Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu
2009-01-01
Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593
Genetic Analysis of Recombinant Inbred Lines for Sorghum bicolor ? Sorghum propinquum
Kong, Wenqian; Jin, Huizhe; Franks, Cleve D.; Kim, Changsoo; Bandopadhyay, Rajib; Rana, Mukesh K.; Auckland, Susan A.; Goff, Valorie H.; Rainville, Lisa K.; Burow, Gloria B.; Woodfin, Charles; Burke, John J.; Paterson, Andrew H.
2013-01-01
We describe a recombinant inbred line (RIL) population of 161 F5 genotypes for the widest euploid cross that can be made to cultivated sorghum (Sorghum bicolor) using conventional techniques, S. bicolor ? Sorghum propinquum, that segregates for many traits related to plant architecture, growth and development, reproduction, and life history. The genetic map of the S. bicolor ? S. propinquum RILs contains 141 loci on 10 linkage groups collectively spanning 773.1 cM. Although the genetic map ha...
Transgenic sorghum ( Sorghum bicolor L. Moench) developed by ...
African Journals Online (AJOL)
Sorghum (Sorghum bicolor (L.) Moench) is an important food and fodder crop. Fungal diseases such as anthracnose caused by Colletotrichum sublineolum reduce sorghum yields. Genetic transformation can be used to confer tolerance to plant diseases such as anthracnose. The tolerance can be developed by introducing ...
(Arachis hypogaea) and Sorghum (Sorghum bicolor)
African Journals Online (AJOL)
ADOWIE PERE
as enzyme activities of Arachis hypogaea and Sorghum bicolor in crude oil contaminated soil. Crude oil ... Treatments without crude oil were ... replicates were made for each treatment. .... dead sections of leaf margins, burning and stunted or.
African Journals Online (AJOL)
sunny
2014-11-12
Nov 12, 2014 ... Biomass materials require reduction and densification for the purpose of handling and space requirements. Guinea corn (Sorghum bi-color) is a major source of biomass material in the tropic regions. The densification process involves some ... a closed-end die, the temperature and the use of binder.
In planta transformation of sorghum (Sorghum bicolor (L.) Moench)
Indian Academy of Sciences (India)
An in planta transformation protocol for sorghum (Sorghum bicolor (L.) Moench) using shoot apical meristem of germinating seedlings is reported in this study. Agrobacterium tumefaciens strain, LBA4404 with pCAMBIA1303 vector and construct pCAMBIA1303TPS1 were individually used for transformation. Since, the ...
Genetic analysis of recombinant inbred lines for Sorghum bicolor × Sorghum propinquum.
Kong, Wenqian; Jin, Huizhe; Franks, Cleve D; Kim, Changsoo; Bandopadhyay, Rajib; Rana, Mukesh K; Auckland, Susan A; Goff, Valorie H; Rainville, Lisa K; Burow, Gloria B; Woodfin, Charles; Burke, John J; Paterson, Andrew H
2013-01-01
We describe a recombinant inbred line (RIL) population of 161 F5 genotypes for the widest euploid cross that can be made to cultivated sorghum (Sorghum bicolor) using conventional techniques, S. bicolor × Sorghum propinquum, that segregates for many traits related to plant architecture, growth and development, reproduction, and life history. The genetic map of the S. bicolor × S. propinquum RILs contains 141 loci on 10 linkage groups collectively spanning 773.1 cM. Although the genetic map has DNA marker density well-suited to quantitative trait loci mapping and samples most of the genome, our previous observations that sorghum pericentromeric heterochromatin is recalcitrant to recombination is highlighted by the finding that the vast majority of recombination in sorghum is concentrated in small regions of euchromatin that are distal to most chromosomes. The advancement of the RIL population in an environment to which the S. bicolor parent was well adapted (indeed bred for) but the S. propinquum parent was not largely eliminated an allele for short-day flowering that confounded many other traits, for example, permitting us to map new quantitative trait loci for flowering that previously eluded detection. Additional recombination that has accrued in the development of this RIL population also may have improved resolution of apices of heterozygote excess, accounting for their greater abundance in the F5 than the F2 generation. The S. bicolor × S. propinquum RIL population offers advantages over early-generation populations that will shed new light on genetic, environmental, and physiological/biochemical factors that regulate plant growth and development.
Identification of differentially expressed genes in sorghum (Sorghum bicolor) brown midrib mutants
Sorghum (Sorghum bicolor L.), with a high biomass yield and excellent tolerance to drought and low nutrition, has been recommended as one of the most competitive bioenergy crops. Brown midrib (bmr) mutant sorghum with reduced lignin content showed a high potential for the improvement of bioethanol ...
Analysis of aluminium sensitivity in sorghum (Sorghum bicolor (L.) Moench) genotypes
Tan, K.
1993-01-01
Twelve genotypes of sorghum ( Sorghum bicolor (L.) Moench) differing in Al sensitivity were grown in an acid soil (with additions of lime or MgSO 4 ) and in nutrient solutions (with or without Al at constant pH) for periods between 14 and 35 days.
Radioinduced variation in genetic improvement of sorghum (Sorghum bicolor (l.). Moench)
International Nuclear Information System (INIS)
Gutierrez del Rio, E.
1984-01-01
A genetic variability study among 25 varieties of sorghum (Sorghum bicolor (L.) Moench) is presented. The populations are irradiated with 0, 10, 20, 30, 40, 50 and 60 Krads of cobalt 60 as far as M 5 generation. An individual selection is done taking into consideration agronomic characteristics like precocity, type, size. height of the plant. (M.A.C.) [pt
Ast, van A.
2006-01-01
Keywords: Striga hermonthica , Sorghum bicolor , infection time, infection level, tolerance.This thesis presents the results of a study on the interaction between the parasitic weed Strigahermonthica (Del.) Benth. and sorghum ( Sorghum bicolor [L.] Moench). The main objective of the study was
Mutant lines of sorghum with low levels of lignin are potentially useful for bioenergy production, but may have problems with insects or disease. Field grown normal and low lignin bmr6 and bmr12 sorghum (Sorghum bicolor) were examined for insect and disease damage in the field, and insect damage in ...
Attention is currently focused on developing sustainable supply chains of sugar feedstocks for new, flexible biorefineries. Fundamental processing needs identified by industry for the large-scale manufacture of biofuels and bioproducts from sweet sorghum (Sorghum bicolor L. Moench) include stabiliz...
Cs phytoremediation by Sorghum bicolor cultivated in soil and in hydroponic system.
Wang, Xu; Chen, Can; Wang, Jianlong
2017-04-03
Cs accumulation characteristics by Sorghum bicolor were investigated in hydroponic system (Cs level at 50-1000 μmol/L) and in soil (Cs-spiked concentration was 100 and 400 mg/kg soil). Two varieties of S. bicolor Cowly and Nengsi 2# grown on pot soil during the entire growth period (100 days) did not show significant differences on the height, dry weight (DW), and Cs accumulation. S. bicolor showed the potential phytoextraction ability for Cs-contaminated soil with the bioaccumulation factor (BCF) and the translocation factor (TF) values usually higher than 1 in soil system and in hydroponic system. The aerial parts of S. bicolor contributed to 86-92% of the total removed amounts of Cs from soil. Cs level in solution at 100 μmol/L gave the highest BCF and TF values of S. bicolor. Cs at low level tended to transfer to the aerial parts, whereas Cs at high level decreased the transfer ratio from root to shoot. In soil, the plant grew well when Cs spiked level was 100 mg/kg soil, but was inhibited by Cs at 400 mg/kg soil with Cs content in sorghum reaching 1147 mg/kg (roots), 2473 mg/kg (stems), and 2939 mg/kg (leaves). In hydroponic system, average Cs level in sorghum reached 5270 mg/kg (roots) and 4513 mg/kg (aerial parts), without significant damages to its biomass at 30 days after starting Cs treatment. Cs accumulation in sorghum tissues was positively correlated with the metal concentration in medium.
Ethanol production from Sorghum bicolor using both separate and ...
African Journals Online (AJOL)
STORAGESEVER
2009-06-17
Jun 17, 2009 ... pre-treatment, enzymatic saccharification, detoxification of inhibitors and fermentation of Sorghum bicolor straw for ethanol production ..... The authors wish to acknowledge financial support from ... Official energy statistics from.
Evaluation of Sorghum bicolor leaf base extract for gastrointestinal ...
African Journals Online (AJOL)
PRECIOUS
2009-11-02
Nov 2, 2009 ... Key words: Sorghum bicolor, gastrointestinal, motility, diarrhoea, jejunum, ileum, fundus. INTRODUCTION ..... the propulsive movement of charcoal meal through the .... A delay in gastric emptying will prevent speedy evacua-.
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Sorghum bicolor 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum bicolor
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Sorghum vulgare 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum vulgare
De novo transcriptome assembly of Sorghum bicolor variety Taejin
Directory of Open Access Journals (Sweden)
Yeonhwa Jo
2016-06-01
Full Text Available Sorghum (Sorghum bicolor, also known as great millet, is one of the most popular cultivated grass species in the world. Sorghum is frequently consumed as food for humans and animals as well as used for ethanol production. In this study, we conducted de novo transcriptome assembly for sorghum variety Taejin by next-generation sequencing, obtaining 8.748 GB of raw data. The raw data in this study can be available in NCBI SRA database with accession number of SRX1715644. Using the Trinity program, we identified 222,161 transcripts from sorghum variety Taejin. We further predicted coding regions within the assembled transcripts by the TransDecoder program, resulting in a total of 148,531 proteins. We carried out BLASTP against the Swiss-Prot protein sequence database to annotate the functions of the identified proteins. To our knowledge, this is the first transcriptome data for a sorghum variety derived from Korea, and it can be usefully applied to the generation of genetic markers.
International Nuclear Information System (INIS)
Bacaha, N.; Shamas, R.; Bakht, J.; Rafi, A.; Farhatullah, M.; Gillani, S.
2015-01-01
Pot experiment was conducted to evaluate the phyto-extraction capacity of heavy metals by Sorghum. Sorghum bicolor was grown in soil artificially contaminated with different concentrations of lead (300, 350 and 400 mg/kg), chromium (50, 100 and 150 mg/kg) and cadmium (100, 150 and 200 mg/kg). Five mM EDTA was applied, as chelating agent to the plants after 4 weeks of sowing. Plants were grown for a total of two months and fresh weight and dry weight of shoot and heavy metal accumulation were analyzed at six and eight weeks after sowing. The results revealed that application of cadmium, chromium and lead and EDTA adversely affected shoot length, fresh weight and dry weight of S. bicolor at both time intervals. Heavy metals uptake increased with the increment of heavy metal by S. bicolor species. Application of 5mM EDTA enhanced the uptake of heavy metal. (author)
The Sorghum bicolor genome and the diversification of grasses
Energy Technology Data Exchange (ETDEWEB)
Paterson, Andrew H.; Bowers, John E.; Bruggmann, Remy; dubchak, Inna; Grimwood, Jane; Gundlach, Heidrun; Haberer, Georg; Hellsten, Uffe; Mitros, Therese; Poliakov, Alexander; Schmutz, Jeremy; Spannagl, Manuel; Tang, Haibo; Wang, Xiyin; Wicker, Thomas; Bharti, Arvind K.; Chapman, Jarrod; Feltus, F. Alex; Gowik, Udo; Grigoriev, Igor V.; Lyons, Eric; Maher, Christopher A.; Martis, Mihaela; Marechania, Apurva; Otillar, Robert P.; Penning, Bryan W.; Salamov, Asaf. A.; Wang, Yu; Zhang, Lifang; Carpita, Nicholas C.; Freeling, Michael; Gingle, Alan R.; hash, C. Thomas; Keller, Beat; Klein, Patricia; Kresovich, Stephen; McCann, Maureen C.; Ming, Ray; Peterson, Daniel G.; ur-Rahman, Mehboob-; Ware, Doreen; Westhoff, Peter; Mayer, Klaus F. X.; Messing, Joachim; Rokhsar, Daniel S.
2008-08-20
Sorghum, an African grass related to sugar cane and maize, is grown for food, feed, fibre and fuel. We present an initial analysis of the approx730-megabase Sorghum bicolor (L.) Moench genome, placing approx98percent of genes in their chromosomal context using whole-genome shotgun sequence validated by genetic, physical and syntenic information. Genetic recombination is largely confined to about one-third of the sorghum genome with gene order and density similar to those of rice. Retrotransposon accumulation in recombinationally recalcitrant heterochromatin explains the approx75percent larger genome size of sorghum compared with rice. Although gene and repetitive DNA distributions have been preserved since palaeopolyploidization approx70 million years ago, most duplicated gene sets lost one member before the sorghum rice divergence. Concerted evolution makes one duplicated chromosomal segment appear to be only a few million years old. About 24percent of genes are grass-specific and 7percent are sorghum-specific. Recent gene and microRNA duplications may contribute to sorghum's drought tolerance.
The diversity of local sorghum (Sorghum bicolor L. Moench) in Nusa Tenggara Timur province
Mukkun, L.; Lalel, H. J. D.; Richana, N.; Pabendon, M. B.; Kleden, S. R.
2018-04-01
Sorghum (Sorghum bicolor L. Moench) is an important food crop in the dry land including Nusa Tenggara Timur (NTT) Province. This plant has a high adaptability to drought, can produce on marginal land, and is relatively resistant to pests and diseases. The study aims to collect and identify the species of local sorghum being cultivated by farmers, and the purposes of cultivation. In addition, this study will preserve germ plasm of local sorghum by providing bank seeds for the next growing season. A collection of local sorghum samples was conducted in 7 districts using survey and observation method. A total of 53 species of sorghum were collected, with various characteristics and different local names. Based on the skin color of the seeds, the accessions were grouped into white groups (26.42%), light yellow (15.09%), black (20.75%), brown (24.52%), and red (13.20 %). Sorghum is used for complementary food for rice, consumption in times of food insecurity, fodder, and as a fence for corn and rice. It is necessary to characterize the type of local sorghum that has the potential to be developed for food, industrial raw materials, and for functional food.
Taxonomy Icon Data: sorghum [Taxonomy Icon
Lifescience Database Archive (English)
Full Text Available sorghum Sorghum bicolor Sorghum_bicolor_L.png Sorghum_bicolor_NL.png Sorghum_bicolor_S.png Sorg...hum_bicolor_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=L http://b...iosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorg...hum+bicolor&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=NS ...
DEFF Research Database (Denmark)
Mocoeur, Anne Raymonde Joelle
Sorghum (Sorghum bicolor (L.) Moench), a C4 African originated grass, ranks 5th most important crop worldwide, feeding over 500 million people in tropical regions as it withstands a wide panel of biotic and abiotic stresses. The small and simple diploid genome of sorghum was elected as the third...... plant for sequencing in 2009 promoting it as a C4 model plant. Among the very diverse genetic resources available for sorghum, sweet sorghum plants; amassing large quantities of juice-rich and sugar-rich stem, grain and vegetative biomass; have been enlightened as bioenergy crop as it can produced from...... a single plant food, feed and fuel. Sweet sorghum has gained interest in Europe to replace maize, for biogas and bioenergy productions, but this versatile crop is sensitive to chilling temperatures and little breeding efforts have been done toward its cold acclimation. The state-of-art of using...
Overexpression of SbMyb60 in sorghum bicolor impacts both primary and secondary metabolism
Few transcription factors have been identified in C4 grasses that either positively or negatively regulate monolignol biosynthesis. Previously, overexpression of SbMyb60 in sorghum (Sorghum bicolor (L.) Moench) was shown to induce monolignol synthesis, which led to elevated lignin deposition and al...
Physical and Mechanical Properties of Sorghum Grains (Sorghum Vulgare
Directory of Open Access Journals (Sweden)
2016-11-01
Full Text Available The physical and mechanical properties of sorghum grains (sorghum vulgare were studied at varying moisture contents of 13%, 20% and 30% (w.b. The four varieties of sorghum grains studied include; Dura, Guinea, Faterita and Kafir. Results indicate that the size ranges were 3.94mm - 4.83mm for Dura variety; 3.75mm - 4.54mm for Guinea variety; 3.21mm - 4.42mm for Kafir variety and 2.70mm - 4.14mm for Faterita variety. Irregularities in the shapes of the grains were observed but all approximated to a sphere. In the mechanical properties, at major diameter, Dura variety had highest rupture force of 1.16kN at 13% moisture content (w.b while the Guinea variety had the lowest rupture force of 0.955kN. In minor diameter, the Dura variety also recorded highest rupture force of 1.12kN at 13% moisture content (w.b while the Kafir variety had the lowest value of 0.952kN. Also at 20% moisture content, the Dura variety had highest rupture force of 1.025kN while the Guinea variety had the lowest rupture force of 0.965kN. The same trend applies in the varieties at 30% moisture content. This is because, increase in moisture content results to decrease in rupture force. And this implies that force beyond these points at these moisture contents may cause damage to the sorghum varieties.
International Nuclear Information System (INIS)
Wu Huibin; Tang Shirong; Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai; Smith, Donald L.
2009-01-01
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO 2 (860 μL L -1 ) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg -1 ). The results showed that elevated CO 2 not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO 2 treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO 2 could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO 2 , increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
Directory of Open Access Journals (Sweden)
Roghayyeh Sheykhbaglou
2014-03-01
Full Text Available Seed priming methods have been used to increases germination characteristics under stress conditions. The study aimed was to determine the effect of salicylic acid and gibberellin on seed reserve utilization, germination and enzyme activity of sorghum (Sorghum bicolor L. seeds under drought stress. Factorial experiment was carried out in completely randomized design with three replications. The first factor was the seed treatments (unpriming, salicylic acid and gibberellin and the second factor was drought stress (0, -4, -8 and -12 bar. The results indicated that for these traits: germination percentage, germination index, weight of utilized (mobilized seed, seed reserve utilization efficiency, seedling dry weight and seed reserve depletion percentage was a significant treatment Ч drought interaction. Thus priming improved study traits in Sorghum (Sorghum bicolor L. seeds under drought stress. Also, priming improves enzyme activity as compared to the unprimed seeds.
TECHNOLOGICAL ADVANCES IN THE OBTAINING OF ETHANOL FROM Sweet sorghum (Sorghum bicolor (L. Moench
Directory of Open Access Journals (Sweden)
Sandro Pedroso Cunha
2010-11-01
Full Text Available ABSTRACT: Replacing the use of gasoline with ethanol in vehicles reduces by 90% CO2 emissions, this justifies the interest in the use of bioethanol as renewable energy. Besides sugar cane, cassava, maize and sugar beet special emphasis is being given to sorghum (Sorghum bicolor L. Moench to produce ethanol for its productivity and resistance. The sorghum is grown in Rio Grande do Sul with a production of about 70,000 tons / year. Embrapa has a program to develop cultivars of sorghum from the time the Pro-Alcohol and currently 25 new varieties of sorghum are being evaluated. Several factors are relevant in the optimization of production such as increased productivity and reduced costs in the production of ethanol. This study aimed to survey recent data that will assess production parameters of ethanol from sorghum. Factors such as reducing the risk of bacterial contamination, the means conducive to fermentation processes or grain sorghum stalk through the use of pretreatment of the sample, have been of great importance because it is basically turning cellulosic biomass into fermentable sugars. Superior genotypes of sweet sorghum for ethanol production are of utmost importance, as well as better ways to convert sugars into ethanol. Lignin, toxic against microorganisms, prevents the conversion of lignocellulose into ethanol. The conversion of lignocellulosic ethanol compounds based on the hydrolysis of cellulose producing simple sugars and fermenting those sugars into ethanol through microbiology.
Energy Technology Data Exchange (ETDEWEB)
Shakoor, N; Nair, R; Crasta, O; Morris, G; Feltus, A; Kresovich, S
2014-01-23
Background: Effective improvement in sorghum crop development necessitates a genomics-based approach to identify functional genes and QTLs. Sequenced in 2009, a comprehensive annotation of the sorghum genome and the development of functional genomics resources is key to enable the discovery and deployment of regulatory and metabolic genes and gene networks for crop improvement. Results: This study utilizes the first commercially available whole-transcriptome sorghum microarray (Sorgh-WTa520972F) to identify tissue and genotype-specific expression patterns for all identified Sorghum bicolor exons and UTRs. The genechip contains 1,026,373 probes covering 149,182 exons (27,577 genes) across the Sorghum bicolor nuclear, chloroplast, and mitochondrial genomes. Specific probesets were also included for putative non-coding RNAs that may play a role in gene regulation (e. g., microRNAs), and confirmed functional small RNAs in related species (maize and sugarcane) were also included in our array design. We generated expression data for 78 samples with a combination of four different tissue types (shoot, root, leaf and stem), two dissected stem tissues (pith and rind) and six diverse genotypes, which included 6 public sorghum lines (R159, Atlas, Fremont, PI152611, AR2400 and PI455230) representing grain, sweet, forage, and high biomass ideotypes. Conclusions: Here we present a summary of the microarray dataset, including analysis of tissue-specific gene expression profiles and associated expression profiles of relevant metabolic pathways. With an aim to enable identification and functional characterization of genes in sorghum, this expression atlas presents a new and valuable resource to the research community.
