and applicability. Only two guidelines clearly reported outcome measures for evaluating efficacy or included quality of life outcomes. CPGs varied regarding the consideration of light/laser therapy or consideration of complementary/alternative medicines. None of them included cost considerations of drugs such as systemic isotretinoin. In conclusion, published acne vulgaris CPGs for acne therapy vary in quality with a clear need to improve their methodological rigor. This could be achieved with the adherence to current CPGs development standards.
Characterization of nuclear and chloroplast microsatellite markers for Falcaria vulgaris (Apiaceae)
Sarbottam Piya; Madhav P. Nepal
2013-01-01
Falcaria vulgaris (sickleweed) is native to Eurasia and a potential invasive plant of the United States. No molecular markers have been developed so far for sickleweed. Characterization of molecular markers for this plant would allow investigation into its population structure and biogeography thereby yielding insights into risk analysis and effective management...
Toxicology effects of Berberis vulgaris (barberry and its active constituent, berberine: a review
Directory of Open Access Journals (Sweden)
Seyede Zohre Kamrani Rad
2017-05-01
Full Text Available Berberis vulgaris and berberine, its main component, traditionally have been used for treatment of various disorders. The pharmacological properties of them have been investigated using different in vivo and in vitro models. In spite of beneficial effects of B. vulgaris on different cell lines, there are documents have revealed negative impacts of it on animal and human. In this regards, the determination of its toxicity in a scientific view is necessary. In current report, we provide classified information about the toxicity of B. vulgaris and berberine in different conditions consist of acute, sub-acute, sub-chronic and chronic state. Besides, it discusses the cytotoxicity, genotoxicity, mutagenicity, and carcinogenicity of B. vulgaris and berberine as well as developmental toxicity and clinical studies. Data from the present study indicate that their toxicity is depending on the route and duration of administration. According to present study, they could induce GI upset and ulceration, immunotoxicity, phototoxicity, neurotoxicity, cardiotoxicity and jaundice in a dose dependent manner. They should be used with caution in pregnancy, neonatal and G6PD deficiency. Besides, consideration should be taken in co-administration of berberine with drugs that are metabolized with CYP enzymes due their inhibitory effects on these enzymes. Furthermore, they evoke cytotoxicity on both normal and cancer cell line which is time and concentration dependent.
Aspects of the population biology of Octopus vulgaris in False Bay ...
African Journals Online (AJOL)
The population biology of the octopus Octopus vulgaris was studied from specimens collected by SCUBA in False Bay, South Africa, between 1997 and 1998. In all, 83% of the specimens collected were found in shelter. Small octopuses were more active than large individuals during the day, 37% of the former and 8% of ...
Oukarroum, Abdallah; Bras, Sébastien; Perreault, François; Popovic, Radovan
2012-04-01
Freshwater microalga Chlorella vulgaris and marine microalga Dunaliella tertiolecta were used to investigate toxic effects induced by 50 nm silver nanoparticles (AgNPs). To induce AgNPs effect, we exposed Chlorella vulgaris and Dunaliella tertiolecta for 24h to 0-10 mg/L. We showed that growth media had different effects in AgNPs agglomerates' formation. Cellular viability, reactive oxygen species (ROS) formation and lipids peroxidation were employed to assess the toxic effects of AgNPs. AgNPs were able to interact directly with the Chlorella vulgaris cells surface and large aggregates were observed. AgNPs have a negative effect on Chlorella vulgaris and Dunaliella tertiolecta, as manifested by a strong decrease in chlorophyll content, viable algal cells, increased ROS formation and lipids peroxidation. The variability in sensitivity of both algae towards AgNPs was observed. We conclude that AgNPs have a negative effect on aquatic algae and these alterations might have serious consequences on structure and function of aquatic plant communities. Copyright © 2011 Elsevier Inc. All rights reserved.
Sarbottam Piya; Madhav P. Nepal; Jack L. Butler; Gary E. Larson; Achal Neupane
2014-01-01
Sickleweed (Falcaria vulgaris), an introduced species native to Europe and Asia, grows as an aggressive weed in some areas of the upper Midwest in the United States. We are reporting genetic diversity and population structure of sickleweed populations using microsatellite markers and nuclear and chloroplast DNA sequences. Populations showed high genetic differentiation...