Effect of mycorrhiza symbiosis on the Nacl salinity in Sorghum bicolor
African Journals Online (AJOL)
In order to determine mycorrhizal symbiosis on the Nacl salinity tolerance in Sorghum bicolor (aspydfyd cultivar), an experiment with two factors was done in Damghan Islamic Azad University laboratory (Iran) in 2007. The first factor with two levels (mycorihizal and non-mycorihizal) and second factor with six levels Nacl ...
Effect of Harvesting Stage on Sweet Sorghum (Sorghum bicolor L. Genotypes in Western Kenya
Directory of Open Access Journals (Sweden)
Moses Owuor Oyier
2017-01-01
Full Text Available Harvesting stage of sweet sorghum (Sorghum bicolor L. Moench cane is an important aspect in the content of sugar for production of industrial alcohol. Four sweet sorghum genotypes were evaluated for harvesting stage in a randomized complete block design. In order to determine sorghum harvest growth stage for bioethanol production, sorghum canes were harvested at intervals of seven days after anthesis. The genotypes were evaluated at different stages of development for maximum production of bioethanol from flowering to physiological maturity. The canes were crushed and juice fermented to produce ethanol. Measurements of chlorophyll were taken at various stages as well as panicles from the harvested canes. Dried kernels at 14% moisture content were also weighed at various stages. Chlorophyll, grain weight, absolute ethanol volume, juice volume, cane yield, and brix showed significant (p=0.05 differences for genotypes as well as the stages of harvesting. Results from this study showed that harvesting sweet sorghum at stages IV and V (104 to 117 days after planting would be appropriate for production of kernels and ethanol. EUSS10 has the highest ethanol potential (1062.78 l ha−1 due to excellent juice volume (22976.9 l ha−1 and EUSS11 (985.26 l ha−1 due to its high brix (16.21.
Energy Technology Data Exchange (ETDEWEB)
Wu Huibin [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); College of Resources and Environment, Huazhong Agricultural University, 430070 Wuhan, Hubei Province (China); Tang Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, The Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Smith, Donald L. [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, H9X 3V9 (Canada)
2009-10-30
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO{sub 2} (860 {mu}L L{sup -1}) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg{sup -1}). The results showed that elevated CO{sub 2} not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO{sub 2} treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO{sub 2} could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO{sub 2}, increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
S Hasibi; H Farahbakhsh; Gh Khajoeinejad
2016-01-01
Introduction Nowadays, salinity is one of the limiting factors for crop production in arid and semi-arid regions. On the other hand, sorghum (Sorghum bicolor L.) is a self-pollinated and short-day plant, which partly has been adapted to salinity and water stress conditions; also play an important role in humans, livestock and poultry nourishments. All studies have showed the positive effects of Silicon on growth and yield of plants in both normal and stress conditions. The aim of this exp...
Identification and profiling of salinity stress-responsive proteins in Sorghum bicolor seedlings
DEFF Research Database (Denmark)
Ngara, Rudo; Ndimba, Roya; Borch-Jensen, Jonas
2012-01-01
Sorghum bicolor, a drought tolerant cereal crop, is not only an important food source in the semi arid/arid regions but also a potential model for studying and gaining a better understanding of the molecular mechanisms of drought and salt stress tolerance in cereals. In this study, seeds of a sweet...... sorghum variety, MN1618, were planted and grown on solid MS growth medium with or without 100mM NaCl. Heat shock protein expression immunoblotting assays demonstrated that this salt treatment induced stress within natural physiological parameters for our experimental material. 2D PAGE in combination...... with MS/MS proteomics techniques were used to separate, visualise and identify salinity stress responsive proteins in young sorghum leaves. Out of 281 Coomassie stainable spots, 118 showed statistically significant responses (p...
The Kraft Pulp And Paper Properties of Sweet Sorghum Bagasse (Sorghum bicolor L Moench
Directory of Open Access Journals (Sweden)
Widya Fatriasari
2015-05-01
Full Text Available This study investigated the potency of sweet sorghum (Sorghum bicolor bagasse as raw material for pulp and paper using kraft pulping. The effects of alkali and sulfidity loading on kraft pulp and paper properties were also investigated. The pulping condition of the kraft pulp consisted of three levels of alkali loading (17, 19 and 22% and sulfidity loading (20, 22 and 24%. The maximum cooking temperature was 170°C for 4 h with a liquid to wood ratio of 10:1. Kraft pulping of this Numbu bagasse produced good pulp indicated by high screen yield and delignification selectivity with a low Kappa number (< 10. The unbleached pulp sheet produced a superior brightness level and a high burst index. The increase of active alkali loading tended to produce a negative effect on the pulp yield, Kappa number and paper sheet properties. Therefore, it is suggested to use a lower active alkaline concentration.
Effects of Urin Cow Dosage on Growth and Production of Sorgum Plant (Sorghum Bicolor L) on Peat Land
Utami Lestari, Sri; Andrian, Andi
2017-12-01
Sweet sorghum (Sorghum bicolor (L)), is a potential cultivated plant, especially in marginal and dry areas, sorghum has an important role as a source of carbohydrates, sorghum is expected as an alternative choice for peatland cultivation, with the use of peatlands is also expected Raising awareness of the environment by cultivating more environmentally friendly plants. The aim of this research is to know the influence and get the best dosage of cow urine on growth and production of Sorghum (Sorghum bicolor L) plant on peat soil. The experiment was conducted experimentally by using Completely Randomized Design (RAL), with one factor, namely: Cow urine administration, given in 5 treatments and 4 replications, resulting in 20 trials. Each experimental unit consists of 4 plants and 2 plants to be sampled. The factors studied were A0 = dose of cow urine 0 cc / 1, A1 = dose of cow urine 25 cc / 1, A2 = dose of cow urine 50 cc / 1, A3 = dose of cow urine 75 cc / 1, A4 = dose Cow urine 100 cc / 1. Conclusion Giving of cow urine has significant effect on growth and production of sorghum plant which is seen on the parameters of plant height, leaf length, leaf width. While wet weight 100 seeds and dry weight of 100 seeds of sorghum plants have no significant effect. The best dose is given by A4 treatment with the best dose of 100 cc / 1.
In Vitro Screening for Drought Tolerance in Different Sorghum (Sorghum bicolor (L. Moench Varieties
Directory of Open Access Journals (Sweden)
Yohannes Tsago
2013-08-01
Full Text Available Drought is one of the complex environmental factors affecting growth and yield of sorghum in arid and semi-arid areas of the world. Sixteen elite sorghum (Sorghum bicolor (L Moench genotypes were evaluated for their genetic potential to drought tolerance at callus induction and plant regeneration stage for drought tolerance. The non-ionic water soluble polymer polyethylene glycol (PEG of molecular weight 6000 was used as osmoticum to simulate water stress. The factorial experiment was laid down in a completely randomized design which comprised of a combination of two factors (genotypes and five PEG stress level; 0, 0.5, 1.0, 1.5, and 2.0% (w/v treatments. Data were recorded for callus induction efficiency, callus fresh weight, embryogenic callus percentage and plant regeneration percentage. Significant differences were observed among the genotypes, treatments and their interactions for the evaluated plant traits suggesting a great amount of variability for drought tolerance in sorghum. The correlation analysis also revealed strong and significant association between embryogenic callus percent and plant regeneration percent as well as between embryogenic callus percent and plant regeneration percent. By taking into consideration all the measured traits, Mann Whitney rank sum test revealed that 76T1#23 and Teshale followed by Meko, Gambella-1107 and Melkam showed better drought stress tolerance. Therefore they are recommended to be used as parents for genetic analysis, gene mapping and improvement of drought tolerance while Chelenko, Hormat and Raya appear to be drought sensitive.
A sorghum (Sorghum bicolor mutant with altered carbon isotope ratio.
Directory of Open Access Journals (Sweden)
Govinda Rizal
Full Text Available Recent efforts to engineer C4 photosynthetic traits into C3 plants such as rice demand an understanding of the genetic elements that enable C4 plants to outperform C3 plants. As a part of the C4 Rice Consortium's efforts to identify genes needed to support C4 photosynthesis, EMS mutagenized sorghum populations were generated and screened to identify genes that cause a loss of C4 function. Stable carbon isotope ratio (δ13C of leaf dry matter has been used to distinguishspecies with C3 and C4 photosynthetic pathways. Here, we report the identification of a sorghum (Sorghum bicolor mutant with a low δ13C characteristic. A mutant (named Mut33 with a pale phenotype and stunted growth was identified from an EMS treated sorghum M2 population. The stable carbon isotope analysis of the mutants showed a decrease of 13C uptake capacity. The noise of random mutation was reduced by crossing the mutant and its wildtype (WT. The back-cross (BC1F1 progenies were like the WT parent in terms of 13C values and plant phenotypes. All the BC1F2 plants with low δ13C died before they produced their 6th leaf. Gas exchange measurements of the low δ13C sorghum mutants showed a higher CO2 compensation point (25.24 μmol CO2.mol-1air and the maximum rate of photosynthesis was less than 5μmol.m-2.s-1. To identify the genetic determinant of this trait, four DNA pools were isolated; two each from normal and low δ13C BC1F2 mutant plants. These were sequenced using an Illumina platform. Comparison of allele frequency of the single nucleotide polymorphisms (SNPs between the pools with contrasting phenotype showed that a locus in Chromosome 10 between 57,941,104 and 59,985,708 bps had an allele frequency of 1. There were 211 mutations and 37 genes in the locus, out of which mutations in 9 genes showed non-synonymous changes. This finding is expected to contribute to future research on the identification of the causal factor differentiating C4 from C3 species that can be used
Molecular markers associated with aluminium tolerance in Sorghum bicolor.
Too, Emily Jepkosgei; Onkware, Augustino Osoro; Were, Beatrice Ang'iyo; Gudu, Samuel; Carlsson, Anders; Geleta, Mulatu
2018-01-01
Sorghum ( Sorghum bicolor , L. Moench) production in many agro-ecologies is constrained by a variety of stresses, including high levels of aluminium (Al) commonly found in acid soils. Therefore, for such soils, growing Al tolerant cultivars is imperative for high productivity. In this study, molecular markers associated with Al tolerance were identified using a mapping population developed by crossing two contrasting genotypes for this trait. Four SSR ( Xtxp34 , Sb5_236 , Sb6_34 , and Sb6_342 ), one STS ( CTG29_3b ) and three ISSR ( 811_1400 , 835_200 and 884_200 ) markers produced alleles that showed significant association with Al tolerance. CTG29_3b, 811_1400 , Xtxp34 and Sb5_ 236 are located on chromosome 3 with the first two markers located close to Alt SB , a locus that underlie the Al tolerance gene ( SbMATE ) implying that their association with Al tolerance is due to their linkage to this gene. Although CTG29_3b and 811_ 1400 are located closer to Alt SB , Xtxp34 and Sb5_236 explained higher phenotypic variance of Al tolerance indices. Markers 835_200 , 884_200 , Sb6_34 and Sb6_342 are located on different chromosomes, which implies the presence of several genes involved in Al tolerance in addition to S bMATE in sorghum. These molecular markers have a high potential for use in breeding for Al tolerance in sorghum.
Suwarti; Efendi, R.; Massinai, R.; Pabendon, M. B.
2018-03-01
Sweet sorghum (Sorghum bicolor L. [Moench]) crop management that is use for raw source of bioethanol for industrial purpose in Indonesia is less developed. The aim of this research was to evaluated sweet sorghum variety at several population to determine optimum density for juice production. Experiment design was set on split-plot design with three replications, conducted on August to December 2016 at the Indonesian Cereals Research Institute Research Station, Maros South Sulawesi. Main plot were six variation of plant row, and sub plot were three sweet sorghum varieties. Result of the study showed that plant population was high significanty affect to stalk weight, total biomass yield, leaf weight, and also significantly affect bagass weight and juice volume. Varieties were high significantly different in plant height, juice volume, and number of nodes. Super 1 variety on population at 166,667 plants/ha (P1) was obtained the highest juice volume (19,445 lHa-1), meanwhile the highest brix value obtained from Numbu at the same plants population. Furthermore juice volume had significant correlation with biomass weight at the r=0.73. Based on ethanol production, Super 2 and Numbu had the highest volume at 83.333 plants/ha density (P3) and Super 1 at 166.667 plants/ha density with the ethanol volume were 827.68 l Ha-1, 1116.50 l/ha and 993.62 l Ha-1 respectively.
Energy Technology Data Exchange (ETDEWEB)
Ian J. Bonner; Kevin L. Kenney
2012-10-01
Cellulosic energy varieties of Sorghum bicolor (L.) Moench show promise as a bioenergy feedstock, however, high moisture content at the time of harvest results in unacceptable levels of degradation when stored in aerobic conditions. To safely store sorghum biomass for extended periods in baled format, the material must be dried to inhibit microbial growth. One possible solution is allowing the material to dry under natural in-field conditions. This study examines the differences in thin-layer drying rates of intact and conditioned sorghum under laboratory-controlled temperatures and relative humidity levels (20 degrees C and 30 degrees C from 40% to 85% relative humidity), and models experimental data using the Page’s Modified equation. The results demonstrate that conditioning drastically accelerates drying times. Relative humidity had a large impact on the time required to reach a safe storage moisture content for intact material (approximately 200 hours at 30 degrees C and 40% relative humidity and 400 hours at 30 degrees C and 70% relative humidity), but little to no impact on the thin-layer drying times of conditioned material (approximately 50 hours for all humidity levels < 70% at 30 degrees C). The drying equation parameters were influenced by temperature, relative humidity, initial moisture content, and material damage, allowing drying curves to be empirically predicted. The results of this study provide valuable information applicable to the agricultural community and to future research on drying simulation and management of energy sorghum.
Cadmium phytoextraction from loam soil in tropical southern China by Sorghum bicolor.
Wang, Xu; Chen, Can; Wang, Jianlong
2017-06-03
The cadmium (Cd) uptake characteristics by Sorghum bicolor cv. Nengsi 2# and Cowley from the acidic sandy loam soil (pH = 6.1) during the entire growth period (100 days) were investigated in pot outdoors in a tropical district of southern China, Hainan Island. The Cd-spiked levels in soil were set as 3 and 15 mg/kg. Correspondingly, the available Cd levels in soil extracted by Mehlich III solution were 2.71 and 9.41 mg/kg, respectively. Basically, two varieties in a full growth period (100 days) did not show a significant difference in their growth and Cd uptake. Under high Cd stress, the plant growth was inhibited and its biomass weight and height decreased by 38.7-51.5% and 27.6-28.5%, respectively. However, S. bicolor showed higher bioaccumulation capability of Cd from soil to plant [bioconcentration factor (BCF)>4], and higher transfer capability of Cd from roots to shoots [translocation factor (TF)>1] under high Cd stress; Cd contents in the roots, stems, and leaves of S. bicolor reached 43.79-46.07, 63.28-70.60, and 63.10-66.06 mg/kg, respectively. S. bicolor exhibited the potential phytoextraction capability for low or moderate Cd-contamination in acidic sandy loam soil.
Directory of Open Access Journals (Sweden)
Pattarawadee Sumthong Nakmee
2016-05-01
Full Text Available Sorghum (Sorghum bicolor Linn. seedlings were grown in pots using Pakchong soil from Nakhon Ratchasima province. Ten species of native Arbuscular mycorrhizal (AM fungi: Glomus sp. 1, Glomus sp. 2, Glomus sp. 3, Glomus aggregatum, Glomus fasciculatum, Acaulospora longula, Glomus occultum, Acaulospora scrobiculata, Acaulospora spinosa and Scutellospora sp., were used to inoculate sorghum seedlings. The sorghum growth and uptake of several major nutrients were evaluated at the harvesting stage. The results revealed that sorghum inoculated with A. scrobiculata produced the greatest biomass, grain dry weight and total nitrogen uptake in shoots. The highest phosphorus uptake in shoots was found in A. spinosa-inoculated plants, followed by Glomus sp. and A. scrobiculata, whereas Scutellospora sp.-inoculated plants showed the highest potassium uptake in shoots followed by A. scrobiculata. Overall, the most efficient AM fungi for improvement of nutrient uptake, biomass and grain dry weight in sorghum were A. scrobiculata.
Lifescience Database Archive (English)
Full Text Available Sorghum bicolor Finished 2n=20 760 Mb 2009 Sanger (Clone-based) 10,717,203 reads 7...30 Mb 8.5x Arachne2 v.20060705 3,304 12,873 BLAST, GenomeScan 34,496 (Sbi1.4) JGI; http://www.phytozome.net/sorghum Sbi1 Sbi1.4 10.1038/nature07723 19189423 ...
Post-anthesis nitrate uptake is critical to yield and grain protein content in Sorghum bicolor.
Worland, Belinda; Robinson, Nicole; Jordan, David; Schmidt, Susanne; Godwin, Ian
2017-09-01
Crops only use ∼50% of applied nitrogen (N) fertilizer creating N losses and pollution. Plants need to efficiently uptake and utilize N to meet growing global food demands. Here we investigate how the supply and timing of nitrate affects N status and yield in Sorghum bicolor (sorghum). Sorghum was grown in pots with either 10mM (High) or 1mM (Low) nitrate supply. Shortly before anthesis the nitrate supply was either maintained, increased 10-fold or eliminated. Leaf sheaths of sorghum grown with High nitrate accumulated nitrate in concentrations >3-times higher than leaves. Removal of nitrate supply pre-anthesis resulted in the rapid reduction of stored nitrate in all organs. Plants receiving a 10-fold increase in nitrate supply pre-anthesis achieved similar grain yield and protein content and 29% larger grains than those maintained on High nitrate, despite receiving 24% less nitrate over the whole growth period. In sorghum, plant available N is important throughout development, particularly anthesis and grain filling, for grain yield and grain protein content. Nitrate accumulation in leaf sheaths presents opportunities for the genetic analysis of mechanisms behind nitrate storage and remobilization in sorghum to improve N use efficiency. Copyright © 2017 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Alex de Matos Teixeira
2014-01-01
Full Text Available The purpose of this study was to evaluate the voluntary intake and digestibility of three sorghum (Sorghum bicolor, L. Moench hybrid silages in sheep. The hybrids used were H1 -BRS 655 (CMSXS 222 A × CMSXS 235 R, with tannin; H2 -(ATF54 A × CMSXS 235 R, without tannin; and H3 -BRS 610 (CMSXS 232 A × CMSXS 234 R, without tannin. The intake and digestibility of dry matter (DM, gross energy (GE, neutral detergent fiber (NDF, acid detergent fiber (ADF and crude protein (CP were measured. Eighteen crossbred sheep weighing 59.4 kg (±8.3 were used in the trial. A completely randomized design with three treatments (hybrids and six repetitions (sheep was used. There were no differences in the DM intake or apparent digestibility among the hybrids. Silage of hybrid BRS 610 displayed higher digestibility coefficients for CP, NDF, ADF, and GE compared with the other silages, which did not differ from each other. The neutral detergent fiber, ADF and digestible energy (DE intakes were similar among the hybrids silages. All of the hybrids resulted in a positive N balance in sheep. The levels of DE were superior in hybrid silage BRS 610 in comparison with the other hybrids. Sorghum hybrid BRS 610 silage exhibited superior nutritional value compared with the other hybrids, which is most likely in part due to the absence of tannins. Sorghum silage made with hybrid BRS 610 (CMSXS 232 A × CMSXS 234 R presents superior gross energy, crude protein, neutral detergent fiber and acid detergent fiber digestibility coefficients, as well as greater digestible energy levels than BRS 655 (CMSXS 222 A × CMSXS 235 R and (ATF54 A × CMSXS 235 R.
Using Genotyping by Sequencing to Map Two Novel Anthracnose Resistance Loci in Sorghum bicolor.
J Felderhoff, Terry; M McIntyre, Lauren; Saballos, Ana; Vermerris, Wilfred
2016-07-07
Colletotrichum sublineola is an aggressive fungal pathogen that causes anthracnose in sorghum [Sorghum bicolor (L.) Moench]. The obvious symptoms of anthracnose are leaf blight and stem rot. Sorghum, the fifth most widely grown cereal crop in the world, can be highly susceptible to the disease, most notably in hot and humid environments. In the southeastern United States the acreage of sorghum has been increasing steadily in recent years, spurred by growing interest in producing biofuels, bio-based products, and animal feed. Resistance to anthracnose is, therefore, of paramount importance for successful sorghum production in this region. To identify anthracnose resistance loci present in the highly resistant cultivar 'Bk7', a biparental mapping population of F3:4 and F4:5 sorghum lines was generated by crossing 'Bk7' with the susceptible inbred 'Early Hegari-Sart'. Lines were phenotyped in three environments and in two different years following natural infection. The population was genotyped by sequencing. Following a stringent custom filtering protocol, totals of 5186 and 2759 informative SNP markers were identified in the two populations. Segregation data and association analysis identified resistance loci on chromosomes 7 and 9, with the resistance alleles derived from 'Bk7'. Both loci contain multiple classes of defense-related genes based on sequence similarity and gene ontologies. Genetic analysis following an independent selection experiment of lines derived from a cross between 'Bk7' and sweet sorghum 'Mer81-4' narrowed the resistance locus on chromosome 9 substantially, validating this QTL. As observed in other species, sorghum appears to have regions of clustered resistance genes. Further characterization of these regions will facilitate the development of novel germplasm with resistance to anthracnose and other diseases. Copyright © 2016 Felderhoff et al.