Directory of Open Access Journals (Sweden)
Iinuma K
2011-10-01
Full Text Available Katsuhiro Iinuma1, Norihisa Noguchi2, Hidemasa Nakaminami2, Masanori Sasatsu2, Setsuko Nishijima3, Isami Tsuboi1 1BML General Laboratory, Matoba, Kawagoe, Saitama, 2Department of Microbiology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, Tokyo, 3Department of Dermatology, Nishijima Skin Clinic, Osaka, Japan Purpose: The in vitro antimicrobial activity of ascorbic acid derivatives against Propionibacterium acnes was tested either alone or in combination with a variety of antimicrobial agents, and their fractional inhibitory concentration index was determined using checkerboard tests. The antimicrobial effectiveness of zinc ascorbate in the treatment of acne vulgaris, either alone or in combination with antibiotics such as clindamycin that are commonly used in Japan for the treatment of acne vulgaris, was therefore examined. Materials and methods: The antimicrobial susceptibility of 41 strains of clindamycin-sensitive and/or clindamycin-resistant P. acnes isolated from acne vulgaris patients was tested, in comparison with a type strain of P. acnes. Results: Zinc ascorbate showed antimicrobial activity against a type strain of P. acnes and its concentration (0.064% was sufficiently lower than the normal dose (5% of other ascorbic acid derivatives. Combinations of zinc ascorbate with clindamycin, erythromycin, and chloramphenicol showed an additive effect, and zinc ascorbate alone effectively inhibited the growth of all P. acnes including clindamycin-resistant strains. Conclusion: The results provide novel evidence that the combination of zinc ascorbate and clindamycin is effective for acne vulgaris treatment. Keywords: antimicrobial susceptibility, ascorbic acid derivatives, combination therapy, checkerboard test
Luque, L.; Orr, V.C.A.; Chen, S.; Westerhof, Roel Johannes Maria; Oudenhoven, Stijn; van Rossum, G.; Kersten, Sascha R.A.; Berruti, F.; Rehmann, L.
2016-01-01
This study evaluated the suitability of pinewood pyrolysates as a carbon source for lipid production and cultivation of the oleaginous yeast Rhodosporidium diobovatum and the microalgae Chlorella vulgaris. Thermal decomposition of pinewood and fractional condensation were used to obtain an oil rich
Subcellular Localization of Cadmium in Chlorella vulgaris Beijerinck Strain Bt-09
Directory of Open Access Journals (Sweden)
P.B. Lintongan
2004-06-01
Full Text Available Growth response curves of Chlorella vulgaris Beijerinck strain Bt-09 to sublethal concentrations of cadmium were evaluated. The growth responses of this microalgal isolate was determined through analysis of chlorophyll a levels. Cadmium was effectively taken up by the cells as determined by Flame Atomic Absorption Spectrophotometry (F-AAS. Subcellular fractionation was undertaken to locate sites that accumulate cadmium.
Mild disintegration of the green microalgae Chlorella vulgaris using bead milling
Postma, P.R.; Miron, T.L.; Olivieri, G.; Barbosa, M.J.; Wijffels, R.H.; Eppink, M.H.M.
2015-01-01
In this work, the mild disintegration of the microalgae Chlorella vulgaris for the release of intracellular products has been studied. By means of bead milling the microalgae suspensions were successfully disintegrated at different biomass concentrations (25–145 gDW kg-1) over a range of agitator
Genetic diversity analysis with ISSR PCR on green algae Chlorella vulgaris and Chlorella pyrenoidosa
Shen, Songdong
2008-11-01
In the present study, genetic polymorphism and diversity in unicellular clones of Chlorella vulgaris Beijerinck and Chlorella pyrenoidosa Chick were studied with Inter Simple Sequence Repeats PCR (ISSR PCR). Samples including four clones of C. vulgaris and three clones of C. pyrenoidosa were purified by single-clone-choice method. For four C. vulgaris unicellular clones, the total number of the bands scored for 18 primers was 298; and the number of the polymorphic bands was 118, of which 39.6% were polymorphic. The size of PCR products ranged from 200 to 2 500 bp. The total number of bands scored for 18 primers, the number of polymorphic bands and the percentage of three C. pyrenoidosa unicellular clones was 194.83 and 30.8%, respectively. POPGENE analysis show that the average Nei genetic diversity (h*) and Shannon index of diversity (I*) in the four C. vulgaris unicellular clones was 0.2181 and 0.3208, respectively, which is slightly higher than those of the three C. pyrenoidosa unicellular clones (0.190 3 and 0.274 8), which agreed with the percentage of polymorphic bands in the mixed samples of the two species. The results suggest that ISSR is a useful method to Chlorella for intraspecies genetic analysis.
Lam, 't Gerard; Postma, P.R.; Fernandes, D.A.; Timmermans, R.A.H.; Vermuë, M.H.; Barbosa, M.J.; Eppink, M.H.; Wijffels, R.H.; Olivieri, G.
2017-01-01
Pulsed Electric Field (PEF) is currently discussed as promising technology for mild and scalable cell disintegration of microalgae. In this study Chlorella vulgaris and Neochloris oleoabundans have been subjected to batch and continuous PEF treatments under a wide range of operating conditions
The Use of Chlorella Vulgaris in a Simple Demonstration of Heavy Metal Toxicity.
Gipps, J. F.; Biro, P.
1978-01-01
An experimental system, suitable for secondary schools, uses Chlorella vulgaris to demonstrate the effects of mercury and cadmium. Very low concentrations of mercury or cadmium decrease growth, whereas lead or arsenic have little effect. Further experiments show additive interactions between mercury and cadmium and antagonistic interactions…
Hou, Qingjie; Pei, Haiyan; Hu, Wenrong; Jiang, Liqun; Yu, Ze
2016-03-01
Food waste contains large amount of organic matter that may be troublesome for handing, storage and transportation. A microbial fuel cell (MFC) was successfully constructed with different inoculum densities of Chlorella vulgaris for promoting food waste treatment. Maximum COD removal efficiency was registered with 44% and 25 g CODL(-1)d(-1) of substrate degradation rate when inoculated with the optimal initial density (150 mg L(-1)) of C. vulgaris, which were 2.9 times and 3.1 times higher than that of the abiotic cathode. With the optimum inoculum density of C. vulgaris, the highest open circuit voltage, working voltage and power density of MFC were 260 mV, 170 mV and 19151 mW m(-3), respectively. Besides the high biodiesel quality, promoted by MFC stimulation the biomass productivity and highest total lipid content of C. vulgaris were 207 mg L(-1)d(-1) and 31%, which were roughly 2.7 times and 1.2 times higher than the control group. Copyright © 2015 Elsevier Ltd. All rights reserved.
Effect of Ethephon as an Ethylene-Releasing Compound on the Metabolic Profile of Chlorella vulgaris.
Kim, So-Hyun; Lim, Sa Rang; Hong, Seong-Joo; Cho, Byung-Kwan; Lee, Hookeun; Lee, Choul-Gyun; Choi, Hyung-Kyoon
2016-06-15
In this study, Chlorella vulgaris (C. vulgaris) was treated with ethephon at low (50 μM) and high (200 μM) concentrations in medium and harvested at 0, 7, and 14 days, respectively. The presence of ethephon led to significant metabolic changes in C. vulgaris, with significantly higher levels of α-tocopherol, γ-aminobutyric acid (GABA), asparagine, and proline, but lower levels of glycine, citrate, and galactose relative to control. Ethephon induced increases in saturated fatty acids but decreases in unsaturated fatty acids. The levels of highly saturated sulfoquinovosyldiacylglycerol species and palmitic acid bound phospholipids were increased on day 7 of ethephon treatment. Among the metabolites, the productivities of α-tocopherol (0.70 μg/L/day) and GABA (1.90 μg/L/day) were highest for 50 and 200 μM ethephon on day 7, respectively. We propose that ethephon treatment involves various metabolic processes in C. vulgaris and can be an efficient way to enrich the contents of α-tocopherol and GABA.
Wang, Lu; Chen, Xiu-rong; Yan, Long; He, Yi-xuan; Shi, Zhen-dong
2015-04-01
Using different rations of sludge extracts and supernate from 4-Chlorophenol (4-CP) simulated wastewater's excess sludge after centrifugation to cultivate the Chlorella vulgaris to achieve the goal of excess sludge utilization together with chlorella cultivating. The experiments were performed in 500 mL flasks with different rations of sludge extracts & BG-11 and supernate & BG-11 in a light growth chamber respectively. Number of algal cells, Chlorophyll, enzyme activity, oil and water total nitrogen (TN), total phosphorus (TP), total organic carbon (TOC), toxicity index were investigated. Result showed that the nutrition supplies and toxicity in the excess sludge were removed efficiently via Chlorella vulgaris, the removal rates of TN and TP were at least 40% and 90% respectively; After 10 days cultivation, the density growth of 50% sludge extracts was 20 times higher of the beginning while its chlorophyll content was lower than that of the blank group. Sludge extracts could promote the proliferation of algae, but were not conducive to the synthesis of chlorophyll. The quantity of SOD in per cell showed Chlorella vulgaris gave a positive response via stimulation from toxicant in sludge extracts and supernate. The best time for collecting chlorella vulgaris was the fifth day of cultivation, taking neutral oil accumulation as the evaluating indicator for its utilization combined with the removal of supplies and toxicity.
Baglieri, Andrea; Sidella, Sarah; Barone, Valeria; Fragalà, Ferdinando; Silkina, Alla; Nègre, Michèle; Gennari, Mara
2016-09-01
This work evaluates the possibility of cultivating Scenedesmus quadricauda and Chlorella vulgaris microalgae in wastewater from the hydroponic cultivation of tomatoes with the aim of purifying the water. S. quadricauda and C. vulgaris were also used in purification tests carried out on water contaminated by the following active ingredients: metalaxyl, pyrimethanil, fenhexamid, iprodione, and triclopyr. Fifty-six days after the inoculum was placed, a reduction was found in the concentration of nitric nitrogen, ammonia nitrogen, and soluble and total phosphorus. The decrease was 99, 83, 94, and 94 %, respectively, for C. vulgaris and 99, 5, 88, and 89 %, respectively, for S. quadricauda. When the microalgae were present, all the agrochemicals tested were removed more quickly from the water than from the sterile control (BG11). The increase in the rate of degradation was in the order metalaxyl > fenhexamid > iprodione > triclopyr > pyrimethanil. It was demonstrated that there was a real degradation of fenhexamid, metalaxyl, triclopyr, and iprodione, while in the case of pyrimethanil, the active ingredient removed from the substrate was absorbed onto the cells of the microalgae. It was also found that the agrochemicals used in the tests had no significant effect on the growth of the two microalgae. The experiment highlighted the possibility of using cultivations of C. vulgaris and S. quadricauda as purification systems for agricultural wastewater which contains eutrophic inorganic compounds such as nitrates and phosphates and also different types of pesticides.