Directory of Open Access Journals (Sweden)
Traoré, M.
2012-01-01
Full Text Available Influence of crop rotation, fertilization and tillage on populations of plant parasitic nematodes of sorghum (Sorghum bicolor (L. Moench. The soil nematodes of three long-term trials (1960, 1980 and 1990 representing the production of sorghum (Sorghum bicolor (L. Moench under different agricultural practices (rotation, tillage and fertilization in the Center West of Burkina Faso, have been explored in the wake of the harvest during the agricultural season 2007/2008. The objective was to identify these nematodes and to study the influence of agricultural practices on this nematofauna. Nematodes were extracted by the method of Seinhorst elutriator. Plant-parasitic nematodes identified are Pratylenchus brachyurus, Tylenchorhynchus martini, Helicotylenchus multicinctus, Scutellonema Caveness, Criconemoides curvatum, Telotylenchus indicus and Xiphinema sp. The first three species represent approximately 98% of individuals surveyed. On the first site, the treatments involving mineral fertilizer and recycling of sorghum straw were favorable for the control of nematodes instead of treatments involving manure. As for rotations, monoculture of sorghum was more infested by nematodes than the rotations sorghum – cowpea and sorghum – cotton. On the second site, the nitrogen has increased of infestation by the two major nematodes in comparison to treatments without nitrogen, with the exception of treatment with anaerobic compost incorporation. On the third site, deep plowing has been unfavorable to the main nematode sorghum compared to shallow tillage. The nematofauna in fallow was more diversified than in cultivated sites and P. brachyurus, the main nematode related to sorghum has fallen sharply in fallow.
Directory of Open Access Journals (Sweden)
Nerbéwendé Sawadogo
2017-05-01
Full Text Available Sorghum bicolor (L. Moench is an under-harvested crop in Burkina Faso. It is grown mainly for its sweet grains in the pasty stage. However, the precocity of the cycle and the sweet grains at pasty stage make it an interesting plant with agro-alimentary potential during the lean season. This study was carried out to identify the main sugars responsible for the sweetness of the grains at the pasty stage and their variation according to the agro-morphological group and the botanical race. Thus, the grains harvested at the pasty stage of fifteen (15 accessions selected according to the agro-morphological group and botanical race were lyophilized and analyzed by High Performance Liquid Chromatography (HPLC. The results reveal the presence of four (4 main carbohydrates at pasty stage of grains such as fructose, glucose, sucrose and starch. Analysis of variance revealed that these carbohydrates discriminate significantly the agro-morphological groups and the botanical races. Moreover, with exception of the sucrose, the coefficient of determination (R2 values shows that the agro-morphological group factor has a greater effect on the expression of glucose, fructose and starch than the botanical race. Group III and caudatum race have the highest levels of fructose and would be the sweetest. While group IV and the guinea-bicolor race with the low value of fructose would be the least sweet. Fructose is therefore the main sugar responsible for the sweetness of the pasty grains of sweet grains sorghum.
African Journals Online (AJOL)
big timmy
... properties of pumpkin (Cucurbita pepo) and sorghum (Sorghum bicolor) flour blends fermented with pure strains of Lactobacillus ... good storage characteristics and affordable cost. (Akinrele ... (MRS), Nutrient agar (NA) and Potato dextrose.
Introduction of sorghum (Sorghum bicolor (L.) Moench) into China ...
African Journals Online (AJOL)
The sorghum is a plant, which has been intentionally introduced in China for foods needs. It is a plant of African origin, which is much cultivated in the northern hemisphere. For millions of people in the semiarid tropic temperature of Asia and Africa, sorghum is the most important staple food. Sorghum is becoming one of the ...
Directory of Open Access Journals (Sweden)
Manzelli, M.
2006-01-01
Full Text Available After the collapse of Siyad Barre' regime, Somalia lost any form of agricultural research with negative consequences on food availability and seed sector stability. A fi rst step to restore food security can be represented by enhancing local genetic resources. Sorghum (Sorghum bicolor (L. Moench is a very important crop in rainfed areas of Somalia serving as primary source of food and forage. Eight morphological and productive characteristics were chosen to assess the phenotypic variability of 7 accessions from South Somalia. Univariate (ANOVA and multivariate (discriminant and cluster analysis methods were used to assess the productive variation within the accession and to group the 7 accessions into clusters based on quantitative characters. The results showed that there is a wide morpho-agronomical diversity among accessions, especially regarding specifi c features suitable for different purpose, such as grain and/or forage production. Moreover the landraces were able to grow and produce under harsh environmental conditions. The gathered information can be used to promote the conservation and future improvement of local sorghum landraces, thus aiding in the stabilisation of a secure and sustainable food resource for farmers of southern Somalia.
International Nuclear Information System (INIS)
Kafi, M.; Nabati, J.; Masoumi, A.; Mehrgerdi, M.Z.
2011-01-01
Application of silicon (Si) to soil is considered as an alternative approach to alleviate salinity stress in crop plants. Therefore, a field experiment was conducted to investigate the effects of Si application [control (without Si), 1.44 and 1.92 g.kg /sup -1/ soil on membrane stability index (MSI), relative water content (RWC), leaf proline, soluble sugars, antioxidant activity, total phenols and dry matter accumulation of two sorghum (Sorghum bicolor) cultivars under three levels of salinity of irrigation water (5.2, 10.5 and 23.1 dS m/sup -1/ . The results showed that leaf proline content, activities of ascorbate peroxidase (APX) and glutathione reductase (GR), Na/sup +/ concentration significantly increased only at high level of salinity, while, RWC Si caused an and dry matter accumulation were significantly decreased at all salinity levels. Soil application of 1.44 g.kg/sup -1/ increase in the activities of APX, catalase (CAT), superoxide dismutase (SOD), peroxidase (PRO), glutathione reductase soil Si caused an increase in membrane stabilityindex, (GR), total antioxidant and total phenol contents and 1.92 g.kg/sup -1/ soluble sugar and total phenol contents, CAT, SOD and total antioxidant activity. Soluble sugars, total phenols, SOD and total antioxidant activity and dry matter accumulation in cv. Omidbakhsh were higher than those in cv. Sepideh. In conclusion, alleviation of salinity stress by exogenous application of Si was found to be associated partly with enhanced antioxidant activity. (author)
Development of Perennial Grain Sorghum
Directory of Open Access Journals (Sweden)
Stan Cox
2018-01-01
Full Text Available Perennial germplasm derived from crosses between Sorghum bicolor and either S. halepense or S. propinquum is being developed with the goal of preventing and reversing soil degradation in the world’s grain sorghum-growing regions. Perennial grain sorghum plants produce subterranean stems known as rhizomes that sprout to form the next season’s crop. In Kansas, breeding perennial sorghum involves crossing S. bicolor cultivars or breeding lines to S. halepense or perennial S. bicolorn × S. halepense breeding lines, selecting perennial plants from F2 or subsequent populations, crossing those plants with S. bicolor, and repeating the cycle. A retrospective field trial in Kansas showed that selection and backcrossing during 2002–2009 had improved grain yields and seed weights of breeding lines. Second-season grain yields of sorghum lines regrowing from rhizomes were similar to yields in the first season. Further selection cycles have been completed since 2009. Many rhizomatous lines that cannot survive winters in Kansas are perennial at subtropical or tropical locations in North America and Africa. Grain yield in Kansas was not correlated with rhizomatousness in either Kansas or Uganda. Genomic regions affecting rhizome growth and development have been mapped, providing new breeding tools. The S. halepense gene pool may harbor many alleles useful for improving sorghum for a broad range of traits in addition to perenniality.
Maturation and germination of somatic embryos of Sorghum bicolor (L. Moench cultivar 'CIAP 132R-05'
Directory of Open Access Journals (Sweden)
Silvio de J Martínez
2017-03-01
Full Text Available In sorghum [Sorghum bicolor (L. Moench], developed protocols for plant regeneration via somatic embryogenesis do not include maturation stage. The present work was carried out with the aim of achieving the maturation and germination of sorghum somatic embryos in cultivar 'CIAP 132R-05'. It were studied four concentrations of sucrose (30, 50, 70 and 90 g l-1, two of abscisic acid (0.25 and 0.5 μM and a control without this growth regulator. Germination initiation (days and number of somatic embryos with complete germination were evaluated in three periods (1 - 7, 8 - 14 and 15 - 21 days of culture. In addition, the effect of 6-BAP (8.9, 17.8 and 26.6 μM on somatic embryo germination was determined. The germination start time (days and after 21 days the number of somatic embryos with complete germination and plants with malformations were determined. The addition of 70 g l-1 sucrose in the culture medium without abscisic acid increased the germination of the somatic embryos to 37.2 plants per embryo group (0.5 g of fresh mass. The highest number of somatic embryos germinated was obtained with 17.78 μM 6-BAP in the germination culture medium. It was demonstrated the need of a maturation stage in the sorghum somatic embryogenesis to increase the germination percentage. Keywords: somatic embryogenesis, sorghum, sucrose, 6-BAP
Alleviation of Boron Stress through Plant Derived Smoke Extracts in Sorghum bicolor
Directory of Open Access Journals (Sweden)
Pirzada Khan
2014-08-01
Full Text Available Boron is an essential micronutrient necessary for plant growth at optimum concentration. However, at high concentrations boron affects plant growth and is toxic to cells. Aqueous extract of plant-derived smoke has been used as a growth regulator for the last two decades to improve seed germination and seedling vigor. It has been established that plant-derived smoke possesses some compounds that act like plant growth hormones. The present research was the first comprehensive attempt to investigate the alleviation of boron stress with plant-derived smoke aqueous extract on Sorghum (Sorghum bicolor seed. Smoke extracts of five plants, i.e. Cymbopogon jwarancusa, Eucalyptus camaldulensis, Peganum harmala, Datura alba and Melia azedarach each with six dilutions (Concentrated, 1:100, 1:200, 1:300, 1:400 and 1:500 were used. While boron solutions at concentrations of 5, 10, 15, 20 and 25 ppm were used for stress. Among the dilutions of smoke, 1:500 of E. camaldulensis significantly increased germination percentage, root and shoot length, number of secondary roots and fresh weight of root and shoot while, boron stress reduced growth of Sorghum. It was observed that combined effect of boron solution and E. camaldulensis smoke extract overcome inhibition and significantly improved plant growth. Present research work investigated that the smoke solution has the potential to alleviate boron toxicity by reducing the uptake of boron by maintaining integrity of plant cell wall. The present investigation suggested that plant derived smoke has the potential to alleviate boron stress and can be used to overcome yield losses caused by boron stress to plants.
DEFF Research Database (Denmark)
Nielsen, Lasse Janniche; Stuart, Peter; Pičmanová, Martina
2016-01-01
Background: The important cereal crop Sorghum bicolor (L.) Moench biosynthesize and accumulate the defensive compound dhurrin during development. Previous work has suggested multiple roles for the compound including a function as nitrogen storage/buffer. Crucial for this function is the endogenous...... turnover of dhurrin for which putative pathways have been suggested but not confirmed. Results: In this study, the biosynthesis and endogenous turnover of dhurrin in the developing sorghum grain was studied by metabolite profiling and time-resolved transcriptome analyses. Dhurrin was found to accumulate...... analyses coupled with metabolite profiling, identified gene candidates involved in proanthocyanidin biosynthesis in sorghum. Conclusions: The results presented in this article reveal the existence of two endogenous dhurrin turnover pathways in sorghum, identify genes putatively involved...
Directory of Open Access Journals (Sweden)
Norazlina Ahmad
2012-01-01
Full Text Available Regulatory sequences with endosperm specificity are essential for foreign gene expression in the desired tissue for both grain quality improvement and molecular pharming. In this study, promoters of seed storage α-kafirin genes coupled with signal sequence (ss were isolated from Sorghum bicolor L. Moench genomic DNA by PCR. The α-kafirin promoter (α-kaf contains endosperm specificity-determining motifs, prolamin-box, the O2-box 1, CATC, and TATA boxes required for α-kafirin gene expression in sorghum seeds. The constructs pMB-Ubi-gfp and pMB-kaf-gfp were microprojectile bombarded into various sorghum and sweet corn explants. GFP expression was detected on all explants using the Ubi promoter but only in seeds for the α-kaf promoter. This shows that the α-kaf promoter isolated was functional and demonstrated seed-specific GFP expression. The constructs pMB-Ubi-ss-gfp and pMB-kaf-ss-gfp were also bombarded into the same explants. Detection of GFP expression showed that the signal peptide (SP::GFP fusion can assemble and fold properly, preserving the fluorescent properties of GFP.
Directory of Open Access Journals (Sweden)
Ethel Lourenzi Barbosa Novelli
2002-05-01
Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.
Sorghum yield and associated satellite-derived meteorological ...
African Journals Online (AJOL)
Sorghum yield and associated satellite-derived meteorological parameters in semi-arid Botswana. ... African Crop Science Journal ... Sorghum (Sorghum bicolor) yield for five seasons (2005/6 to 2009/10) from the Botswana Department of Crop ... Key Words: Coefficient of determination, NDVI, Pearson correlation ...
Bean, S R; Lookhart, G L; Bietz, J A
2000-02-01
An improved method for separating and characterizing maize (Zea mays L.) and sorghum (Sorghum bicolor L. Moench) storage proteins by free zone capillary electrophoresis (FZCE) was developed. Previous electrophoretic methods for analyzing these proteins required high concentrations of urea to maintain protein solubility during separation. To overcome disadvantages of urea, we developed a FZCE method that mimicked reversed-phase high-performance liquid chromatography (RP-HPLC) in that it used high levels of acetonitrile (ACN) at low pH. The optimized FZCE buffer system consisted of 80 mM phosphate-glycine buffer, nominal pH 2.5, containing 60% ACN and a cellulose derivative to dynamically coat capillary walls. Resolution was similar to or higher than that previously achieved by FZCE buffers utilizing 8 M urea as a buffer additive. ACN concentrations of at least 50% were necessary to achieve acceptable separations; this ACN concentration is approximately that necessary to extract these storage proteins. ACN was equally effective as traditional ethanol solvents and 8 M urea for solubilizing maize and sorghum proteins. The ACN-based FZCE buffer system gave high repeatability (buffers. This FZCE method may be applicable for the analysis of other hydrophobic proteins without the use of urea.
Glucuronoarabinoxylans from sorghum grain
Verbruggen, M.A.
1996-01-01
Water-unextractable cell wall materials (WUS) were prepared from raw, polished, and malted sorghum ( Sorghum vulgare cv. Fara Fara). Except for the amounts, hardly any difference could be observed between the WUS of these three raw materials. This means that cell wall
Efficient regeneration of sorghum, Sorghum bicolor (L.) Moench, from shoot-tip explant.
Syamala, D; Devi, Prathibha
2003-12-01
Novel protocols for production of multiple shoot-tip clumps and somatic embryos of Sorghum bicolor (L.) Moench were developed with long-term goal of crop improvement through genetic transformation. Multiple shoot-tip clumps were developed in vitro from shoot-tip explant of one-week old seedling, cultured on MS medium containing only BA (0.5, 1 or 2 mg/l) or both BA (1 or 2 mg/l) and 2,4-D (0.5 mg/l) with bi-weekly subculture. Somatic embryos were directly produced on the enlarged dome shaped growing structures that developed from the shoot-tips of one-week old seedling explants (without any callus formation) when cultured on MS medium supplemented with both 2,4-D (0.5 mg/l) and BA (0.5 mg/l). However, the supplementation of MS medium with only 2,4-D (0.5 mg/l) induced compact callus without any plantlet regeneration. Each multiple shoot-clump was capable of regenerating more than 80 shoots via an intensive differentiation of both axillary and adventitious shoot buds, the somatic embryos were capable of 90% germination, plant conversion and regeneration. The regenerated shoots could be efficiently rooted on MS medium containing indole-3-butyric acid (IBA 1 mg/l). The plants were successfully transplanted to glasshouse and grown to maturity with a survival rate of 98%. Morphogenetic response of the explants was found to be genotypically independent.
Enhanced ethanol production from stalk juice of sweet sorghum by ...
African Journals Online (AJOL)
user
2012-03-15
Mar 15, 2012 ... Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy ... government that only ''non-grain” materials can be used ... In this work, ... inoculated (10%, v/v) into fermentation medium prepared with the.
Enhanced ethanol production from stalk juice of sweet sorghum by ...
African Journals Online (AJOL)
Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy crops. As a novel green regenerated high-energy crop with high utility value, high yield of biomass, the sweet sorghum is widely used and developed in China. Stalk juice of sweet sorghum was used as the main substrate for ethanol ...
Cantoro, Renata; Crocco, Carlos Daniel; Benech-Arnold, Roberto Luis; Rodr?guez, Mar?a Ver?nica
2013-01-01
The precise adjustment of the timing of dormancy release according to final grain usage is still a challenge for many cereal crops. Grain sorghum [Sorghum bicolor (L.) Moench] shows wide intraspecific variability in dormancy level and susceptibility to pre-harvest sprouting (PHS). Both embryo sensitivity to abscisic acid (ABA) and gibberellin (GA) metabolism play an important role in the expression of dormancy of the developing sorghum grain. In previous works, it was shown that, simultaneous...
Mapping and characterisation of the sorghum cell suspension ...
African Journals Online (AJOL)
Here we reported the first secretomic study of sorghum (Sorghum bicolor), a naturally drought tolerant cereal crop. In this study, we used a gel-based proteomic approach in combination with mass spectrometry to separate and identify proteins secreted into the culture medium of sorghum cell suspensions, a first step ...
Genetic architecture of kernel composition in global sorghum germplasm
Sorghum [Sorghum bicolor (L.) Moench] is an important cereal crop for dryland areas in the United States and for small-holder farmers in Africa. Natural variation of sorghum grain composition (protein, fat, and starch) between accessions can be used for crop improvement, but the genetic controls are...
Tapping the US sweet sorghum collection to identify biofuel germplasm
The narrow genetic base in sweet sorghum [Sorghum bicolor (L.) Moench] breeding programs is limiting the development of new varieties for biofuel production. Therefore, the identification of genetically diverse sweet sorghum germplasm in the U.S. National Plant Germplasm System (NPGS) collection is...
African Journals Online (AJOL)
sorghum plants mitigates the negative effect of drought stress, favoring this crop cultivation in areas of low water ... It is a salt and aluminum-tolerant crop, making areas suitable for ... its growth or decrease its metabolic activity and later, when water ..... and osmoregulation, but also in stabilizing the structures and enzyme ...
Biological and water-use efficiencies of sorghum-groundnut intercrop
African Journals Online (AJOL)
In order to compare water-use efficiency of sole crops and intercrops, 2 experiments were conducted in 2 consecutive years with sorghum (Sorghum bicolor L. Moench) and groundnut (Arachis hypogaea L.) on a loamy, Grossarenic Paleudult. In a randomized block, split-plot design, sorghum (SS), groundnut (GG), ...
Morphological responses of forage sorghums to salinity and ...
African Journals Online (AJOL)
The response of forage sorghum [Sorghum bicolor (L.) Moench] varieties to salinity and irrigation frequency were studied from December 2007 to December 2009. Two forage sorghum varieties (Speedfeed and KFS4) were grown under salinity levels of 0, 5, 10 and 15 dS m-1 and irrigated when the leaf water potential ...
Sorghum [Sorghum bicolor (L.) Moench] Seed Quality as Affected by ...
African Journals Online (AJOL)
... bicolor (L.) Moench seeds subjected to different field cultural management practices. ... Germination and vigour tests indicated that seed selection time did not ... In relation to this, variety E1291 showed better seed vigour, viability and yield ...
Evaluation of the multi-seeded (msd) mutant of sorghum for ethanol production
Grain sorghum [Sorghum bicolor (L.) Moench], a cost effective crop in semiarid regions, is an underestimated supplement to corn in starch based ethanol production. Twenty three multi-seeded (msd) mutant sorghums and one wild type sorghum BTx623 were evaluated for ethanol production and effect of che...
International Nuclear Information System (INIS)
Yu, P.
2011-01-01
Sorghum seed (Sorghum bicolor L.) has unique degradation and fermentation behaviours compared with other cereal grains such as wheat, barley and corn. This may be related to its cell and cell-wall architecture. The advanced synchrotron radiation infrared microspectroscopy (SR-IMS) technique enables the study of cell or living cell biochemistry within cellular dimensions. The objective of this study was to use the SR-IMS imaging technique to microprobe molecular spatial distribution and cell architecture of the sorghum seed tissue comprehensively. High-density mapping was carried out using SR-IMS on beamline U2B at the National Synchrotron Light Source (Brookhaven National Laboratory, NY, USA). Molecular images were systematically recorded from the outside to the inside of the seed tissue under various chemical functional groups and their ratios [peaks at ∼1725 (carbonyl C=O ester), 1650 (amide I), 1657 (protein secondary structure α-helix), 1628 (protein secondary structure β-sheet), 1550 (amide II), 1515 (aromatic compounds of lignin), 1428, 1371, 1245 (cellulosic compounds in plant seed tissue), 1025 (non-structural CHO, starch granules), 1246 (cellulosic material), 1160 (CHO), 1150 (CHO), 1080 (CHO), 930 (CHO), 860 (CHO), 3350 (OH and NH stretching), 2960 (CH 3 anti-symmetric), 2929 (CH 2 anti-symmetric), 2877 (CH 3 symmetric) and 2848 cm -1 (CH 2 asymmetric)]. The relative protein secondary structure α-helix to β-sheet ratio image, protein amide I to starch granule ratio image, and anti-symmetric CH 3 to CH 2 ratio image were also investigated within the intact sorghum seed tissue. The results showed unique cell architecture, and the molecular spatial distribution and intensity in the sorghum seed tissue (which were analyzed through microprobe molecular imaging) were generated using SR-IMS. This imaging technique and methodology has high potential and could be used for scientists to develop specific cereal grain varieties with targeted food and feed
Efficacy of herbicide seed treatments for controlling Striga infestation of Sorghum
Tuinstra, M.R.; Soumana, S.; Al-Khatib, K.; Kapran, I.; Toure, A.; Ast, van A.; Bastiaans, L.; Ochanda, N.W.; Salami, I.; Kayentao, M.; Dembele, S.
2009-01-01
Witchweed (Striga spp.) infestations are the greatest obstacle to sorghum [Sorghum bicolor (L.) Moench] grain production in many areas in Africa. The objective of this study was to evaluate the efficacy of herbicide seed treatments for controlling Striga infestation of sorghum. Seeds of an
Directory of Open Access Journals (Sweden)
Yinping Jiao
2018-01-01
Full Text Available Sorghum (Sorghum bicolor Moench, L. plant accumulates copious layers of epi-cuticular wax (EW on its aerial surfaces, to a greater extent than most other crops. EW provides a vapor barrier that reduces water loss, and is therefore considered to be a major determinant of sorghum's drought tolerance. However, little is known about the genes responsible for wax accumulation in sorghum. We isolated two allelic mutants, bloomless40-1 (bm40-1 and bm40-2, from a mutant library constructed from ethyl methane sulfonate (EMS treated seeds of an inbred, BTx623. Both mutants were nearly devoid of the EW layer. Each bm mutant was crossed to the un-mutated BTx623 to generated F2 populations that segregated for the bm phenotype. Genomic DNA from 20 bm F2 plants from each population was bulked for whole genome sequencing. A single gene, Sobic.001G228100, encoding a GDSL-like lipase/acylhydrolase, had unique homozygous mutations in each bulked F2 population. Mutant bm40-1 harbored a missense mutation in the gene, whereas bm40-2 had a splice donor site mutation. Our findings thus provide strong evidence that mutation in this GDSL-like lipase gene causes the bm phenotype, and further demonstrate that this approach of sequencing two independent allelic mutant populations is an efficient method for identifying causal mutations. Combined with allelic mutants, MutMap provides powerful method to identify all causal genes for the large collection of bm mutants in sorghum, which will provide insight into how sorghum plants accumulate such abundant EW on their aerial surface. This knowledge may facilitate the development of tools for engineering drought-tolerant crops with reduced water loss.
Tapping the US historic sweet sorghum collection to identify biofuel germplasm
Sweet sorghum [Sorghum bicolor (L.) Moench] has gained an important role as a viable alternative to fossil fuels and a more profitable option than maize and sugarcane. Nevertheless, the actual narrow genetic base in sweet sorghum breeding programs is limiting the development of new biofuel varietie...
Ruthrof, Katinka X; Steel, Emma; Misra, Sunil; McComb, Jen; O'Hara, Graham; Hardy, Giles E St J; Howieson, John
2018-06-01
Globally, land-use transition from mining to agriculture is becoming increasingly attractive and necessary for many reasons. However, low levels of necessary plant nutrients, and high levels of heavy metals, can hamper plant growth, affecting yield, and potentially, food safety. In post-phosphate mining substrates, for example, nitrogen (N) is a key limiting nutrient, and, although legumes are planted prior to cereals, N supplementation is still necessary. We undertook two field trials on Christmas Island, Australia, to determine whether Sorghum bicolor could be grown successfully in a post-phosphate mining substrate. The first trial investigated N (urea) demand (amount of N required for adequate crop growth) for S. bicolor, and whether N addition could reduce the naturally occurring cadmium (Cd) concentrations in the crop. The second trial examined whether slow release nitrogen fertilizers (SRF) could replace urea to increase biomass and reduce Cd concentrations. Our first trial demonstrated that S. bicolor has a high N demand, with the highest biomass being recorded in the 160kg/ha urea treatment. However, plants treated with 80, 120 and 160kg/ha were not significantly different from one another. After 7weeks of growth, leaf Cd concentrations were significantly lower for all urea treatments compared with the control plants. However, after 23weeks, seed Cd concentrations did not differ across treatments. Our second trial demonstrated that the application of SRF (Macracote® and Sulsync®) and 160kg/ha urea significantly increased biomass above the control plants. There was, however, no treatment response in terms of Cd or N concentrations in the seed at final harvest. Thus, we have shown that N is currently critical for S. bicolor, even following legume cropping, and that high biomass and a significant reduction in Cd can be attained with appropriate levels of urea. Our work has important implications for cereal growth and food safety in post-mining agriculture
Use of hybridization (F1 in forage sorghum (Sorghum bicolor (L. Moench breeding
Directory of Open Access Journals (Sweden)
Pataki Imre
2010-01-01
Full Text Available In plants with bisexual flowers, the development of hybrids and F1 seed production is only possible by using cytoplasmatic male sterility. The discovery of such sterility and the maintainers has made it possible to utilize the phenomenon of heterosis to improve yields and yield components in forage sorghum. It has been shown that the best way to develop forage sorghum hybrids is to cross grain sorghum as the female parent and Sudan grass as the male. The objective of this study was to develop a forage sorghum hybrid for the production of green matter to be used either fresh or for silage. The sorghum hybrid developed in these efforts (Siloking is intended for multiple cutting, as the basal nodes produce buds and regrowth takes place. The performance of the new hybrid with respect to yield and quality was compared to that of the forage sorghum cultivar NS Džin. In a two-year study conducted under different growing conditions in four locations, Siloking produced an average green matter yield of 86.29 t ha-1 (two cuts, a dry matter yield of 25.34 t ha-1, and a crude protein content of 11.85 %. Siloking outperformed NS Džin in terms of yield and quality. .
Radiation balance in the sweet sorghum crop
International Nuclear Information System (INIS)
Assis, F.N. de; Mendez, M.E.G.; Martins, S.R.; Verona, L.A.
1987-01-01
The fluxes of incident solar radiation, reflected and net radiation were measured during the growing cicle of two fields of sweet sorghum (Sorghum bicolor L.), cus. BR-501 and BR-503, maintained under convenient irrigation level. Resultant data allowed to estimate the crop albedo as well as the estimates of Rn. (M.A.C.) [pt
The environment strongly affects estimates of heterosis in hybrid sweet sorghum
Sweet sorghum (Sorghum bicolor (L.) Moench) has potential as a biofuel feedstock but hybrid cultivars are needed to support an industry based on this crop. The purpose of this study was to compare five inbred sweet sorghum lines and 15 hybrids derived from them, and to determine the extent of envir...
Achievements and problems in the weed control in grain sorghum (Sorghum Bicolor Moench.
Directory of Open Access Journals (Sweden)
Gr. Delchev
2017-09-01
Full Text Available Abstract. Chemical control has emerged as the most efficient method of weed control. Herbicides combinations and tank mixtures of herbicides with adjuvants, fertilizers, growth regulators, fungicides, insecticides are more effective than when applied alone on sorghum crops. Their combined use often leads to high synergistic effect on yield. The use of herbicide antidotes for the treatment of seeds in sorghum is a safe way to overcome its high sensitivity to many herbicides. Data regarding herbicide for chemical control of annual graminaceous weeds in sorghum crops are quite scarce even worldwide. Problem is the persistence of some herbicides used in the predecessors on succeeding crops, which is directly related to the weather conditions during their degradation. Most of the information on sorghum relates to the conventional technology for weed control. There is no information about the new Concep technology in grain sorghum. A serious problem is also the volunteers of the Clearfield and Express sun sunflower. They have resistance to herbicides different from that of conventional sunflower hybrids. There is no information yet in scientific literature on control of these volunteers.
DEFF Research Database (Denmark)
Gnanasekaran, Thiyagarajan; Karcher, Daniel; Nielsen, Agnieszka Janina Zygadlo
2016-01-01
. For this purpose, we stably engineered the dhurrin pathway from Sorghum bicolor into the chloroplasts of Nicotiana tabacum (tobacco). Dhurrin is a cyanogenic glucoside and its synthesis from the amino acid tyrosine is catalysed by two membrane-bound cytochrome P450 enzymes (CYP79A1 and CYP71E1) and a soluble...... glucosyltransferase (UGT85B1), and is dependent on electron transfer from a P450 oxidoreductase. The entire pathway was introduced into the chloroplast by integrating CYP79A1, CYP71E1, and UGT85B1 into a neutral site of the N. tabacum chloroplast genome. The two P450s and the UGT85B1 were functional when expressed...... compared to 6% in sorghum. The results obtained pave the way for plant P450s involved in the synthesis of economically important compounds to be engineered into the thylakoid membrane of chloroplasts, and demonstrate that their full catalytic cycle can be driven directly by photosynthesis-derived electrons....
Enhancement of photosynthesis in Sorghum bicolor by ultraviolet radiation
International Nuclear Information System (INIS)
Johnson, G.A.; Day, T.A.
2002-01-01
We assessed the influence of ultraviolet radiation (UV) on net photosynthetic CO 2 assimilation rate (Pn) in Sorghum bicolor, with particular attention to examining whether UV can enhance Pn via direct absorption of UV and absorption of UV-induced blue fluorescence by photosynthetic pigments. A polychromatic UV response spectrum of leaves was constructed by measuring Pn under different UV supplements using filters that had sharp transmission cut-offs from 280 to 382 nm, against a background of non-saturating visible light. When the abaxial surface was irradiated, P n averaged 4.6% higher with the UV supplement that cut-off UV at 311 nm, compared to lower and higher UV wavelength supplements. This former supplement differed from higher wavelength supplements by primarily providing more UV between 320 and 350 nm. To assess the possibility of direct absorption of UV by photosynthetic pigments, we measured the absorbance of extracted chlorophylls. Chlorophyll a had absorbance peaks at 340 and 389 nm that were 49 and 72% of that at the sorét peak. Chlorophyll b had absorbance peaks at 315 and 346 nm that were both 35% of that at the sorét peak. Since the epidermis transmits some UV, the strong UV absorbance of chlorophyll implies a potential role for irradiance beyond the bounds of the conventionally defined photosynthetically active radiation waveband (400–700 nm). To assess the role of absorption of UV-induced blue fluorescence, we measured the UV-induced fluorescence excitation and emission spectra of leaves. Abaxial excitation peaked at 328 nm, while emission peaked at 446 nm. In this analysis, we used our abaxial fluorescence excitation spectrum and the UV photosynthetic inhibition spectrum of Caldwell et al. (1986) to weight the UV irradiance with each cut-off filter, thereby estimating the potential contribution of UV-induced blue fluorescence to photosynthesis and the inhibitory effects of UV irradiance on photosynthesis, respectively. With a non
Antimicrobial evaluation of red, phytoalexin-rich sorghum food biocolorant
Akogou, Folachodé U.G.; Besten, Den Heidy M.W.; Polycarpe Kayodé, A.P.; Fogliano, Vincenzo; Linnemann, Anita R.
2018-01-01
Sorghum (Sorghum bicolor) extract is traditionally used as red biocolorant in West Africa to colour foods, among which wagashi, a soft cheese. This biocolorant is a source of the phytoalexin apigeninidin and phenolic acids, and users claim that it has preservative effects next to its colouring
Performance evaluation of biomass sorghum in Hawaii and Texas
Although biomass sorghum [Sorghum bicolor (L.) Moench] has been identified as a high yielding bioenergy feedstock crop on the continental USA, there is lack of conclusive data on its performance in HI. The objective of this study was to (i) determine the adaptability and productivity of two biomass...
Directory of Open Access Journals (Sweden)
Gómez G. Liliana Cecilia
2012-04-01
Full Text Available
Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibit better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.
Sweet Sorghum Crop. Effect of the Compost Application
International Nuclear Information System (INIS)
Negro, M. J.; Solano, M. L.; Carrasco, J.; Ciria, P.
1998-01-01
A 3 year-plot experiments were performed to determined the possible persistence of the positive effects of treating soil with compost. For this purpose, a sweet sorghum bagasse compost has been used. Experiments were achieved with sweet sorghum (Sorghum bicolor. L. Moench) vr Dale as energy crop. Similar sorghum productivities were obtained both in plots with consecutive compost applications and in plots amended with mineral fertilizers. No residual effect after three years has been detected. It could be due to the low dose of compost application. (Author) 27 refs
Directory of Open Access Journals (Sweden)
A.H Saeidnejad
2012-12-01
Full Text Available Recently, using the source of organic fertilizers and biofertilizers in sustainable crop production is growing. In order to evaluate the effect of organic compounds, biofertilizers and chemical fertilizer on morphological properties, yield and yield components of forage Sorghum (sorghum bicolor a field experiment was conducted in the Research Farm, College of Agriculture, Ferdowsi University of Mashhad in 2008.The treatments were seed inoculation with the combination of Azotobacter chroococcum and Azospirillum brasilense, Compost (15 t/ha, Vermicompost (10 t/ha, seed inoculation with Azotobacter and Azospirillum and compost (10t/ha, seed inoculation with Azotobacter chroococcum and Azospirillum brasilense and Vermicompost (7t/ha, seed inoculation with Pseudomonas flurescence, seed inoculation with Pseudomonas flurescence and Azotobacter chroococcum and Azospirillum brasilense combination, seed inoculation with Pseudomonas flurescence and compost (15t/ha, chemical fertilizer (80 kg/h urea fertilizer and 50 kg/h super phosphate fertilizer and control. Harvesting was performed in 2 cuts in flowering stage. Plant height, number of tiller per plant and SPAD reading was significantly affected by the treatments. Stem diameter was not affected by any treatments. There was a significant difference among all treatments in terms of fresh and dry forage yield. There were no significant differences among all treatments in terms of stem and leaf dry matter. In general, result of this experiment indicated that organic amendments and biofertilizers could be acceptable alternatives for chemical fertilizers.
Propriedades funcionais da semente do sorgo (Sorghum bicolor (L. Moench in natura e germinado
Directory of Open Access Journals (Sweden)
D. D. F. Leite
2016-01-01
Full Text Available A utilização de sementes germinadas na elaboração de produtos alimentícios com boa qualidade nutricional é uma possibilidade e o sorgo pode se apresentar como alternativa ao consumo dos cereais convencionais. O objetivo deste estudo foi de observar as alterações nos parâmetros físico-químicos da semente de sorgo antes e após o processo de germinação, assim como avaliar as propriedades funcionais indicando suas possíveis utilizações como ingrediente alimentar. As sementes germinadas apresentaram um aumento no teor proteico, passando de 4,32 para 7,20%, além da diminuição no teor de amido e consequente aumento no teor de açúcares redutores. A partir das propriedades funcionais avaliadas, a semente de sorgo germinada apresentou uma boa capacidade de absorção de óleo, podendo ser utilizado como ingrediente para auxiliar na textura e suculência de produtos. A germinação garantiu boa capacidade de formação de espuma e sua estabilidade, podendo ser utilizado como ingrediente em produtos alimentícios de fermentação, como bolos e biscoitos, além de bom agente de formação de gel podendo ser útil em sistemas alimentícios como pudim e lanches, que requerem espessamento e gelificação.Properties of sorghum seed Functional (Sorghum bicolor (L. Moench in natura and germinatedAbstract: The use of germinated seeds in the preparation of food products with good nutritional quality is a possibility and sorghum can be presented as an alternative to the consumption of conventional cereals. The objective of this study was to observe the changes in physical and chemical parameters of sorghum seed before and after the germination process, and assess the functional properties indicating their possible use as a food ingredient. Germinated seeds showed an increase in protein content, from 4.32 to 7.20% in addition to the decrease in the starch content and the consequent increase in reducing sugars. From the functional properties
Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions
Ghazi N. Al-Karaki; M. Al-Hashimi
2012-01-01
The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...
Identification of widely varying levels of resistance to meloidogyne incognita in sweet sorghum
Sweet sorghum (Sorghum bicolor) is a potential bioenergy crop that could be incorporated into annual cropping systems in the southern US, where it would likely be rotated with cotton. The desirability of including sweet sorghum in a cotton cropping system will be influenced by sweet sorghum’s host ...
An economic analysis of sweet sorghum cultivation for ethanol production in North China
Liu, H.; Ren, L.; Spiertz, J.H.J.; Zhu, Y.; Xie, G.H.
2015-01-01
Sweet sorghum [Sorghum bicolor (L.) Moench] is a promising non-food energy crop. The objective of this study was to determine the economic costs and input sensitivity of sweet sorghum compared to cotton, maize, and sunflower, at two saline-alkali sites in Shandong (Wudi County) and Inner Mongolia
Peña, Pamela A; Quach, Truyen; Sato, Shirley; Ge, Zhengxiang; Nersesian, Natalya; Dweikat, Ismail M; Soundararajan, Madhavan; Clemente, Tom
2017-12-01
The expression of a barley alanine aminotransferase gene impacts agronomic outcomes in a C3 crop, wheat. The use of nitrogen-based fertilizers has become one of the major agronomic inputs in crop production systems. Strategies to enhance nitrogen assimilation and flux in planta are being pursued through the introduction of novel genetic alleles. Here an Agrobacterium-mediated approach was employed to introduce the alanine aminotransferase from barley (Hordeum vulgare), HvAlaAT, into wheat (Triticum aestivum) and sorghum (Sorghum bicolor), regulated by either constitutive or root preferred promoter elements. Plants harboring the transgenic HvAlaAT alleles displayed increased alanine aminotransferase (alt) activity. The enhanced alt activity impacted height, tillering and significantly boosted vegetative biomass relative to controls in wheat evaluated under hydroponic conditions, where the phenotypic outcome across these parameters varied relative to time of year study was conducted. Constitutive expression of HvAlaAT translated to elevation in wheat grain yield under field conditions. In sorghum, expression of HvAlaAT enhanced enzymatic activity, but no changes in phenotypic outcomes were observed. Taken together these results suggest that positive agronomic outcomes can be achieved through enhanced alt activity in a C3 crop, wheat. However, the variability observed across experiments under greenhouse conditions implies the phenotypic outcomes imparted by the HvAlaAT allele in wheat may be impacted by environment.
Three sorghum serpin recombinant proteins inhibit midgut trypsin activity and growth of corn earworm
The sorghum (Sorghum bicolor) genome contains at least 17 putative serpin (serine protease inhibitor) open reading frames, some of which are induced by pathogens. Recent transcriptome studies found that most of the putative serpins are expressed but their roles are unknown. Four sorghum serpins were...
The fall armyworm [Spodoptera frugiperda (Lepidoptera: Noctuidae)] is an economically important pest of sorghum [Sorghum bicolor (L) Moench]. However, resistance to fall armyworm in sweet sorghum has not been extensively studied. A collection of primarily sweet sorghum accessions were evaluated in t...
Prospecting for Energy-Rich Renewable Raw Materials: Sorghum Stem Case Study.
Byrt, Caitlin S; Betts, Natalie S; Tan, Hwei-Ting; Lim, Wai Li; Ermawar, Riksfardini A; Nguyen, Hai Yen; Shirley, Neil J; Lahnstein, Jelle; Corbin, Kendall; Fincher, Geoffrey B; Knauf, Vic; Burton, Rachel A
2016-01-01
Sorghum vegetative tissues are becoming increasingly important for biofuel production. The composition of sorghum stem tissues is influenced by genotype, environment and photoperiod sensitivity, and varies widely between varieties and also between different stem tissues (outer rind vs inner pith). Here, the amount of cellulose, (1,3;1,4)-β-glucan, arabinose and xylose in the stems of twelve diverse sorghum varieties, including four photoperiod-sensitive varieties, was measured. At maturity, most photoperiod-insensitive lines had 1% w/w (1,3;1,4)-β-glucan in stem pith tissue whilst photoperiod-sensitive varieties remained in a vegetative stage and accumulated up to 6% w/w (1,3;1,4)-β-glucan in the same tissue. Three sorghum lines were chosen for further study: a cultivated grain variety (Sorghum bicolor BTx623), a sweet variety (S. bicolor Rio) and a photoperiod-sensitive wild line (S. bicolor ssp. verticilliflorum Arun). The Arun line accumulated 5.5% w/w (1,3;1,4)-β-glucan and had higher SbCslF6 and SbCslH3 transcript levels in pith tissues than did photoperiod-insensitive varieties Rio and BTx623 (<1% w/w pith (1,3;1,4)-β-glucan). To assess the digestibility of the three varieties, stem tissue was treated with either hydrolytic enzymes or dilute acid and the release of fermentable glucose was determined. Despite having the highest lignin content, Arun yielded significantly more glucose than the other varieties, and theoretical calculation of ethanol yields was 10 344 L ha-1 from this sorghum stem tissue. These data indicate that sorghum stem (1,3;1,4)-β-glucan content may have a significant effect on digestibility and bioethanol yields. This information opens new avenues of research to generate sorghum lines optimised for biofuel production.