Ji, Yan; Hu, Wenrong; Li, Xiuqing; Ma, Guixia; Song, Mingming; Pei, Haiyan
2014-01-01
Monosodium glutamate wastewater (MSGW) is a potential medium for microbial cultivation because of containing abundant organic nutrient. This paper seeks to evaluate the feasibility of growing Chlorella vulgaris with MSGW and assess the influence of MSGW concentration on the biomass productivity and biochemical compositions. The MSGW diluted in different concentrations was prepared for microalga cultivation. C. vulgaris growth was greatly promoted with MSGW compared with the inorganic BG11 medium. C. vulgaris obtained the maximum biomass concentration (1.02 g/L) and biomass productivity (61.47 mg/Ld) with 100-time diluted MSGW. The harvested biomass was rich in protein (36.01-50.64%) and low in lipid (13.47-25.4%) and carbohydrate (8.94-20.1%). The protein nutritional quality and unsaturated fatty acids content of algal increased significantly with diluted MSGW. These results indicated that the MSGW is a feasible alternative for mass cultivation of C. vulgaris. Copyright © 2013 Elsevier Ltd. All rights reserved.
Liu, Jing; Zhang, Xu; Tan, Tianwei
2016-10-01
In this study, the flocculation process of Chlorella vulgaris and Rhodotorula glutinis induced by inorganic salts modified montmorillonoid was conducted. The maximum flocculation efficiency (FE) of 98.50% for C. vulgaris and 11.83% for R. glutinis were obtained with 4g/L and 5g/L flocculant within the dosage scope of 1-5g/L. The difference of FE was then thermodynamically explained by the extended DLVO theory and the FE of R. glutinis was mechanically enhanced to 90.66% with 0.06g/L cationic polyacrylamide (CPAM) at an optimum pH of 9. After that, aimed to utilize the remainder flocculant capacity, C. vulgaris culture was added to the aggregation of R. glutinis. Fortunately, the coagulation of R. glutinis and C. Vulgaris was achieved with 0.05g/L CPAM and 5g/L flocculant at pH 9 and the FE reached 90.15% and 91.24%, respectively. Copyright © 2016 Elsevier Ltd. All rights reserved.
Wound Healing in a Patient with Psoriasis Vulgaris and Femur Megaprosthesis Implantation
Directory of Open Access Journals (Sweden)
Markus Nottrott
2008-01-01
Full Text Available Extraskeletal mesenchymal chondrosarcoma is extremely rare and, in combination with psoriasis, it has never been described before. We report a case of wide resection of an extraskeletal chondrosarcoma of the thigh and reconstruction with a femoral megaprosthesis in a patient with psoriasis vulgaris. Special emphasis has been laid to postoperative wound healing in psoriatic skin which did not show any problems.
Resistances to an insect herbivore and a phytopathogen in Barbarea vulgaris
DEFF Research Database (Denmark)
Christensen, Stina
The crucifer Barbarea vulgaris grows naturally in Europe and Western Asia. In Denmark and neighbouring countries, the subspecies arcuata exists in two types that differ in insect and pathogen resistance, as well as in several other traits. The types have been named after the degree of leaf pubesc...
Ulcerated lupus vulgaris at the site of Bacille Calmette-Guérin vaccination.
Singal, Archana; Sonthalia, Sidharth; Pandhi, Deepika
2013-01-01
We report a case of ulcerated lupus vulgaris occurring in 1.5-year-old boy at the Bacille Calmette-Guérin vaccination site within 6 months, which was diagnosed using histology and polymerase chain reaction. The lesion resolved with isoniazid and rifampicin therapy. © 2011 Wiley Periodicals, Inc.
Lupus vulgaris of external nose with septal perforation--a rarity in antibiotic era.
Garg, Ajay; Wadhera, Raman; Gulati, S P; Singh, Jagjit
2010-07-01
Lupus vulgaris (LV) is the commonest morphological variant of cutaneous tuberculosis. Case of LV of external nose extending to internal nose causing septal perforation is documented here. Histopathology of biopsy taken confirmed the diagnosis of LV. Patient responded well to Anti-tubercular therapy (ATT).
Lupus vulgaris diagnosed after 37 years: a case of delayed diagnosis.
Turan, Enver; Yurt, Nurdan; Yesilova, Yavuz; Celik, Ozgur Ilhan
2012-05-15
Lupus vulgaris is the most common chronic, progressive form of cutaneous tuberculosis. Lesions are generally solitary and found on the head and neck region. Cutaneous tuberculosis can present with different clinical appearances. Therefore, it does not necessarily have characteristic findings and can be difficult to diagnose. Although there were typical clinical findings, the diagnosis of our case was delayed because of its asymptomatic course.
Directory of Open Access Journals (Sweden)
Hong-Wen Sun
2014-01-01
Full Text Available Nonylphenol polyethoxylates (NPnEOs, a major class of nonionic surfactants, can easily enter into aquatic environments through various pathways due to their wide applications, which leads to the extensive existence of their relative stable metabolites, namely nonylphenol (NP and mono- to tri-ethoxylates. This study investigated the bioconcentration and degradation of NP and NPnEO oligomers (n = 1–12 by a green algae, Chlorella vulgaris. Experimental results showed that C. vulgaris can remove NP from water phase efficiently, and bioconcentration and degradation accounted for approximately half of its loss, respectively, with a 48 h BCF (bioconcentration factor of 2.42 × 103. Moreover, C. vulgaris could concentrate and degrade NPnEOs, distribution profiles of the series homologues of the NPnEOs in algae and water phase were quite different from the initial homologue profile. The 48 h BCF of the NPnEO homologues increased with the length of the EO chain. Degradation extent of total NPnEOs by C. vulgaris was 95.7%, and only 1.1% remained in water phase, and the other 3.2% remained in the algal cells. The algae removed the NPnEOs mainly through degradation. Due to rapid degradation, concentrations of the long chain NPnEO homologous in both water (n ≥ 2 and the algal phase (n ≥ 5 was quite low at the end of a 48 h experiment.
Soil-borne microorganisms and soil-type affect pyrrolizidine alkaloids in Jacobaea vulgaris
Joosten, L.; Mulder, P.P.J.; Klinkhamer, P.G.L.; Veen, van J.A.
2009-01-01
Secondary metabolites like pyrrolizidine alkaloids (PAs) play a crucial part in plant defense. We studied the effects of soil-borne microorganisms and soil-type on pyrrolizidine alkaloids in roots and shoots of Jacobaea vulgaris. We used clones of two genotypes from a dune area (Meijendel),
PvRbohB negatively regulates Rhizophagus irregularis colonization in Phaseolus vulgaris.
Arthikala, Manoj-Kumar; Montiel, Jesús; Nava, Noreide; Santana, Olivia; Sánchez-López, Rosana; Cárdenas, Luis; Quinto, Carmen
2013-08-01
Plant NADPH oxidases (RBOHs) regulate the early stages of rhizobial infection in Phaseolus vulgaris and affect nodule function in Medicago truncatula. In contrast, the role of RBOHs in the plant-arbuscular mycorrhizal (AM) symbiosis and in the regulation of reactive oxygen species (ROS) production during the establishment of the AM interaction is largely unknown. In this study, we assessed the role of P. vulgaris Rboh (PvRbohB) during the symbiosis with the AM fungus, Rhizophagus irregularis. Our results indicate that the PvRbohB transcript is significantly up-regulated in the mycorrhized roots of P. vulgaris. Further, the PvRbohB promoter was found to be active during the invasion of R. irregularis. Down-regulation of PvRbohB transcription by RNAi (RNA interference) silencing resulted in diminished ROS levels in the transgenic mycorrhized roots and induced early hyphal root colonization. Interestingly, the size of appressoria increased in PvRbohB-RNAi roots (760 ± 70.1 µm) relative to controls (251 ± 73.2 µm). Finally, the overall level of mycorrhizal colonization significantly increased in PvRbohB-RNAi roots [48.1 ± 3.3% root length colonization (RLC)] compared with controls (29.4 ± 1.9% RLC). We propose that PvRbohB negatively regulates AM colonization in P. vulgaris.
Fungal endophytes in germinated seeds of the common bean, Phaseolus vulgaris
The common bean (Phaseolus vulgaris) is the most important food legume in the world, but its production is severely limited by several biotic and abiotic stressors. In search of a sustainable solution to this problem, we conducted a survey of fungal endophytes in 582 germinated seeds belonging to 11...
Major genes for resistance to beet necrotic yellow vein virus (BNYVV) in Beta vulgaris
Scholten, Olga E.; Jansen, Ritsert C.; Keizer, L.C. Paul; Bock, Theo S.M. de; Lange, Wouter
1996-01-01
Inheritance of resistance to beet necrotic yellow vein virus (BNYVV) was studied in segregating F2 and backcross families obtained from crosses between resistant plants of the sugar beet selection Holly-1-4 or the wild beet accession Beta vulgaris subsp. maritima WB42 and susceptible parents.
Directory of Open Access Journals (Sweden)
Reza Ghaderi
2013-11-01
Conclusion: The results indicate that frequencies of various dermatoglyphic patterns differ in atopic eczema, acne vulgaris and vitiligo from that of normal population. Perhaps this difference can be used as a diagnostic biological marker to screen for those susceptible to these dermatoses.