Prospecting for Energy-Rich Renewable Raw Materials: Sorghum Stem Case Study.
Directory of Open Access Journals (Sweden)
Caitlin S Byrt
Full Text Available Sorghum vegetative tissues are becoming increasingly important for biofuel production. The composition of sorghum stem tissues is influenced by genotype, environment and photoperiod sensitivity, and varies widely between varieties and also between different stem tissues (outer rind vs inner pith. Here, the amount of cellulose, (1,3;1,4-β-glucan, arabinose and xylose in the stems of twelve diverse sorghum varieties, including four photoperiod-sensitive varieties, was measured. At maturity, most photoperiod-insensitive lines had 1% w/w (1,3;1,4-β-glucan in stem pith tissue whilst photoperiod-sensitive varieties remained in a vegetative stage and accumulated up to 6% w/w (1,3;1,4-β-glucan in the same tissue. Three sorghum lines were chosen for further study: a cultivated grain variety (Sorghum bicolor BTx623, a sweet variety (S. bicolor Rio and a photoperiod-sensitive wild line (S. bicolor ssp. verticilliflorum Arun. The Arun line accumulated 5.5% w/w (1,3;1,4-β-glucan and had higher SbCslF6 and SbCslH3 transcript levels in pith tissues than did photoperiod-insensitive varieties Rio and BTx623 (<1% w/w pith (1,3;1,4-β-glucan. To assess the digestibility of the three varieties, stem tissue was treated with either hydrolytic enzymes or dilute acid and the release of fermentable glucose was determined. Despite having the highest lignin content, Arun yielded significantly more glucose than the other varieties, and theoretical calculation of ethanol yields was 10 344 L ha-1 from this sorghum stem tissue. These data indicate that sorghum stem (1,3;1,4-β-glucan content may have a significant effect on digestibility and bioethanol yields. This information opens new avenues of research to generate sorghum lines optimised for biofuel production.
Directory of Open Access Journals (Sweden)
Juárez-Cisneros Gladys
2014-11-01
Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.
Inclusion of sweet sorghum flour in bread formulations | Araujo ...
African Journals Online (AJOL)
Sweet sorghum (Sorghum bicolor L. Moench) has been studied as an additional source of raw material for production or partial replacement of foods due to its high fiber concentration. Its consumption is associated with the prevention of some diseases and nutritional benefits. The aim of this study was to evaluate the partial ...
Performance of elite grain sorghum varieties in the West Nile Agro ...
African Journals Online (AJOL)
ACSS
Ouma, J.P. and Akuja, T.E. 2013. Agronomic and morphological performance of sorghum (Sorghum bicolor L.) for the dry highlands of. Kenya. www.m.elewa.org. Schatz, B.G., Schneiter, A.A. and Gardner,. J.E. 1987. Effect of plant density on grain sorghum production in North. Dakota. pp. 16-17. Snider, J.L., Randy, L.R. and ...
Directory of Open Access Journals (Sweden)
P. Hima Kumari
2018-05-01
Full Text Available Na+ transporters play an important role during salt stress and development. The present study is aimed at genome-wide identification, in silico analysis of sodium-proton antiporter (NHX and sodium-proton exchanger (NHE-type transporters in Sorghum bicolor and their expression patterns under varied abiotic stress conditions. In Sorghum, seven NHX and nine NHE homologs were identified. Amiloride (a known inhibitor of Na+/H+ exchanger activity binding motif was noticed in both types of the transporters. Chromosome 2 was found to be a hotspot region with five sodium transporters. Phylogenetic analysis inferred six ortholog and three paralog groups. To gain an insight into functional divergence of SbNHX/NHE transporters, real-time gene expression was performed under salt, drought, heat, and cold stresses in embryo, root, stem, and leaf tissues. Expression patterns revealed that both SbNHXs and SbNHEs are responsive either to single or multiple abiotic stresses. The predicted protein–protein interaction networks revealed that only SbNHX7 is involved in the calcineurin B-like proteins (CBL- CBL interacting protein kinases (CIPK pathway. The study provides insights into the functional divergence of SbNHX/NHE transporter genes with tissue specific expressions in Sorghum under different abiotic stress conditions.
Registration of six grain sorghum pollinator (R) lines
Six sorghum [Sorghum bicolor (L.) Moench] pollinators [KS142R (Reg. No. PI XXXX), KS143R (Reg. No. PI XXXX), KS144R (Reg.No. PI XXXX), KS145R (Reg. No. PI XXXX), KS146R (Reg. No. PI XXXX) and KS147R (Reg. No. PI XXXX) were developed from random mating using a recurrent selection followed by pedigree...
Sorghum cobalt analysis on not determined wave length with atomic ...
African Journals Online (AJOL)
This study was to know the better wave length on measuring cobalt content in forage sorghum hybrid (Sorghum bicolor) with an atomic absorption spectrophotometer. The analysis was on background correction mode with three wave lengths; 240.8, 240.7 (determined wave length or recommended wave length) and 240.6 ...
Jun, Se-Young; Walker, Alexander M; Kim, Hoon; Ralph, John; Vermerris, Wilfred; Sattler, Scott E; Kang, ChulHee
2017-08-01
Cinnamyl alcohol dehydrogenase (CAD) catalyzes the final step in monolignol biosynthesis, reducing sinapaldehyde, coniferaldehyde, and p -coumaraldehyde to their corresponding alcohols in an NADPH-dependent manner. Because of its terminal location in monolignol biosynthesis, the variation in substrate specificity and activity of CAD can result in significant changes in overall composition and amount of lignin. Our in-depth characterization of two major CAD isoforms, SbCAD2 (Brown midrib 6 [bmr6]) and SbCAD4, in lignifying tissues of sorghum ( Sorghum bicolor ), a strategic plant for generating renewable chemicals and fuels, indicates their similarity in both structure and activity to Arabidopsis ( Arabidopsis thaliana ) CAD5 and Populus tremuloides sinapyl alcohol dehydrogenase, respectively. This first crystal structure of a monocot CAD combined with enzyme kinetic data and a catalytic model supported by site-directed mutagenesis allows full comparison with dicot CADs and elucidates the potential signature sequence for their substrate specificity and activity. The L119W/G301F-SbCAD4 double mutant displayed its substrate preference in the order coniferaldehyde > p -coumaraldehyde > sinapaldehyde, with higher catalytic efficiency than that of both wild-type SbCAD4 and SbCAD2. As SbCAD4 is the only major CAD isoform in bmr6 mutants, replacing SbCAD4 with L119W/G301F-SbCAD4 in bmr6 plants could produce a phenotype that is more amenable to biomass processing. © 2017 American Society of Plant Biologists. All Rights Reserved.
Sorghum as an alternative of cultivation to maize; Sorghumhirse als Anbaualternative zum Mais
Energy Technology Data Exchange (ETDEWEB)
Jaekel, Kerstin; Theiss, Markus; Poetzschke, Karen [Saechsisches Landesamt fuer Umwelt, Landwirtschaft und Geologie (LfULG), Dresden (Germany)] [and others
2013-10-01
Due to their high dry matter yield potential Sorghum bicolor and Sorghum bicolor x sudanense are well fitted as feedstock for biogas production. Similar to maize, both species show a high efficiency in their use of water (C4-plants). However, Sorghum has a higher drought tolerance in comparison with maize but is more sensitive to low temperatures. Hence a cultivation of Sorghum is recommendable especially in dry and relatively warm regions, including recultivated areas and even on loess soil, provided that the required temperatures are given. Due to the fact that Sorghum is not affected by the corn root worm, it also could gain relevance in regions were the cultivation of maize is restricted. Furthermore, Sorghum is usable as a catch crop as well as a main crop because of its variable sowing time. Catch crop cultivation, however, yields a significantly lower amount of dry matter and -quality which is a result of its shorter vegetation period. Owing to its higher crude fiber concentration Sorghum achieves a lower theoretically attainable specific methane yield (Weissbach) than maize. Thus only on rare occasions Sorghum does achieve methane yields per hectare that are comparable to maize. Eventually, the competitiveness of Sorghum greatly depends on provision of enhanced cultivars achieved through genetic improvement. (orig.)
Potential of multiseeded mutant (msd) to boost sorghum grain yield
Seed number per plant is an important determinant of the grain yield in cereal and other crops. We have isolated a class of multiseeded (msd) sorghum (Sorghum bicolor L. Moench) mutants that are capable of producing three times the seed number and twice the seed weight per panicle as compared with t...
Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...
Dhurrin content relates to sorghum (Sorghum bicolor (L) Moench) seedling growth in marginal soils.
Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has b...
Dhurrin content relates to sorghum [sorghum bicolor (L.) Moench] seedling growth in marginal soils
Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has ...
DEFF Research Database (Denmark)
Mehmood, Sajid; Gulfraz, M.; Rana, N. F.
2009-01-01
The objective of this work was to find the best combination of different experimental conditions during pre-treatment, enzymatic saccharification, detoxification of inhibitors and fermentation of Sorghum bicolor straw for ethanol production. The optimization of pre-treatment using different...... were used in order to increase the monomeric sugar during enzymatic hydrolysis and it has been observed that the addition of these surfactants contributed significantly in cellulosic conversion but no effect was shown on hemicellulosic hydrolysis. Fermentability of hydrolyzate was tested using...... Saccharomyces cerevisiae Ethanol Red (TM) and it was observed that simultaneous saccharification and fermentation ( SSF) with both batch and fed batch resulted in better ethanol yield as compared to separate hydrolysis and fermentation ( SHF). Detoxification of furan during SHF facilitated reduction...
International Nuclear Information System (INIS)
Kurdali, F.; Khalifa, K.; Janat, M.
2001-09-01
A field experiment on Sesbania aculeata and Sorghum bicolor grown in mono cropping and in inter cropping systems was conducted under non-saline conditions (soil EC e 0.16, water EC w 1dS/m) to evaluate dry matter production, total N yield, soil N uptake and N 2 -fixation using 15 N isotope dilution method. Three different row ratios of sesbania (ses) and sorghum (sor) were subjected in the inter cropping system (2ses: 1sot; 1ses: 1sor and 1ses: 2sor row ratio). Dry matter yield of sole sorghum was higher than that of sole sesbania, and it was similar to that produced by the inter cropping treatments. However, total N yield of sole sorghum was significantly the lowest, with no differences being obtained between sole sesbania and inter cropping treatments. The LERs of total N yield were, in all cases, higher than 1, reflecting a greater advantage of inter cropping system in terms of land use efficiency. Percentages of N 2 fixation in the inter cropped sesbania were considerably enhanced compared with the pure stand of sesbania. This was mainly attributed to the depletion of soil N resulting from the greater apparent competitiveness of sorghum for soil N, and consequently, a greater dependence of sesbania on N 2 fixation. However, the degree of the intraspecific competition for soil N uptake was affected by the proportion of crops in the mixture, and it was considerably reduced in the 2ses: 1sor row ratio. This was demonstrated when an equal depletion of soil and fertilizer N uptake occurred for both crops. We excluded in all-inter cropping treatments the possibility of N transfer from sesbania to sorghum. Row inter cropping, with crops grown in alternation of two rows of sesbania with one row of sorghum, seemed to be the most adequate row ratio in terms of total N yield, LER, N 2 -fixation and soil N uptake balance of the component crops. (author)
Directory of Open Access Journals (Sweden)
S Hasibi
2016-12-01
Full Text Available Introduction Nowadays, salinity is one of the limiting factors for crop production in arid and semi-arid regions. On the other hand, sorghum (Sorghum bicolor L. is a self-pollinated and short-day plant, which partly has been adapted to salinity and water stress conditions; also play an important role in humans, livestock and poultry nourishments. All studies have showed the positive effects of Silicon on growth and yield of plants in both normal and stress conditions. The aim of this experiment was to improve salinity tolerance of Sorghum by application of Silicon. Materials and Methods A split plot experiment based on randomized complete block design with three replications in both normal and salt stress conditions was carried out at research farm of Shahid Bahonar University of Kerman in 2013. Silicon treatments (0 and 6 mM were considered as main plot and various sorghum genotypes (payam, sepideh, TN-4-70, TN-04-71, TN-04-39, TN-04-107, TN-04-100, TN-04-37, TN-04-68, TN-04-83, TN-04-62 and TN-04-95 were assigned to sub plots. The sodium silicate was used as silica source. The data were analyzed by SAS software using combine analysis. Means comparisons were accomplished by Duncan multiple range test at 5% probability level. Some of the measured traits were as follow: Relative water content (Ritchie and Nguyen, 1990, Relative permeability (33, leaf area index and chlorophyll index (by SPAD. Results and Discussion According to the results, use of silicon led to increase of RWC under salinity stress, while RWC decreased by 13% when no silicon applied. Salinity significantly decreased 1000-grain weight. Maximum grain yield obtained from TN-04-37 (987.6 g m-2 under normal condition with foliar application of silicon. Application of silicon under stress condition led to 38% increase in grain yield of Sepideh compared to control. Under salt stress, silicon also increased shoot dry weight in TN-04-107, TN-04-70, TN-04-37, Payam and Sepideh genotypes
Characterization of novel multi-seeded (msd) mutants of sorghum for increasing grain number
The tribe Andropogoneae of the Poaceae family exhibits highly branched inflorescence known as panicle or tassel. Characteristically, each spikelet in a panicle or tassel comprise of a combination of sessile/fertile and sterile florets. In sorghum, (Sorghum bicolor L. Moench), the existing cultivars ...
As diet is one of the major controllable factors in cancer development, potentially chemopreventive foods are of significant interest to public health. One such food is sorghum (Sorghum bicolor), a cereal grain that contains varying concentrations of polyphenols. In a panel of 15 sorghum germplasm...
Characterization of novel Brown midrib 6 mutations affecting lignin biosynthesis in sorghum
The presence of lignin reduces the quality of lignocellulosic biomass for forage materials and feedstock for biofuels. In C4 grasses, the brown midrib phenotype has been linked to mutations to genes in the monolignol biosynthesis pathway. For example, the Bmr6 gene in sorghum (Sorghum bicolor) has b...
Genetic diversity of sweet sorghum germplasm in Mexico using AFLP and SSR markers
The objective of this work was to evaluate the diversity and genetic relationships between lines and varieties of the sweet sorghum (Sorghum bicolor) germplasm bank of the National Institute for Forestry, Agriculture and Livestock Research, Mexico, using AFLP and SSR markers. The molecular markers ...
Effect of sowing date on grain quality of sorghum ( Sorghum bicolor ...
African Journals Online (AJOL)
IVHAA) while minerals; iron and zinc were determined using Atomic Absorption Spectrophotometry. Significant site by variety by sowing date interactions at P < 0.05 level of probability were obtained for protein, iron and zinc content of sorghum ...
Yield and forage value of a dual-purpose bmr-12 sorghum hybrid
Grain sorghum [Sorghum bicolor (L.) Moench] is an important crop for rainfed production systems with 2.7 million ha grown in the USA in 2013. The brown-midrib (bmr) mutations, especially bmr-12, have resulted in low stover lignin and high fiber digestibility without reducing grain yield in some sor...
Sorghum [Sorghum bicolor (L.) Moench] is valued for bioenergy, feed and food. Potential of sorghum genotypes to support differing populations of root- and soil-associated fluorescent Pseudomonas spp. or Fusarium spp., in two soils, was assessed. Pseudomonads and Fusarium spp. were assessed from root...
International Nuclear Information System (INIS)
Kurdali, F.; Khalifa, K.; Janat, M.
2001-09-01
A field experiment was conducted under saline conditions (soil EC e 15, water EC w 8 dS/m/m) to evaluate the performance of sole crops and inter crops of Sesbania aculeata and Sorghum bicolor (1:1 row ratio) in terms of dry matter production, total N yield, soil N uptake and N 2 -fixation using 15 N isotope dilution method. Dry matter yield in sole crop of sesbania was significantly higher that that of sole sorghum; whereas, that of the inter cropping was significantly lower than sole sesbania, but was similar to that produced by sole sorghum. Total nitrogen yield in sole sesbania was four-fold than that accumulated in sole sorghum, whereas, that of mixed cropping was 2.6 fold compared to that of sole sorghum. The LER of total N yield was higher than 1 reflecting a greater advantage of inter cropping system in terms of land use efficiency. The proportion of N derived from N 2 fixation (%Ndfa) in the sesbania was increased from 63 to 79%, for sole and inter cropping system, respectively. There was no evidence of a significant transfer of N from the sesbania to the sorghum. Results on the relative growth of plants on saline soil compared with non-saline soil clearly demonstrated that sesbania was more salt tolerant than the sorghum. soil nitrogen uptake by plants, particularly in sorghum, was adversely affected by salinity. However, amounts of N 2 fixed by sole sesbania grown is saline soil was close or even higher than on non-saline soil. The use of inter cropping systems of legumes and non-legumes could be a promising agricultural approach to reutilize wasted lands, after a careful selection of appropriate tolerant genotypes to prevailing saline conditions. (author)
Directory of Open Access Journals (Sweden)
Liliana Gómez G
2012-01-01
Full Text Available Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibith better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.
Diurnal oscillation of SBE expression in sorghum endosperm
Energy Technology Data Exchange (ETDEWEB)
Sun, Chuanxin; Mutisya, J.; Rosenquist, S.; Baguma, Y.; Jansson, C.
2009-01-15
Spatial and temporal expression patterns of the sorghum SBEI, SBEIIA and SBEIIB genes, encoding, respectively, starch branching enzyme (SBE) I, IIA and IIB, in the developing endosperm of sorghum (Sorghum bicolor) were studied. Full-length genomic and cDNA clones for sorghum was cloned and the SBEIIA cDNA was used together with gene-specific probes for sorghum SBEIIB and SBEI. In contrast to sorghum SBEIIB, which was expressed primarily in endosperm and embryo, SBEIIA was expressed also in vegetative tissues. All three genes shared a similar temporal expression profile during endosperm development, with a maximum activity at 15-24 days after pollination. This is different from barley and maize where SBEI gene activity showed a significantly later onset compared to that of SBEIIA and SBEIIB. Expression of the three SBE genes in the sorghum endosperm exhibited a diurnal rhythm during a 24-h cycle.
Techno-economic assessment of Levulinic Acid Plant from Sorghum Bicolor in Indonesia
Gozan, M.; Ryan, B.; Krisnandi, Y.
2018-04-01
The increasing need of energy is one of the main energy security issues in Indonesia. Hence, alternative energy is needed. Levulinic acid (LA) is among chemical platform used in the synthesis for avariety of high-value materials, such as fuels and commodity chemicals. It is predicted that global LA market demand to reach 3.1 tons in 2016. This study examines industrial processdesign and economic analysis for LA production in Indonesia.Sorghum bicolor was used as feed because of its high cellulose, low lignin contents and availability in Indonesia. The conventional economic problem from biomass based production was diminished sincethe valuable waste from pretreatment processwas sold to otherindustry.This plant was recommended to be built in an industrial estate area in Jawa Timur (East Java) province. Results from simulation using SuperPro Designer 9.0 was used for the techno-economic assessment.The plant assessment showed that the minimum production capacity was 7.7 ton per day to achieve an internal rate of return (IRR) and payback period (PBP) values of 19.61% and 3.93 years, respectively. Sensitivity analysis showed that product selling price was the most predominant factor for IRR, NPV, PBP and ROI. Raw material and water had low effects on those economic parameters. These values indicated that LA plant was feasible to be built in Indonesia.
Dowd, Patrick F; Sattler, Scott E
2015-01-01
The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.