A greenhouse test for screening sugar beet (Beta vulgaris) for resistance to Rhizoctonia solani
Scholten, O.E.; Panella, L.; Bock, de T.S.M.; Lange, W.
2001-01-01
Rhizoctonia solani Kühn is a serious plant pathogenic fungus, causing various types of damage to sugar beet (Beta vulgaris L.). In Europe, the disease is spreading and becoming a threat for the growing of this crop. Plant resistance seems to be the most practical and economical way to control the
Pre-emergence Damping Off of Beta vulgaris by Rhizopus stolonifer
Rhizopus stolonifer (Rs), a cool temperature zygomycete that can cause a post-harvest rot on sugarbeet (Beta vulgaris), also causes pre-emergence damping off in other crops. We are interested in its potential pre-emergence damping off activity in sugarbeet. Sugarbeets are quite susceptible to seedli...
THE ACTION OF UV RADIATION ON MITOTIC INDEX AND MITOTIC DIVISION PHASES AT PHASEOLUS VULGARIS L
Directory of Open Access Journals (Sweden)
Csilla Iuliana Bara
2005-08-01
Full Text Available In this work, damaging effects of UV radiations on bean Phaseolus vulgaris L. plantule root tips were investigated. Our study proves that by bean plants, the decrease of cell division frequency appears to be part of protection mechanism against especially the short waved UV radiation, with variations depending on cultivar.
DEFF Research Database (Denmark)
Nielsen, M. K.; Jacobsen, Stine; Olsen, Susanne Nautrup
2016-01-01
inoculations of parasite-naïve foals, and it remains unknown to what extent the parasite is associated with different types of colic. Objectives: To evaluate the role of S. vulgaris as a risk factor for different types of colic in horses. Study design: A retrospective case–control study among horses referred...
Inhibition of HIV-1 infection by aqueous extracts of Prunella vulgaris L
The mint family produces many metabolites with medicinal properties. Several species are reported to have antiviral activity, including lemon balm, peppermint, hyssop, basil, sage and self-heal. To further characterize the anti-lentiviral activity of self-heal (Prunella vulgaris), we tested water an...
Green Tea and Other Tea Polyphenols: Effects on Sebum Production and Acne Vulgaris.
Saric, Suzana; Notay, Manisha; Sivamani, Raja K
2016-12-29
Polyphenols are antioxidant molecules found in many foods including nuts, fruits, vegetables, chocolate, wine, and tea. Polyphenols have antimicrobial, anti-inflammatory, and antineoplastic properties. Recent studies suggest that tea polyphenols may be used for reducing sebum production in the skin and for treatment of acne vulgaris. This review examines the evidence for use of topically and orally ingested tea polyphenols against sebum production and for acne treatment and prevention. The PubMed database was searched for studies on tea polyphenols, sebum secretion, and acne vulgaris. Of the 59 studies found, eight met the inclusion criteria. Two studies evaluated tea polyphenol effects on sebum production; six studies examined tea polyphenol effects on acne vulgaris. Seven studies evaluated topical tea polyphenols; one study examined systemic tea polyphenols. None of the studies evaluated both topical and systemic tea polyphenols. Tea polyphenol sources included green tea (six studies) and tea, type not specified (two studies). Overall, there is some evidence that tea polyphenols in topical formulation may be beneficial in reducing sebum secretion and in treatment of acne. Research studies of high quality and with large sample sizes are needed to assess the efficacy of tea polyphenols in topical and oral prevention of acne vulgaris and lipid synthesis by the sebaceous glands.
Isolation and Structure Elucidation of Radical Scavengers from Thymus vulgaris Leaves
Dapkevicius, A.; Beek, van T.A.; Lelyveld, G.P.; Veldhuizen, van A.; Groot, de Æ.; Linssen, J.P.H.; Venskutonis, R.
2002-01-01
2,2-Diphenyl-1-picrylhydrazyl radical (DPPH*) scavenging activity-guided fractionation of a leaf extract of Thymus vulgaris led to the isolation of the radical scavengers rosmarinic acid 1, eriodictyol, taxifolin, luteolin 7-glucuronide, p-cymene 2,3-diol, p-cymene 2,3-diol 6-6'-dimer, carvacrol,
Severity and impact of acne vulgaris on the quality of life of adolescents in Nigeria
Directory of Open Access Journals (Sweden)
Ogedegbe EE
2014-12-01
Full Text Available Evelyn E Ogedegbe,1 Eshan B Henshaw2 1Cedarcrest Hospital, Abuja, Federal Capital Territory, Nigeria; 2Department of Medicine, Faculty of Medicine and Dentistry, University of Calabar, Cross River State, Nigeria Background: Acne vulgaris is a common skin condition, which affects most adolescents at some point in their lives. It has been found to have a significant impact on their psychological well-being and has been associated with depression and suicide ideation. Many studies have assessed the impact of acne vulgaris on the quality of life (QoL in different population subgroups around the world, but there is a dearth of reports from the African subcontinent. This study thus seeks to assess the severity of acne vulgaris and determine its effect on the QoL of adolescents in Lagos, Nigeria. Methods: In a cross-sectional survey employing a two-stage sampling method, the severity of acne vulgaris and its impact on the QoL of adolescents attending a senior secondary school in Lagos, Nigeria was assessed using the Global Acne Grading Scale (GAGS and the Cardiff Acne Disability Index (CADI, respectively. The correlation between the results of the GAGS and CADI was also determined. Results: One hundred and sixty adolescent students with acne were recruited, with males accounting for 51.9% and females 48.1%. The mean and standard deviation of the GAGS severity scores were 11.3±5.4 for males and 11.9±5.4 for females. Only one student had severe acne vulgaris (GAGS, 31–38, 10% moderate (GAGS, 19–30, and 89.4% mild (GAGS, 1–18. The overall CADI score was 3.4±3.0, which suggests mild impairment in QoL; however, the solitary student with severe acne had severe QoL impairment. There was a weak positive correlation between the GAGS and the CADI score. Conclusion: Most adolescents in our study had mild acne vulgaris, and the overall impact on their QoL was mild. However, the correlation between the psychosocial impact and acne severity was weak. There
Directory of Open Access Journals (Sweden)
Pablo García-Fernández
2017-05-01
Full Text Available The common octopus, Octopus vulgaris, is a good candidate for aquaculture but a sustainable production is still unviable due to an almost total mortality during the paralarvae stage. DNA methylation regulates gene expression in the eukaryotic genome, and has been shown to exhibit plasticity throughout O. vulgaris life cycle, changing profiles from paralarvae to adult stages. This pattern of methylation could be sensitive to small alterations in nutritional and environmental conditions during the species early development, thus impacting on its health, growth and survival. In this sense, a full understanding of the epigenetic mechanisms operating during O. vulgaris development would contribute to optimizing the culture conditions for this species. Paralarvae of O. vulgaris were cultured over 28 days post-hatching (dph using two different Artemia sp. based diets: control and a long chain polyunsaturated fatty acids (LC-PUFA enriched diet. The effect of the diets on the paralarvae DNA global methylation was analyzed by Methyl-Sensitive Amplification Polymorphism (MSAP and global 5-methylcytosine enzyme-linked immunosorbent assay (ELISA approaches. The analysis of different methylation states over the time revealed a global demethylation phenomena occurring along O. vulgaris early development being directly driven by the age of the paralarvae. A gradual decline in methylated loci (hemimethylated, internal cytosine methylated, and hypermethylated parallel to a progressive gain in non-methylated (NMT loci toward the later sampling points was verified regardless of the diet provided and demonstrate a pre-established and well-defined demethylation program during its early development, involving a 20% of the MSAP loci. In addition, a differential behavior between diets was also observed at 20 dph, with a LC-PUFA supplementation effect over the methylation profiles. The present results show significant differences on the paralarvae methylation profiles
García-Fernández, Pablo; García-Souto, Danie; Almansa, Eduardo; Morán, Paloma; Gestal, Camino
2017-01-01
The common octopus, Octopus vulgaris, is a good candidate for aquaculture but a sustainable production is still unviable due to an almost total mortality during the paralarvae stage. DNA methylation regulates gene expression in the eukaryotic genome, and has been shown to exhibit plasticity throughout O. vulgaris life cycle, changing profiles from paralarvae to adult stages. This pattern of methylation could be sensitive to small alterations in nutritional and environmental conditions during the species early development, thus impacting on its health, growth and survival. In this sense, a full understanding of the epigenetic mechanisms operating during O. vulgaris development would contribute to optimizing the culture conditions for this species. Paralarvae of O. vulgaris were cultured over 28 days post-hatching (dph) using two different Artemia sp. based diets: control and a long chain polyunsaturated fatty acids (LC-PUFA) enriched diet. The effect of the diets on the paralarvae DNA global methylation was analyzed by Methyl-Sensitive Amplification Polymorphism (MSAP) and global 5-methylcytosine enzyme-linked immunosorbent assay (ELISA) approaches. The analysis of different methylation states over the time revealed a global demethylation phenomena occurring along O. vulgaris early development being directly driven by the age of the paralarvae. A gradual decline in methylated loci (hemimethylated, internal cytosine methylated, and hypermethylated) parallel to a progressive gain in non-methylated (NMT) loci toward the later sampling points was verified regardless of the diet provided and demonstrate a pre-established and well-defined demethylation program during its early development, involving a 20% of the MSAP loci. In addition, a differential behavior between diets was also observed at 20 dph, with a LC-PUFA supplementation effect over the methylation profiles. The present results show significant differences on the paralarvae methylation profiles during its
Decrease in glutathione may be involved in pathogenesis of acne vulgaris.