Hernández-Calderón, Erasto; Aviles-Garcia, Maria Elizabeth; Castulo-Rubio, Diana Yazmín; Macías-Rodríguez, Lourdes; Ramírez, Vicente Montejano; Santoyo, Gustavo; López-Bucio, José; Valencia-Cantero, Eduardo
2018-02-01
Our results show that Sorghum bicolor is able to recognize bacteria through its volatile compounds and differentially respond to beneficial or pathogens via eliciting nutritional or defense adaptive traits. Plants establish beneficial, harmful, or neutral relationships with bacteria. Plant growth promoting rhizobacteria (PGPR) emit volatile compounds (VCs), which may act as molecular cues influencing plant development, nutrition, and/or defense. In this study, we compared the effects of VCs produced by bacteria with different lifestyles, including Arthrobacter agilis UMCV2, Bacillus methylotrophicus M4-96, Sinorhizobium meliloti 1021, the plant pathogen Pseudomonas aeruginosa PAO1, and the commensal rhizobacterium Bacillus sp. L2-64, on S. bicolor. We show that VCs from all tested bacteria, except Bacillus sp. L2-64, increased biomass and chlorophyll content, and improved root architecture, but notheworthy A. agilis induced the release of attractant molecules, whereas P. aeruginosa activated the exudation of growth inhibitory compounds by roots. An analysis of the expression of iron-transporters SbIRT1, SbIRT2, SbYS1, and SbYS2 and genes related to plant defense pathways COI1 and PR-1 indicated that beneficial, pathogenic, and commensal bacteria could up-regulate iron transporters, whereas only beneficial and pathogenic species could induce a defense response. These results show how S. bicolor could recognize bacteria through their volatiles profiles and highlight that PGPR or pathogens can elicit nutritional or defensive traits in plants.
Simulating the probability of grain sorghum maturity before the first frost in northeastern Colorado
Expanding grain sorghum [Sorghum bicolor (L.) Moench] production northward from southeastern Colorado is thought to be limited by shorter growing seasons due to lower temperatures and earlier frost dates. This study used a simulation model for predicting crop phenology (PhenologyMMS) to predict the ...
International Nuclear Information System (INIS)
Ali, Tahira Mohsin; Hasnain, Abid
2013-01-01
Highlights: ► Sorghum starches were chemically modified. ► Starch–lipid complexes were studied in the presence of emulsifiers. ► Type II complexes were also detected in native and oxidized starches on adding GMS. ► Starch–lipid complexes sharply reduced retrogradation in modified starches. - Abstract: The effect of emulsifiers on complexation and retrogradation characteristics of native and chemically modified white sorghum starches was studied. Complex forming tendency of white sorghum starch with commercially available emulsifiers GMS and DATEM improved after acetylation. Presence of emulsifiers reduced λ max (wavelength of maximum absorbance) both for native and modified sorghum starches suggesting lower availability of amylose chains to complex with iodine. In native white sorghum starch (NWSS) and oxidized white sorghum starch (OWSS), both Type I and Type II starch–lipid complexes were observed on addition of 1.0% GMS prior to gelatinization. Acetylated-oxidized white sorghum starch (AOWSS) formed weakest complexes among all the modified starches. The results revealed that antistaling characteristics of modified sorghum starches were enhanced when used in combination with emulsifiers. The most prominent decline in reassociative capability among modified starches was observed for acetylated starches.
Inheritance and molecular mapping of anthracnose resistance genes present in sorghum line SC112-14
Anthracnose (Colletotrichum sublineolum) is one of the most destructive diseases of sorghum (Sorghum bicolor L. Moench) affecting all aerial tissues of the plant. The most effective strategy for its control is the incorporation of resistance genes. Therefore, the anthracnose resistance response pr...
Effect of Fungicide Applications on Grain Sorghum (Sorghum bicolor L. Growth and Yield
Directory of Open Access Journals (Sweden)
Dan D. Fromme
2017-01-01
Full Text Available Field studies were conducted in the upper Texas Gulf Coast and in central Louisiana during the 2013 through 2015 growing seasons to evaluate the effects of fungicides on grain sorghum growth and development when disease pressure was low or nonexistent. Azoxystrobin and flutriafol at 1.0 L/ha and pyraclostrobin at 0.78 L/ha were applied to the plants of two grain sorghum hybrids (DKS 54-00, DKS 53-67 at 25% bloom and compared with the nontreated check for leaf chlorophyll content, leaf temperature, and plant lodging during the growing season as well as grain mold, test weight, yield, and nitrogen and protein content of the harvested grain. The application of a fungicide had no effect on any of the variables tested with grain sorghum hybrid responses noted. DKS 53-67 produced higher yield, greater test weight, higher percent protein, and N than DKS 54-00. Results of this study indicate that the application of a fungicide when little or no disease is present does not promote overall plant health or increase yield.
75 FR 41392 - Sorghum Promotion and Research Program: Procedures for the Conduct of Referenda
2010-07-16
... voting procedures, eligibility, disposition of forms and records, FSA's role, and reporting the results... means any harvested portion of Sorghum bicolor (L.) Moench or any related species of the genus Sorghum... of the forms and records. FSA would coordinate State and county FSA roles in conducting the...
Sorghum [Sorghum bicolor (L.) Moench] is valued for bioenergy, feed and food. Aims: Potential of sorghum genotypes to support differing populations of root- and soil-associated fluorescent Pseudomonas spp. or Fusarium spp., in two soils, was assessed. Methods: Culturable pseudomonads were enumerated...
Maturation curves of sweet sorghum genotypes
Directory of Open Access Journals (Sweden)
Renan Silva e Souza
2016-02-01
Full Text Available ABSTRACT Sweet sorghum [Sorghum bicolor (L. Moench] stands out as a complementary crop to sugarcane Saccharum spp. for the production of ethanol, since it has juicy stems with directly fermentable sugars. Due to this fact, there is a need for the analysis of sweet sorghum properties in order to meet the agro-industry demand. This work aimed to develop and study the maturation curves of seven sweet sorghum cultivars in ten harvest dates. The results showed a significant difference between cultivars and harvest dates for all parameters analysed (p≤0.01. Regarding the sugar content, the cultivars BRS508, XBWS80147 and CMSX629 showed the highest means for the total reducing sugars (TRS and recoverable sugar (RS. In the production of ethanol per tonne of biomass (EP, the cultivars BRS508 and CMSX629 presented the best results.
Directory of Open Access Journals (Sweden)
Sánchez-Yáñez Juan Manuel
2015-11-01
Full Text Available In soil spill a high concentration of waste motor oil (WMO it´s causing lost soil fertility, which is solved by remediation, but is expensive and polluting, an ecological alternative is bioremediation (BR by biostimulation follow by phytoremediation (PY with Sorghum bicolor using Burkholderia cepacia and Penicillium chrysogenum, promoting growth plant microorganisms (PGPM at concentration value below to the maximum according to NOM-138 SEMARNAT/SS-2003 de 4400 ppm/Kg soil. The objectives of this research were a bioremediation of soil contaminated by high WMO concentrations by biostimulation with mineral solution and Vicia sativa as green manure (GM, and subsequent b phytoremediation by S. bicolor with B. cepacia and P. chrysogenum to reduce remaining WMO at concentration below to maximum according to NOM-138 SEMARNAT/SS-2003. The results showed that biostimulation with mineral solution and V. sativa reduced WMO from 55000 to 33400 ppm, and from 65000 to 24300 ppm. Follow by PY by S. bicolor with B. cepacia and P. chrysogenum decreased WMO from 33400 ppm to 210 ppm, and from 24300 ppm to 360 ppm, compared to soil as negative control in which WMO did not change by natural attenuation. This suggests that to integrate BR and PY is an ecological option instead to apply chemical technique expensive and causing environmental pollution.
Directory of Open Access Journals (Sweden)
Adugna Abdi Woldesemayat
Full Text Available Crop response to the changing climate and unpredictable effects of global warming with adverse conditions such as drought stress has brought concerns about food security to the fore; crop yield loss is a major cause of concern in this regard. Identification of genes with multiple responses across environmental stresses is the genetic foundation that leads to crop adaptation to environmental perturbations.In this paper, we introduce an integrated approach to assess candidate genes for multiple stress responses across-species. The approach combines ontology based semantic data integration with expression profiling, comparative genomics, phylogenomics, functional gene enrichment and gene enrichment network analysis to identify genes associated with plant stress phenotypes. Five different ontologies, viz., Gene Ontology (GO, Trait Ontology (TO, Plant Ontology (PO, Growth Ontology (GRO and Environment Ontology (EO were used to semantically integrate drought related information.Target genes linked to Quantitative Trait Loci (QTLs controlling yield and stress tolerance in sorghum (Sorghum bicolor (L. Moench and closely related species were identified. Based on the enriched GO terms of the biological processes, 1116 sorghum genes with potential responses to 5 different stresses, such as drought (18%, salt (32%, cold (20%, heat (8% and oxidative stress (25% were identified to be over-expressed. Out of 169 sorghum drought responsive QTLs associated genes that were identified based on expression datasets, 56% were shown to have multiple stress responses. On the other hand, out of 168 additional genes that have been evaluated for orthologous pairs, 90% were conserved across species for drought tolerance. Over 50% of identified maize and rice genes were responsive to drought and salt stresses and were co-located within multifunctional QTLs. Among the total identified multi-stress responsive genes, 272 targets were shown to be co-localized within QTLs
The productivity and profitability of sorghum [Sorghum bicolor (L.) Moench] is reduced by susceptibility to fungal diseases such as anthracnose, which causes yield loss of both grain and biomass. A limited number of resistant accessions are present in temperate adapted germplasm, while resistant sou...
Energy Technology Data Exchange (ETDEWEB)
Kurdali, F; Khalifa, K; Janat, M [Atomic Energy Commission, Damascus (Syrian Arab Republic). Dept. of Agriculture
2001-09-01
A field experiment on Sesbania aculeata and Sorghum bicolor grown in mono cropping and in inter cropping systems was conducted under non-saline conditions (soil EC{sub e} 0.16, water EC{sub w}1dS/m) to evaluate dry matter production, total N yield, soil N uptake and N{sub 2}-fixation using {sup 15}N isotope dilution method. Three different row ratios of sesbania (ses) and sorghum (sor) were subjected in the inter cropping system (2ses: 1sot; 1ses: 1sor and 1ses: 2sor row ratio). Dry matter yield of sole sorghum was higher than that of sole sesbania, and it was similar to that produced by the inter cropping treatments. However, total N yield of sole sorghum was significantly the lowest, with no differences being obtained between sole sesbania and inter cropping treatments. The LERs of total N yield were, in all cases, higher than 1, reflecting a greater advantage of inter cropping system in terms of land use efficiency. Percentages of N{sub 2} fixation in the inter cropped sesbania were considerably enhanced compared with the pure stand of sesbania. This was mainly attributed to the depletion of soil N resulting from the greater apparent competitiveness of sorghum for soil N, and consequently, a greater dependence of sesbania on N{sub 2} fixation. However, the degree of the intraspecific competition for soil N uptake was affected by the proportion of crops in the mixture, and it was considerably reduced in the 2ses: 1sor row ratio. This was demonstrated when an equal depletion of soil and fertilizer N uptake occurred for both crops. We excluded in all-inter cropping treatments the possibility of N transfer from sesbania to sorghum. Row inter cropping, with crops grown in alternation of two rows of sesbania with one row of sorghum, seemed to be the most adequate row ratio in terms of total N yield, LER, N{sub 2}-fixation and soil N uptake balance of the component crops. (author)
Sorghum [Sorghum bicolor (L.) Moench] is valued for bioenergy, feed and food. Potential of sorghum genotypes to support differing populations of root- and soil-associated fluorescent Pseudomonas spp. or Fusarium spp., in two soils, was assessed. Pseudomonad and Fusarium numbers were assessed from ro...
75 FR 70573 - Sorghum Promotion and Research Program: Procedures for the Conduct of Referenda
2010-11-18
... definitions, certification and voting procedures, eligibility, disposition of forms and records, the role of... means any harvested portion of Sorghum bicolor (L.) Moench or any related species of the genus Sorghum... disposition of the forms and records. FSA will coordinate State and county FSA roles in conducting the...
Cover crop and N fertilization may maintain soil C and N levels under sweet sorghum (Sorghum bicolor [L.] Moench) biomass harvested for bioenergy production. The effect of cover crops (hairy vetch [Vicia villosa Roth], rye [Secaele cereale L.], hairy vetch/rye mixture, and the control [no cover crop...
Sorghum (Sorghum bicolor L. Moench) cultivars and germplasm display branched inflorescence or panicle, characterized by spikelets composed of a single sessile, fertile floret that develop into viable seed and one or two adjacent sterile pedicellate florets (Monoseeded [MSD] trait). Based on total nu...
Directory of Open Access Journals (Sweden)
Thierry E. Besançon
2016-01-01
Full Text Available Dicamba and 2,4-D are among the most common and inexpensive herbicides used to control broadleaf weeds. However, different studies have pointed the risk of crop injury and grain sorghum yield reduction with postemergence applications of 2,4-D. No research data on grain sorghum response to 2,4-D or dicamba exists in the Southeastern United States. Consequently, a study was conducted to investigate crop growth and yield response to 2,4-D (100, 220, and 330 g acid equivalent ha−1 and dicamba (280 g acid equivalent ha−1 applied on 20 to 65 cm tall sorghum. Greater stunting resulted from 2,4-D applied at 330 g acid equivalent ha−1 or below 45 cm tall sorghum whereas lodging prevailed with 2,4-D at 330 g acid equivalent ha−1 and dicamba applied beyond 35 cm tall crop. Regardless of local environmental conditions, 2,4-D applied up to 35 cm tall did not negatively impact grain yield. There was a trend for yields to be somewhat lower when 2,4-D was applied on 45 or 55 cm tall sorghum whereas application on 65 cm tall sorghum systematically decreased yields. More caution should be taken with dicamba since yield reduction has been reported as early as applications made on 35 cm tall sorghum for a potentially dicamba sensitive cultivar.
Genomic dissection of anthracnose resistant response in sorghum [Sorghum bicolor (L.)
The goal of this project is to use a genomics-based approaches to identify anthracnose resistance loci from diverse sorghum germplasm as an effort to the disease resistance mechanism of at least one of these genes. This information will provide plant breeders with a tool kit that can be used to maxi...
Directory of Open Access Journals (Sweden)
Balderas-León Iván
2015-02-01
Full Text Available Waste motor oil (WMO pollutes soil and causing lost soil fertility. An alternative to solve this problem its bioremediation (BR by double and following biostimulation (BS with mineral solution (MS and a legume as green manure (GM then using phytoremediation (PR with growth promoting vegetal bacteria (GPVB like Bacillus cereus and Burkholderia cepacia to minimize remaining WMO. The aims of this research were: a bioremediation of polluted soil by 75000 ppm of WMO by biostimulation and then b Its phytoremediation for remaining WMO by Sorghum vulgare inoculated with B. cereus and B. cepacia. Soil polluted by high concentration WMO was biostimulated with MS, and then Phaseolus vulgaris treated by GPVB was incorporated as GM, finally to apply PR to eliminate WMO with S. vulgare with GPVB. Results indicate that soil bioremediated by biostimulation with MS, WMO decreased at 32500 ppm/30 days, and then with GM, WMO was reduced at 10100 ppm after/90 days. Finally, to apply phytoremediation using S. vulgare and GPVB at flowering, WMO was reduced from 2500 ppm to 800 ppm. For recovering soil impacted by high concentration WMO to apply both techniques double and following BS and PR are the best option than each technique separately.
Energy Technology Data Exchange (ETDEWEB)
Kurdali, F; Khalifa, K; Janat, M [Atomic Energy Commission, Damascus (Syrian Arab Republic). Dept. of Agriculture
2001-09-01
A field experiment was conducted under saline conditions (soil EC{sub e} 15, water EC{sub w} 8 dS/m/m) to evaluate the performance of sole crops and inter crops of Sesbania aculeata and Sorghum bicolor (1:1 row ratio) in terms of dry matter production, total N yield, soil N uptake and N{sub 2}-fixation using {sup 15}N isotope dilution method. Dry matter yield in sole crop of sesbania was significantly higher that that of sole sorghum; whereas, that of the inter cropping was significantly lower than sole sesbania, but was similar to that produced by sole sorghum. Total nitrogen yield in sole sesbania was four-fold than that accumulated in sole sorghum, whereas, that of mixed cropping was 2.6 fold compared to that of sole sorghum. The LER of total N yield was higher than 1 reflecting a greater advantage of inter cropping system in terms of land use efficiency. The proportion of N derived from N{sub 2} fixation (%Ndfa) in the sesbania was increased from 63 to 79%, for sole and inter cropping system, respectively. There was no evidence of a significant transfer of N from the sesbania to the sorghum. Results on the relative growth of plants on saline soil compared with non-saline soil clearly demonstrated that sesbania was more salt tolerant than the sorghum. soil nitrogen uptake by plants, particularly in sorghum, was adversely affected by salinity. However, amounts of N{sub 2} fixed by sole sesbania grown is saline soil was close or even higher than on non-saline soil. The use of inter cropping systems of legumes and non-legumes could be a promising agricultural approach to reutilize wasted lands, after a careful selection of appropriate tolerant genotypes to prevailing saline conditions. (author)
Directory of Open Access Journals (Sweden)
Mohammed eRiyazaddin
2016-04-01
Full Text Available Host plant resistance is one of the major components to control sorghum shoot fly, Atherigona soccata. To understand the nature of gene action for inheritance of shoot fly resistance, we evaluated 10 parents, 45 F1’s and their reciprocals in replicated trials during the rainy and postrainy seasons. Genotypes ICSV 700, Phule Anuradha, ICSV 25019, PS 35805, IS 2123, IS 2146 and IS 18551 exhibited resistance to shoot fly damage across seasons. Crosses between susceptible parents were preferred for egg laying by the shoot fly females, resulting in a susceptible reaction. ICSV 700, ICSV 25019, PS 35805, IS 2123, IS 2146 and IS 18551 exhibited significant and negative general combining ability (gca effects for oviposition, deadheart incidence, and overall resistance score. The plant morphological traits associated with expression of resistance/ susceptibility to shoot fly damage such as leaf glossiness, plant vigor, and leafsheath pigmentation also showed significant gca effects by these genotypes, suggesting the potential for use as a selection criterion to breed for resistance to shoot fly, A. soccata. ICSV 700, Phule Anuradha, IS 2146 and IS 18551 with significant positive gca effects for trichome density can also be utilised in improving sorghums for shoot fly resistance. The parents involved in hybrids with negative specific combining ability (sca effects for shoot fly resistance traits can be used in developing sorghum hybrids with adaptation to postrainy season. The significant reciprocal effects of combining abilities for oviposition, leaf glossy score and trichome density suggested the influence of cytoplasmic factors in inheritance of shoot fly resistance. Higher values of variance due to sca (σ2s, dominance variance (σ2d, and lower predictability ratios than the variance due to gca (σ2g and additive variance (σ2a for shoot fly resistance traits indicated the predominance of dominance type of gene action, whereas trichome density, leaf
Grain mold in sorghum [Sorghum bicolor (L.) Moench] is a major worldwide problem; damage caused by this fungal disease complex includes a reduction in yield (loss of seed mass), grain density, and germination. Long smut is another important fungal disease in sorghum and potential threat to food sec...
Differences in fusarium species in brown midrib sorghum and in air populations in production fields
Several Fusarium spp. cause sorghum (Sorghum bicolor) grain mold, resulting in deterioration and mycotoxin production in the field and during storage. Fungal isolates from the air (2005 to 2006) and from leaves and grain from wild-type and brown midrib (bmr)-6 and bmr12 plants (2002 to 2003) were co...
The collective effects of protein-binding polyphenols (PBP), preceding forage type, tillage, and fertilizer N on soil NO3-N production, N uptake, and dry matter yield (DMY) of N-demanding crops such as sorghum-sudangrass [SS, Sorghum bicolor (L.) Moench x S. sudanese Piper] are poorly understood. Th...
Mutation breeding in sorghum (sorghum bicolor L.) for improving plant as ruminant feed
International Nuclear Information System (INIS)
H, Soeranto
1998-01-01
Mutation breeding using gamma irradiation in sorghum was aimed at improving the quality and production of sorghum plant as ruminant feed. Seeds of local sorghum variety Keris with moisture of about 14% were irradiated with gamma rays from Cobalt-60 source using the dose levels up to 0.5 kgy. The MI plant were grown in Pasar Jumat, the M2 and M3 were grown in Citayam experimental station. The M2 plants were harvested 40 days after sowing by cutting plants 20 cm above ground surface. Two weeks later observations for the ability of plants to produce new buds (buds variable). The plants green products in green products in from of their dry weight (product variable) were collected 40 days after harvesting and drying process in oven at 105 0 C for 24 hours. Plant selections with intensity of 20% were done for the bud variable among samples of M2 plants. Selection responses in the M3 were found to vary from the lowest at 0.5 kgy population (R s = 0.8507). The share of genetic factors to selection responses in bud variable varied from 7.25% at 0,5 kgy population to 22.35% at 0.3 kgy population. Selection for bud variable gave directly impact in increasing product variable in the M3. (author)
Four sorghum (Sorghum bicolor L.) germplasm lines— PSLS-SGCTB01 (Reg. No.), PSLS-SGCTR02 (Reg. No.), PSLS-SGCTB03 (Reg. No.) and PSLS-SGCTB04 (Reg. No.) — were developed by the USDA-ARS in Lubbock TX, in 2017. The primary purpose for the release of these lines is to provide an alternative germplasm ...
SILAGE QUALITY OF CORN AND SORGHUM ADDED WITH FORAGE PEANUTS
Directory of Open Access Journals (Sweden)
WALKÍRIA GUIMARÃES CARVALHO
2016-01-01
Full Text Available Corn and sorghum are standard silage crops because of their fermentative characteristics. While corn and sorghum silages have lower crude protein (CP contents than other crops, intercropping with legumes can increase CP content. Furthermore, one way to increase CP content is the addition of legumes to silage. Consequently, the research objective was to evaluate the fermentative and bromatological characteristics of corn (Zea mays and sorghum (Sorghum bicolor silages added with forage peanuts (Arachis pintoi. The experimental design was completely randomized with four replicates. The treatments consisted of corn silage, sorghum silage, forage peanut silage, corn silage with 30% forage peanut, and sorghum silage with 30% forage peanut. The results showed that the corn and sorghum added with peanut helped to improve the silage fermentative and bromatological characteristics, proving to be an efficient technique for silage quality. The forage peanut silage had lower fermentative characteristics than the corn and sorghum silages. However, the forage peanut silage had a greater CP content, which increased the protein contents of the corn and sorghum silages when intercropped with forage peanuts.
Directory of Open Access Journals (Sweden)
Amelinda Angelina
2013-09-01
Full Text Available Sorghum, Sorghum bicolor (L Moench, adalah sereal paling penting kelima setelah beras, jagung, barley dan gandum. Hasil penelitian menunjukkan bahwa kemampuan substitusi biji sorghum terhadap tepung terigu bisa mencapai 50-75%, walaupun nilai protein pembentuk glutennya tidak dapat menyamai tepung terigu. Tujuan dari penelitian ini adalah mempelajari pengaruh waktu fermentasi terhadap penurunan total asam laktat, nilai pH, dan jumlah total khamir (baker’s yeast tanpa menggunakan nutrient kimia tambahan . Analisa komposisi biji sorghum yang diinvestigasi dalam keadaan wet basis dari laboratorium menghasilkan kadar air, lemak, serat, protein, karbohidrat, dan abu masing-masing sebesar 12.85%, 3.10%, 0.56%, 5.87%, 75.82%, dan 1.79%. Untuk nilai energi total dengan metode bomb kalori didapatkan 4375.94 kcal/kg. Pengujian biji sorghum menghasilkan C-organik sebesar 12,47%. Berdasarkan analisa didapatkan hasil optimal dalam membuat tepung sorghum terfermentasi pada proses fermentasi 60 jam dengan jumlah yeast yang dihasilkan 1,7 x 105 sel/ml dengan kondisi yield % asam laktat 0,214%.
Characterization of Novel Sorghum brown midrib Mutants from an EMS-Mutagenized Population
Sattler, Scott E.; Saballos, Ana; Xin, Zhanguo; Funnell-Harris, Deanna L.; Vermerris, Wilfred; Pedersen, Jeffrey F.
2014-01-01
Reducing lignin concentration in lignocellulosic biomass can increase forage digestibility for ruminant livestock and saccharification yields of biomass for bioenergy. In sorghum (Sorghum bicolor (L.) Moench) and several other C4 grasses, brown midrib (bmr) mutants have been shown to reduce lignin concentration. Putative bmr mutants isolated from an EMS-mutagenized population were characterized and classified based on their leaf midrib phenotype and allelism tests with the previously describe...
Energy Technology Data Exchange (ETDEWEB)
Voorman, R; Penner, D
1986-09-01
(/sup 14/C)-MBOCA was absorbed by cabbage (Brassica oleracea L.), bean (Phaseolus vulgaris L.), and sugar beet (Beta vulgaris L.) leaves, but did not move beyond the absorption point. Radio autographs of bean, sorghum (Sorghum vulgare Pers.), orchard grass (Dactylis glomerata L.) and carrot (Daucus carrota L.) plants exposed to (/sup 14/C)-MBOCA via hydroponic culture showed considerable radioactivity associated with the roots with only limited translocation of (/sup 14/C) into upper plant parts. Bean and cucumber (Cucumis sativa L.) plants grown in (/sup 14/C)-MBOCA amended soil translocated virtually no (/sup 14/C) into aerial parts, but again considerable radioactivity was found on roots. Radioactivity could not be rinsed off roots with water or acetone, and a small amount of radioactivity was observed in the xylem-phloem layer of the carrot root.
Directory of Open Access Journals (Sweden)
Luiz Henrique dos Santos Gomes
2012-03-01
Full Text Available Nutrition values of silages from different sorghum cultivars are evaluated. Five 26-kg castrated crossbred lambs, housed in pens equipped with feces and urine collectors for the study of their metabolism, were employed in a 5 x 5 Latin square experimental design. Treatments consisted of silage from five different sorghum cultivars: IPA 1011 and IPA 2564 (grain sorghum, IPA 2502 (dual purpose sorghum, IPA FS-25 and IPA 467 (forage sorghum. Protein level was corrected to 12% by adding a mixture of urea: ammonium sulfate (9:1. Treatments IPA 1011, IPA 2564 and IPA 2502 provided high intake of dry matter, total carbohydrate and total digestible nutrients, and low intake of neutral detergent fiber. Cultivars IPA 1011 and IPA 2564 provided high apparent crude protein digestibility coefficient, whereas cultivars IPA 1011 and IPA 2564 had high total digestible nutrient levels. All cultivars provided positive nitrogen. Owing to nutrient intake and digestibility values, grain sorghum silages evidenced high potential in ruminant nutrition.
Dicko, M.H.; Hilhorst, M.H.; Gruppen, H.; Traore, A.S.; Laane, N.C.M.; Berkel, van W.J.H.; Voragen, A.G.J.
2002-01-01
Analysis of fifty sorghum [Sorghum bicolor (L.) Moench] varieties used in Burkina Faso showed that they have different contents of phenolic compounds, peroxidase (POX), and polyphenol oxidase (PPO). Most of the varieties (82%) had a tannin content less than 0.25% (w/w). POX specific activity was
Path analysis of the productive traits in Sorghum species
Directory of Open Access Journals (Sweden)
Ikanović Jela
2011-01-01
Full Text Available This research studied the phenotypic correlation coefficients between three Sorghum species, namely forage sorghum S. bicolor Moench. (c. NS-Džin, Sudan grass S. sudanense L. (c. Zora and interspecies hybrid S. bicolor x S. sudanense (c. Siloking. The analyses were performed on plant material samples taken from the first cutting, when plants were in the beginning phase of tasseling. The following morphologic traits were studied: plant height, number of leaves per plant, stem leaf weight and mean stem weight. Additionally, their direct and indirect effect on dependent variable green biomass yield was analyzed, for which path coefficients were calculated. This method enables more quality and full insight into relations existing among the studied traits, more precise establishment of cause-effect connections among them, as well as to separate direct from indirect effects of any particular trait on dependent variable, being biomass yield in this case. The analysis of phenotypic coefficients revealed differences in direct and indirect effect of certain traits on dependent variable. Sudan grass had the highest stem (2.281 m and most leaves per plant (7.917. Forage sorghum had the largest leaf weight per plant (49.05 g, while interspecies hybrid had the highest mean stem weight (80.798 g. Variations of these morphologic traits among species were found to be significant and very significant. Morphologic traits - stem height and weight significantly affected sorghum green biomass yield. Leaf number and leaf portion in total biomass were negatively correlated with yield. Cultivars differed significantly regarding morphologic and productive traits. Sudan grass had the lowest green biomass yield, while forage sorghum and interspecies hybrid had significant yield increase.
Anthracnose, caused by the fungal pathogen Colletotrichum sublineolum Henn. ex. Sacc. and Trotter 1913, is an economically damaging disease of sorghum [Sorghum bicolor (L.) Moench] in hot and humid production regions of the world. Control of anthracnose is almost exclusively through the use of genet...
Fundamental processing needs identified by industry for the large-scale manufacture of biofuels and bioproducts from sweet sorghum (Sorghum bicolor L. Moench), include the long-term storage of 65 Brix syrups for year-round supply, efficient transport, and acceptable end-product yields. Sweet sorghu...
Sorghum (Sorghum bicolor) varieties adopt strongly contrasting strategies in response to drought.
Ogbaga, Chukwuma C; Stepien, Piotr; Johnson, Giles N
2014-10-01
Sorghum is one of the most drought tolerant crops but surprisingly, little is known about the mechanisms achieving this. We have compared physiological and biochemical responses to drought in two sorghum cultivars with contrasting drought tolerance. These closely related cultivars have starkly contrasting responses to water deficit. In the less tolerant Samsorg 40, drought induced progressive loss of photosynthesis. The more drought tolerant Samsorg 17 maintained photosynthesis, transpiration and chlorophyll content until the most extreme conditions. In Samsorg 40, there was a highly specific down-regulation of selected proteins, with loss of PSII and Rubisco but maintenance of PSI and cytochrome b6 f, allowing plants to maintain ATP synthesis. The nitrogen released allows for accumulation of glycine betaine and proline. To the best of our knowledge, this is the first example of specific reengineering of the photosynthetic apparatus in response to drought. In contrast, in Samsorg 17 we detected no substantial change in the photosynthetic apparatus. Rather, plants showed constitutively high soluble sugar concentration, enabling them to maintain transpiration and photosynthesis, even in extremely dry conditions. The implications for these strikingly contrasted strategies are discussed in relation to agricultural and natural systems. © 2014 Scandinavian Plant Physiology Society.
Data on physiological parameters of A, gs, Em, Ci, and IWUE in grain sorghum (Sorghum bicolor L. Moench) is limited. Flag leaves from three plants of two hybrids, grown using added N fertilizer rates of 0.0, 112, and 224 kg ha-1 near Elizabeth, MS were field sampled for these parameters at growth s...
Energy Technology Data Exchange (ETDEWEB)
Negro, M J; Solano, M L; Carrasco, J; Ciria, P
1998-12-01
A 3 year-plot experiments were performed to determined the possible persistence of the positive effects of treating soil with compost. For this purpose, a sweet sorghum bagasse compost has been used. Experiments were achieved with sweet sorghum (Sorghum bicolor. L. Moench) vr Dale as energy crop. Similar sorghum productivities were obtained both in plots with consecutive compost applications and in plots amended with mineral fertilizers. No residual effect after three years has been detected. It could be due to the low dose of compost application. (Author) 27 refs.
Brown midrib (bmr) mutants in sorghum (Sorghum bicolor (L.) Moench) and several other C4 grasses are associated with reduced lignin concentration, altered lignin composition and improved cell wall digestibility, which are desirable properties in biomass development for the emerging lignocellulosic b...
Epicoccum nigrum the new pathogen of sorghum seed in Serbia
Directory of Open Access Journals (Sweden)
Ristić Danijela
2012-01-01
Full Text Available Sixteen samples of sorghum seed (Sorghum bicolor (L. Moench. 'Alba', 'Gold', 'Prima' and 'Reform' were analyzed in the localities of Bački Petrovac and Čantavir in the period 2009-2011. Tipresence of species belonging to the genera Epicoccum, Fusarium, Alternaria, Aspergillus and Penicillium was established in single and mixed infections. From the infected sorghum seed, monosporial cultures identified as Epicoccum nigrum based on morphology, proved their pathogenicity on artificially inoculated sorghum seedlings. Molecular identification was performed by PCR and amplification of the ITS region of ribosomal DNA. Gene sequences of selected isolates 291-09 (JQ619838 and 315-09 (JQ619839 exhibited 99-100% nucleotide identity with the sequences of 31 isolates of E. nigrum deposited in the GenBank. It obtained results represent the first detailed characterization of E. nigrum in Serbia. The presence of a large number of phytopathogenic fungi on sorghum seed should be further investigated in order to clarify their relationships and relative significance.
International Nuclear Information System (INIS)
Linton, Joseph A.; Miller, J. Corey; Little, Randall D.; Petrolia, Daniel R.; Coble, Keith H.
2011-01-01
This study examines the feasibility of producing sweet sorghum (Sorghum bicolor (L.) Moench) as an ethanol feedstock in the southeastern United States through representative counties in Mississippi. We construct enterprise budgets along with estimates of transportation costs to estimate sweet sorghum producers' breakeven costs for producing and delivering sweet sorghum biomass. This breakeven cost for the sweet sorghum producer is used to estimate breakeven costs for the ethanol producer based on wholesale ethanol price, production costs, and transportation and marketing costs. Stochastic models are developed to estimate profits for sweet sorghum and competing crops in two representative counties in Mississippi, with sweet sorghum consistently yielding losses in both counties. -- Highlights: → We examine the economic feasibility of sweet sorghum as an ethanol feedstock. → We construct enterprise budgets along with estimates of transportation costs. → We estimate breakeven costs for producing and delivering sweet sorghum biomass. → Stochastic models determine profits for sweet sorghum in two Mississippi counties.
Directory of Open Access Journals (Sweden)
Nicésio Filadelfo Janssen de Almeida Pinto
2003-08-01
Full Text Available O controle químico da "ergot" (Claviceps africana foi realizado em campo de produção de sementes do híbrido de sorgo granífero BR 304 (Sorghum bicolor (L. Moench., utilizando-se os fungicidas (g i.a./ha: captan (1250,0, fenarimol (80,0, trifenil hidróxido de estanho (166,7, prochloraz (450,0, chlorothalonil (1500,0, iprodione (750,0, azoxystrobin (150,0, thiabendazole (360,0, procimidone (750,0, ziram (1500,0 e tebuconazole (200,0. Parcelas sem aplicação de fungicida constituíram a testemunha. As pulverizações foram realizadas com pulverizador costal manual, com o jato dirigido para as panículas. O intervalo das aplicações dos fungicidas foi de 4 dias, a partir da antese. Aos 7 dias após o término das pulverizações, a porcentagem de panículas doentes variou 5,4 para o fungicida tebuconazole e 100,0% para a maioria dos demais tratamentos. Para a porcentagem de flores doentes por panícula, os valores variaram de 0,3% a 65,0% para o fungicida tebuconazole e testemunha, respectivamente. Não ocorreu diferença significativa entre as porcentagens de flores doentes por panículas nos tratamentos tebuconazole (0,3%, chlorothalonil (2,5% e prochloraz (3,0%, sendo esses os mais eficientes no controle da ergot. Adicionalmente, o fungicida mais eficiente no controle da antracnose foliar (Colletotrichum graminicola foi o prochloraz, ao passo que para a ferrugem (Puccinia purpurea e a cercosporiose (Cercospora fusimaculans, o maior controle foi obtido com o fungicida tebuconazole. Não houve aumento da germinação das sementes em nenhum dos tratamentos; entretanto, o aumento do peso de mil sementes foi significativo para os tratamentos com os fungicidas prochloraz, chlorotalonil e tebuconazole.The efficiency of fungicides in the control of sugar disease of sorghum (Sorghum bicolor (L. Moench. was evaluated in a seed production field of the sorghum hybrid BR 304. The following fungicides and doses (g a.i./ha were evaluated : captan (1250
Directory of Open Access Journals (Sweden)
Pataki Imre
2011-01-01
Full Text Available Aim of this research was determination of mode of inheritance, gene effects components of genetic variance, combining abilities, average contribution of lines and testers and their interactions in expression of stem thickness in forage sorghum F1 generation. Method line x tester was applied. Material comprised of eight genetically divergent A-inbred lines of grain sorghum three R lines-testers of Sudan grass and twenty-four F1 hybrids obtained by crossing lines with testers. Among tested genotypes there were significant differences in mean values of stem thickness. Analysis of variance of combining abilities showed that there were highly significant differences for general combining abilities (GCA and specific combining abilities (SCA non-additive component of genetic variance (dominance and epistasis had greater portion in total genetic variance for stem thickness. During the first research year, interaction between inbred maternal line with testers had the largest contribution in expression of stem thickness of F1 hybrid at both locations, while in the second year at location Rimski Šančevi the largest contribution belongs to lines and at location Mačvanski Prnjavor the largest contribution belongs to testers. Assessment of combining abilities showed that these inbred lines of grain sorghum can be used as mothers: SS-1 646, SS-1 688 and S-8 682 in breeding forage sorghum for thicker stem. According to SCA, promising forage sorghum hybrids are S-8 682 x ST-R lin H and P-21 656 x C-198. This research can be of importance for developing new high-yielding forage sorghum hybrids.
Fan, F.; Spiertz, J.H.J.; Han, L.P.; Liu, Z.X.; Xie, G.H.
2013-01-01
Effects of cultivar choice and nitrogen supply on biomass yield and dry matter partitioning of sweet sorghum [Sorghum bicolor (L.) Moench] were studied under irrigated conditions in the arid temperate climate of north-west China. Two hybrid cultivars, Zaoshu-1 (ZS 1) and Chuntian-2 (CT 2), and two
Net ecosystem exchange (NEE) of carbon dioxide (CO2) and water vapor (H2O) fluxes from irrigated grain sorghum (Sorghum bicolor L. Moench) and maize (Zea mays L.) fields in the Texas High Plains were quantified using the eddy covariance (EC) technique during 2014-2016 growing seasons and examined in...
Fermentation and enzyme treatments for sorghum
Directory of Open Access Journals (Sweden)
Patrícia Fernanda Schons
2012-03-01
Full Text Available Sorghum (Sorghum bicolor Moench is the fifth most produced cereal worldwide. However, some varieties of this cereal contain antinutritional factors, such as tannins and phytate that may form stable complexes with proteins and minerals which decreases digestibility and nutritional value. The present study sought to diminish antinutritional tannins and phytate present in sorghum grains. Three different treatments were studied for that purpose, using enzymes tannase (945 U/Kg sorghum, phytase (2640 U/Kg sorghum and Paecilomyces variotii (1.6 X 10(7 spores/mL; A Tannase, phytase and Paecilomyces variotii, during 5 and 10 days; B An innovative blend made of tanase and phytase for 5 days followed by a Pv increase for 5 more days; C a third treatment where the reversed order of B was used starting with Pv for 5 days and then the blend of tannase and phytase for 5 more days. The results have shown that on average the three treatments were able to reduce total phenols and both hydrolysable and condensed tannins by 40.6, 38.92 and 58.00 %, respectively. Phytase increased the amount of available inorganic phosphorous, on the average by 78.3 %. The most promising results concerning tannins and phytate decreases were obtained by the enzymes combination of tannase and phytase. The three treatments have shown effective on diminishing tannin and phytate contents in sorghum flour which leads us to affirm that the proposed treatments can be used to increase the nutritive value of sorghum grains destined for either animal feeds or human nutrition.
Fermentation and enzyme treatments for sorghum.
Schons, Patrícia Fernanda; Battestin, Vania; Macedo, Gabriela Alves
2012-01-01
Sorghum (Sorghum bicolor Moench) is the fifth most produced cereal worldwide. However, some varieties of this cereal contain antinutritional factors, such as tannins and phytate that may form stable complexes with proteins and minerals which decreases digestibility and nutritional value. The present study sought to diminish antinutritional tannins and phytate present in sorghum grains. Three different treatments were studied for that purpose, using enzymes tannase (945 U/Kg sorghum), phytase (2640 U/Kg sorghum) and Paecilomyces variotii (1.6 X 10(7) spores/mL); A) Tannase, phytase and Paecilomyces variotii, during 5 and 10 days; B) An innovative blend made of tanase and phytase for 5 days followed by a Pv increase for 5 more days; C) a third treatment where the reversed order of B was used starting with Pv for 5 days and then the blend of tannase and phytase for 5 more days. The results have shown that on average the three treatments were able to reduce total phenols and both hydrolysable and condensed tannins by 40.6, 38.92 and 58.00 %, respectively. Phytase increased the amount of available inorganic phosphorous, on the average by 78.3 %. The most promising results concerning tannins and phytate decreases were obtained by the enzymes combination of tannase and phytase. The three treatments have shown effective on diminishing tannin and phytate contents in sorghum flour which leads us to affirm that the proposed treatments can be used to increase the nutritive value of sorghum grains destined for either animal feeds or human nutrition.
Grain sorghum (Sorghum bicolor L. Moench) crop yield is significantly compromised by high temperature stress-induced male sterility, and is attributed to reduced cell wall invertase (CWI)-mediated sucrose hydrolysis in microspores and anthers leading to altered carbohydrate metabolism and starch def...