Ikeno, Hiroshi; Tochio, Takumi; Tanaka, Hiroshi; Nakata, Satoru
2011-09-01
Some past studies reported that oxidative stress components such as reactive oxygen species (ROS) or lipid peroxide (LPO) are involved in the pathogenesis and progression of acne vulgaris. In this study, we hypothesized that the pathogenesis of acne vulgaris may depend on the differences in antioxidative activity among antioxidants in our body. We collected samples of stratum corneum from acne patients and healthy subjects and compared the quantity of gluthathione (GSH), one of many antioxidative components in our body, for comparison. Samples of stratum corneum were collected from facial acne-involved lesion, facial uninvolved area, and the medial side of the upper arm in acne vulgaris patients. Similarly, samples were collected from a facial uninvolved area and the medial side of the upper arm in healthy subjects. The quantity of GSH was measured in each area. In vitro effects of alpha-melanocyte stimulating hormone (α-MSH) on GSH synthesis-related gene were also examined. The quantity of GSH in stratum corneum from each area was significantly lower in acne vulgaris patients than that of healthy subjects. There was no significant difference in quantity of GSH between the acne-involved lesion and uninvolved area in acne patients. In vitro studies showed that the expression level of Glutamate-cysteine ligase catalytic subunit (GCLC), one of the GSH synthesis-related genes, was significantly decreased by the additional use of α-MSH. We conclude that a decline in antioxidative activity led by a decrease in GSH quantity may play an important role in pathogenesis of acne vulgaris. The use of α-MSH may further decrease the GSH level. © 2011 Wiley Periodicals, Inc.
Salmalian, Hajar; Saghebi, Roshanak; Moghadamnia, Ali Akbar; Bijani, Ali; Faramarzi, Mahbobeh; Nasiri Amiri, Fatemeh; Bakouei, Fatemeh; Behmanesh, Fereshte; Bekhradi, Reza
2014-01-01
Background: Dysmenorrhea is one of the most common medical problems in gynecology causing several problems in the personal and social life of women. This study was conducted to compare the effect of thymus vulgaris and ibuprofen on the treatment of primary dysmenorrhea Methods: This clinical study was conducted on 84 students of Babol University of Medical Sciences with primary dysmenorrhea. The students were randomly assigned to three groups receiving thymus vulgaris, ibuprofen and placebo. In all three groups, with the beginning of pain, 200 mg capsules and 25 drops of essential oil were given every 6 hours for two consecutive cycles. Pain intensity used the visual scale before and one hour after each dose for 48 hour after starting medication. The data were collected and analyzed. This study was registered in the Iranian Registry of Clinical Trial (www.irct.ir) with registration number ID: IRCT201101245683N1 Results: The mean age of participants was 20.5±1.8 years. Both thymus vulgaris and ibuprofen were effective to reduce the pain severity of dysmenorrhea. Before treatment, the mean pain intensity in thymus vulgaris, ibuprofen and placebo groups were 6.57±2.02, 5.30±2.23 and 6.18±1.78, respectively and after treatment decreased to 1.21±1.06, 1.48±1.62 and 3.54±2.26, respectively. Reduction of pain severity was not statistically significant between the two medications, however it was significant for each drug compared with placebo (pthymus vulgaris as well as ibuprofen can be effective in reducing the severity of pain and spasm in primary dysmenorrhea. PMID:24778782
Identification and characterization of microRNAs in Phaseolus vulgaris by high-throughput sequencing
2012-01-01
Background MicroRNAs (miRNAs) are endogenously encoded small RNAs that post-transcriptionally regulate gene expression. MiRNAs play essential roles in almost all plant biological processes. Currently, few miRNAs have been identified in the model food legume Phaseolus vulgaris (common bean). Recent advances in next generation sequencing technologies have allowed the identification of conserved and novel miRNAs in many plant species. Here, we used Illumina's sequencing by synthesis (SBS) technology to identify and characterize the miRNA population of Phaseolus vulgaris. Results Small RNA libraries were generated from roots, flowers, leaves, and seedlings of P. vulgaris. Based on similarity to previously reported plant miRNAs,114 miRNAs belonging to 33 conserved miRNA families were identified. Stem-loop precursors and target gene sequences for several conserved common bean miRNAs were determined from publicly available databases. Less conserved miRNA families and species-specific common bean miRNA isoforms were also characterized. Moreover, novel miRNAs based on the small RNAs were found and their potential precursors were predicted. In addition, new target candidates for novel and conserved miRNAs were proposed. Finally, we studied organ-specific miRNA family expression levels through miRNA read frequencies. Conclusions This work represents the first massive-scale RNA sequencing study performed in Phaseolus vulgaris to identify and characterize its miRNA population. It significantly increases the number of miRNAs, precursors, and targets identified in this agronomically important species. The miRNA expression analysis provides a foundation for understanding common bean miRNA organ-specific expression patterns. The present study offers an expanded picture of P. vulgaris miRNAs in relation to those of other legumes. PMID:22394504