Directory of Open Access Journals (Sweden)
Walmir Lima Wanderley
2002-02-01
Full Text Available O experimento foi conduzido com o objetivo de avaliar o desempenho de vacas da raça Holandesa em lactação, alimentadas com rações contendo diferentes níveis (0, 12, 24 e 36% de palma forrageira (Opuntia ficus indica Mill em substituição à silagem de sorgo (Sorghum bicolor (L. Moench. Foram utilizadas oito vacas distribuídas em dois quadrados latinos (4x4. Cada período experimental teve duração de 21 dias, sendo 14 destinados à adaptação dos animais às rações e sete para coleta. Os consumos de matéria seca (MS, em kg/dia, % de PV e em relação ao peso metabólico (g/kg0,75, e matéria orgânica e carboidratos totais, expressos em kg/dia, não foram influenciados pela adição de palma na ração, apresentando valores médios de 20,18; 3,41; 167,80; 18,86; e 14,85, respectivamente. O consumo de carboidratos não-fibrosos, em kg/dia, aumentou, e os de fibra em detergente neutro, em kg/dia e % de PV, fibra em detergente ácido; proteína bruta e extrato etéreo, expressos em kg/dia, diminuíram linearmente com a inclusão de palma na ração. O consumo de sódio não foi influenciado pela adição de palma na ração, com valor médio de 29,45g/dia. Os consumos de potássio e magnésio aumentaram e o de fósforo diminuiu linearmente com a adição de palma na ração. Não houve efeito da inclusão de palma sobre a produção de leite com e sem correção para 3,5% de gordura, cujos valores médios foram de 25,01 e 26,97kg/dia, respectivamente. O teor de gordura do leite foi influenciado de forma quadrática, sendo o teor máximo estimado em 4,08%, com 20,51% de palma na ração. A conversão alimentar aumentou linearmente com a inclusão de palma.The experiment was conducted to evaluate the performance of lactating Holstein cows fed diet with different replacement levels (0, 12, 24 and 36% of forage cactus (Opuntia ficus indica Mill for sorghum silage (Sorghum bicolor (L. Moench. Eight cows were assigned to a two 4x4 latin
Nutrient and carbohydrate partitioning in sorghum stover
International Nuclear Information System (INIS)
Powell, J.M.; Hons, F.M.; McBee, G.G.
1991-01-01
Sorghum [Sorghum bicolor (L.) Moench] stover has been demonstrated to be a potential biomass energy source. Complete aboveground crop removal, however, can result in soil degradation. Differential dry matter, nutrient, and carbohydrate partitioning by sorghum cultivars may allow management strategies that return certain parts to the field while removing other portions for alternative uses, such as energy production. A field study was conducted to determine N,P,K, nonstructural carbohydrate, cellulose hemicellulose, and lignin distributions in stover of three diverse sorghum cultivars of differing harvest indices. Determinations were based on total vegetative biomass; total blades; total stalks; and upper middle, and lower blades and stalks. Concentrations of N and P were higher in blades than stalks and generally declines from upper to lower stover parts. Large carbohydrate and lignin concentration differences were observed on the basis of cultivar and stover part. Greater nutrient partitioning to the upper third of the intermediate and forage-type sorghum stovers was observed as compared to the conventional grain cultivar. Stover carbohydrates for all cultivars were mainly contained in the lower two-thirds of the stalk fraction. A system was proposed for returning upper stover portion to soil, while removing remaining portions for alternative uses
Potensi penggunaan beberapa varietas sorgum manis (Sorghum bicolor (L. Moench sebagai tanaman pakan
Directory of Open Access Journals (Sweden)
Mustikoweni Purnomohadi
2012-02-01
Full Text Available Sweet sorghum is a versatile crop that can be used as grain crop, sugar alcohol production and even as forage crop. The aim of this study was to evaluate the potential use of sweet sorghum either as grain crop or forage crop. The experiment used four varieties of sweet sorghum: Rio, Cawley, Keller and Wray, which were planted in polybag with six replication using Completely Randomized Design. The result of the research showed that Keller and Wray had longer vegetative growth, and good quality of chemical composition for forage than Rio and Cawley.
Directory of Open Access Journals (Sweden)
A Azari Nasrabad
2017-12-01
Full Text Available Introduction Osmotic adjustment in plants can be achieved by the accumulation of compatible solution or metabolites. These compounds are known as compatible metabolites that accumulate naturally in tolerant plants due to non-interference in the normal metabolic response of plants to adapt or supplement. Proline, soluble sugars and other metabolites accumulation that are involved in osmotic adjustment have been reported for various plants. Different studies show that water absorption in sorghum plant, is due to osmotic adjustment and appropriate and fairly extensive root system. Moreover, there are some differences from genotype to genotype regarding the osmolites accumulation under drought stress conditions. Thus, the aim of this study was to investigate the effects of drought in the vegetative and reproductive growth stages on yield, its components and biochemical traits in grain sorghum genotypes. Materials and Methods In order to evaluate the effect of water stress on grain yield and its components and some biochemical traits in grain sorghum genotypes (Sorghum bicolor L., a field experiment as a split plot design was carried out with 3 replications in 2014 at the research farm of the southern Khorasan Agriculture and natural resources research and education center. Water stress treatments including normal irrigation (control, irrigation cut off in vegetative growth stage (emergence of terminal leaf as rolled and irrigation cut off in generative growth stage (50% of plants in start of flowering as the main plot and 10 genotypes of sorghum including KGS29, MGS2, Sepideh, KGFS27, MGS5, KGFS5, KGFS17, KGFS13 and KGFS30 were considered as sub plots. Each plot consists of 4 rows with a length of 6 m and row spacing of 60 cm, between plants on row was 10 cm. In addition, between each plot and the adjacent plot a row was considered to side effect reduction. To determine the yield components of each plot, half a meter in length was harvested and the
Petti, Carloalberto; Hirano, Ko; Stork, Jozsef; DeBolt, Seth
2015-09-01
Here, we show a mechanism for expansion regulation through mutations in the green revolution gene gibberellin20 (GA20)-oxidase and show that GAs control biosynthesis of the plants main structural polymer cellulose. Within a 12,000 mutagenized Sorghum bicolor plant population, we identified a single cellulose-deficient and male gametophyte-dysfunctional mutant named dwarf1-1 (dwf1-1). Through the Sorghum propinquum male/dwf1-1 female F2 population, we mapped dwf1-1 to a frameshift in GA20-oxidase. Assessment of GAs in dwf1-1 revealed ablation of GA. GA ablation was antagonistic to the expression of three specific cellulose synthase genes resulting in cellulose deficiency and growth dwarfism, which were complemented by exogenous bioactive gibberellic acid application. Using quantitative polymerase chain reaction, we found that GA was positively regulating the expression of a subset of specific cellulose synthase genes. To cross reference data from our mapped Sorghum sp. allele with another monocotyledonous plant, a series of rice (Oryza sativa) mutants involved in GA biosynthesis and signaling were isolated, and these too displayed cellulose deficit. Taken together, data support a model whereby suppressed expansion in green revolution GA genes involves regulation of cellulose biosynthesis. © 2015 American Society of Plant Biologists. All Rights Reserved.
Morphological characteristics of BRS 501 sweet sorghum under water stress
Directory of Open Access Journals (Sweden)
Luciano Rezende Moreira
2016-12-01
Full Text Available Sorghum [Sorghum bicolor (L. Moench] crop is distinguished from other crops for its tolerance to both water deficit and excess soil moisture, under very dry and/or very hot environmental situations in which the productivity of other cereals becomes uneconomical. This work was conducted to evaluate the effects of irrigation on root conformation at the initial development phase of sweet sorghum. So, BRS 501 cv. was subjected to four irrigation levels based on 80%, 60%, 40% and 20% of the field capacity (CC. The decreased availability of water in the soil negatively affected the majority of the characteristics under evaluation except for the relationship between the root system and the aerial part (SR/PA, average root diameter (DMR and specific root area (ARE. We concluded that the growth of sweet sorghum plants under evaluation is sensible to the decrease of water in the soil, as it is affected by low water availability. This methodology, common to other crops, can be used for saccharine sorghum in order to establish hydric availabilities in new experiments to discriminate the drought-tolerant cultivars.
CSIR Research Space (South Africa)
Grootboom, AW
2010-01-01
Full Text Available of transformation. In sorghum, concerns about flow of herbicide and antibiotic resistance gene into genetically related wild and weedy species have a direct bearing on the choice of suitable selectable markers in many tropical and subtropical regions. The authors...
Directory of Open Access Journals (Sweden)
Dilek Lemlioglu-Austin
2012-09-01
Full Text Available Bran extracts (70% aqueous acetone of specialty sorghum varieties (tannin, black, and black with tannin were used to investigate the effects of sorghum phenolic compounds on starch digestibility, Estimated Glycemic Index (EGI, and Resistant Starch (RS of porridges made with normal corn starch, enzyme resistant high amylose corn starch, and ground whole sorghum flours. Porridges were cooked with bran extracts in a Rapid Visco-analyser (RVA. The cooking trials indicated that bran extracts of phenolic-rich sorghum varieties significantly reduced EGI, and increased RS contents of porridges. Thus, there could be potential health benefits associated with the incorporation of phenolic-rich sorghum bran extracts into foods to slow starch digestion and increase RS content.
The role of sorghum genotype in the interaction with the parasitic weed Striga hermonthica
Rodenburg, J.
2005-01-01
Keywords:Strigahermonthica , Sorghum bicolor , selection measures, resistance, tolerance, genotypes.
Sorghum [Sorghum bicolor (L.) Möench] is the world’s fifth most important crop, grown for forage, grain, and as a biofuel. Fast growing and drought tolerant, it is considered a climate-change-ready crop. Two free-air CO2 enrichment (FACE) experiments at Maricopa, Arizona, USA showed that, like othe...
International Nuclear Information System (INIS)
Grant, R.H.; Jenks, M.A.; Rich, P.J.; Peters, P.J.; Ashworth, E.N.
1995-01-01
Near-isogenic mutants of Sorghum bicolor with genetic alterations affecting epicuticular wax (EW) structure but having similar canopy architecture provided a model system to examine the influence of EW on plant radiation scattering. Differences in canopies with two different sheath EW amounts showed differences in angular reflectance and transmittance. The differences varied with waveband of radiation. Canopy ultraviolet-B (UVB) and photosynthetically active radiation (PAR) backward reflectance in the principal solar plane were higher by wild-type plants (N-15) bearing reflective stalk EW filaments than mutant plants (bm-15) lacking stalk EW filaments. Between panicle emergence to anthesis the backward PAR reflectance increased more in the N-15 than bm-15 canopy. We suspect that the increase was a result of reflections from stalk facets emerging above the surface plane of the canopy foliage and exposing reflective EW. As panicles emerged above the foliage, canopy UVB and PAR forward reflectance by bm-15 increased while forward reflectance by N-15 decreased. The increased forward reflectance from bm-15 may be because of high specular reflectance from the microscopically smooth bm-15 stalk surfaces. Based on comparisons of probability distributions, significant differences in PAR and UVB canopy transmittance were detected between N-15 and bm-15. The median UVB transmittance was greater in the bm-15 canopy than the N-15 canopy, while the median PAR transmittance was the same for the two canopies. The greater transmittance in the N-15 canopy corresponded with lower EW load of the sheaths, but the difference between canopies was within the experimental error. Distinct influences of the stalk EW on canopy reflectance and transmittance were difficult to assess because of the relatively low proportion of surface area containing EW, the experimental errors associated with UVB irradiance field measurements. The optical properties of the S. bicolor canopy varied by waveband
Phytotoxicity of sorgoleone found in grain Sorghum root exudates.
Einhellig, F A; Souza, I F
1992-01-01
Root exudates ofSorghum bicolor consist primarily of a dihydroquinone that is quickly oxidized to ap-benzoquinone named sorgoleone. The aim of this investigation was to determine the potential activity of sorgoleone as an inhibitor of weed growth. Bioassays showed 125μM sorgoleone reduced radicle elongation ofEragrostis tef. In liquid culture, 50-μM sorgoleone treatments stunted the growth ofLemna minor. Over a 10-day treatment period, 10μM sorgoleone in the nutrient medium reduced the growth of all weed seedlings tested:Abutilon theophrasti, Datura stramonium, Amaranthus retroflexus, Setaria viridis, Digitaria sanguinalis, andEchinochloa crusgalli. These data show sorgoleone has biological activity at extremely low concentrations, suggesting a strong contribution toSorghum allelopathy.
International Nuclear Information System (INIS)
Kurdali, F.; Khalifa, K.; Janat, M.
2002-01-01
A field experiment on Sesbania aculeata and Sorghum bicolor grown in mono cropping and in inter cropping systems was conducted under non-saline conditions (soil EC sub e 0.16, water EC sub w 1 ds/m/m) to evaluate dry matter production, total N yield, soil N uptake and N sub 2 -fixation using sup 1 sup 5 N isotope dilution method. Three different row ratios of sesbania (ses) and sorghum (sor) were subjected in the inter cropping system (2 ses: 1 sor; 1 ses: 1 sor and 1 ses: 2 sor row ratio). Dry matter yield of sole sorghum was higher than that of sole sesbania, and it was similar to that produced by the inter cropping treatments. However, total N yield of sole sorghum was significantly the lowest, with no differences being obtained between sole sesbania and inter cropping treatments. The LERs of total N yield were, in all cases, higher than 1, reflecting a greater advantage of inter cropping system in terms of land use efficiency. Percentages of N sub 2 fixation in the inter cropped sesbania were considerably enhanced compared with the pure stand of sesbania. This was mainly attributed to the depletion of soil N resulting from the greater apparent competitiveness of sorghum for soil N, and consequently, a greater dependence of sesbania on N sub 2 fixation. However, the degree of the intraspecific competition for soil N uptake was affected by the proportion of crops in the mixture, and it was considerably reduced in the 2 ses: 1 sor row ratio. This was demonstrated when an equal depletion of soil and fertilizer N uptake occurred for both crops. We excluded in all-inter cropping treatments the possibility of N transfer from sesbania to sorghum. Row inter cropping, with crops grown in alternation of two rows of sesbania with one row of sorghum, seemed to be the most adequate row ratio in terms of total N yield, LER, N sub 2 -fixation and soil N uptake balance of the component crops. (author)
Genetic variability of tissue cultured Sorghum bicolor (L) Moench as ...
African Journals Online (AJOL)
To evaluate their performance for seedling traits at seedling stage (under hydroponics), plant water relations under water stress and ultimately grain yield, and to estimate the genetic variability of the regenerates, the parent plants of local sorghum cultivars in Kenya using simple sequence repeats (SSR) markers were ...
Directory of Open Access Journals (Sweden)
Hyun-Geun Min
2017-09-01
Full Text Available Throughout year 2015 to 2016, 101 proso millet and 200 sorghum samples were collected from five provinces in South Korea. The samples were subjected to paired-end RNA sequencing and further analyzed by RT-PCR. The results indicated that Rice black-streaked dwarf virus (RBSDV was detected from sorghum collected in Gyeongsang province. The other four viruses, including RBSDV, Rice stripe virus (RSV, Barley virus G (BVG, and Cereal yellow dwarf virus (CYDV, were detected from proso millet. Among four viruses, both RSV and RBSDV were identified high frequency from proso millet collected from Gyeongsang province. Otherwise, BVG was nearly equally identified from five provinces, suggesting that the virus was supposedly widespread nationwide. RBSDV was first identified from both proso millet and sorghum in South Korea. The other virus annotated CYDV identified proso millet was shown to have relatively low identities compared to CYDV previously reported, suggesting that the virus might be new member of Polerovirus.
The Effect of Soil Fertilizers on Yield and Growth Traits of Sorghum (Sorghum bicolor
Directory of Open Access Journals (Sweden)
R Kamaei
2016-07-01
Full Text Available Introduction Since the use of chemical fertilizers causes environmental pollution and ecological damage, so application of biological fertilizers and selection the effective and compatible species in an special area, could be beneficial for sustainability of agroecosystems there. Nowadays, attention to the interrelation of plant-organism tended to interrelations between plant-organism-organism. Such nutritional relations, have ecological importance and important application in agriculture. The aim of this experiment was to evaluate the effect of chemical, organic and bio fertilizers on sorghum performance. Materials and Methods A field experiment was conducted in a randomized complete block design with three replications. The experimental treatments include three kinds of biofertilizers and their integrations and vermicompost and chemical fertilizer as follow: 1- mycorhhiza arbuscular (G.mosseae + vermicompost 2- mycorhhiza+ Nitroxine® (included bacteria Azospirillum sp. and Azotobacter sp. 3- mycorhhiza arbuscular+ Rhizobium (Rhizobium sp. 4-mycorhhiza arbuscular + Chemical fertilizer NPK 5- mycorhhiza arbuscular 6-control. Mycorhhiza and chemical fertilizer were mixed with soil at the depth of 30 cm before planting. Seeds were inoculated with bio fertilizers and dried at shadow. First irrigation applied immediately after planting. In order to improve seedling emergence second irrigation was performed after 4 days and other irrigation was applied at regular intervals of 10 days. Studied traits were: height and percentage of root colonization, specific root length, seed yield, number of seeds in panicle, thousands seeds weight. To determine the specific root length (root length in a certain volume of soil at the end of the growing season, plants in each plot were sampled. Then the length of root of each sample was determined. Results and Discussion The results showed that although the treatments did not affect the height of stem significantly
Biological studies on albino rats fed with Sorghum bicolor starch ...
African Journals Online (AJOL)
Partially purified amylase was extracted from the culture medium of Rhizopus sp. grown in potato dextrose broth for 48 h at room temperature by precipitation with 96.9% ethanol. The enzyme was used to hydrolyze sorghum starch. The hydrolyzed product was afterwards formulated into rat feed, which was fed to albino rats ...
Effect of Excessive Soil Moisture Stress on Sweet Sorghum: Physiological Changes and Productivity
International Nuclear Information System (INIS)
Zhang, F.; Wang, Y.; Yu, H.; Zhu, K.; Zhang, Z.; Zou, F. L. J.
2016-01-01
Sweet sorghum [Sorghum bicolor (L.) Moench] is a potential bioenergy feedstock. Research explaining the response of sweet sorghum to excessive soil moisture (EM) stress at different growth stage is limited. To investigate the effect of EM stress on sweet sorghum antioxidant enzymes, osmotic regulation, biomass, quality, and ethanol production, an experiment was conducted in a glasshouse at the National Sorghum Improvement Center, Shenyang, China. Sweet sorghum (cv. LiaoTian1) was studied in four irrigation treatments with a randomized block design method. The results showed that the protective enzyme, particularly the SOD, CAT and APX in it, was significantly affected by EM stress. EM stress deleteriously affected sweet sorghum growth, resulting in a remarkable reduction of aboveground biomass, stalk juice quality, stalk juice yield, and thus, decreased ethanol yield. EM stress also caused significant reduction in plant relative water content, which further decreased stalk juice extraction rate. Sweet sorghum grown under light, medium, and heavy EM treatments displayed 5, 19, and 30% fresh stalk yield reduction, which showed a significant difference compared to control. The estimated juice ethanol yield significantly declined from 1407 ha/sup -1/ (under optimum soil moisture) to 1272, 970, and 734 L ha/sup -1/ respectively. (author)
Characterizing Sorghum Panicles using 3D Point Clouds
Lonesome, M.; Popescu, S. C.; Horne, D. W.; Pugh, N. A.; Rooney, W.
2017-12-01
To address demands of population growth and impacts of global climate change, plant breeders must increase crop yield through genetic improvement. However, plant phenotyping, the characterization of a plant's physical attributes, remains a primary bottleneck in modern crop improvement programs. 3D point clouds generated from terrestrial laser scanning (TLS) and unmanned aerial systems (UAS) based structure from motion (SfM) are a promising data source to increase the efficiency of screening plant material in breeding programs. This study develops and evaluates methods for characterizing sorghum (Sorghum bicolor) panicles (heads) in field plots from both TLS and UAS-based SfM point clouds. The TLS point cloud over experimental sorghum field at Texas A&M farm in Burleston County TX were collected using a FARO Focus X330 3D laser scanner. SfM point cloud was generated from UAS imagery captured using a Phantom 3 Professional UAS at 10m altitude and 85% image overlap. The panicle detection method applies point cloud reflectance, height and point density attributes characteristic of sorghum panicles to detect them and estimate their dimensions (panicle length and width) through image classification and clustering procedures. We compare the derived panicle counts and panicle sizes with field-based and manually digitized measurements in selected plots and study the strengths and limitations of each data source for sorghum panicle characterization.
Directory of Open Access Journals (Sweden)
Bahzad H.S. Mustafa
2016-09-01
Full Text Available This study was conducted in Sulaimani governorate in order to identify the biological control of some Ixodidae genera among different flocks of cattle, sheep and goats. Four genera of Ixodidae; Boophilus spp., Hyalomma spp., Rhipicephalus spp. and Haemaphysalis spp., were identified in these infested animals. According to chi–square test, the highest distribution of Boophulis spp., was recorded in cattle (56.51%, and the highest distribution of Hyalomma spp., (49.82% and Rhipicephalus spp., (28.16% which were in sheep. The highest number of Haemophasylas spp., was obtained from goats (6.67%, whereas the lowest number of this genus (2.88% and 2.89% was collected from cattle and sheep respectively. The toxicity of Sorghum bicolor seed extract was tested against the more distributed Ixodidae genera (Boophilus spp. and Hyalomma spp. by immersion method on mature ticks, four concentrations (23.2, 17.4, 11.6 and 5.8 mg/dl, in addition to the control treatment (0 mg/dl of the seed were used to evaluate the engorged females in vitro. The results showed that 100% of absolute cumulative mortality of Boophilus spp., was gain after 72 hr by 23.2 mg/dl extract concentration, followed by 17.4 mg/dl which gave 90% mortality, whereas 100% absolute cumulative mortality for Hyalomma spp., was obtained by 23.2 mg/dl extract concentration after 48 hr, followed by 17.4, 11.6 and 5.8 mg/dl concentration that gave 90%, 80% and 40% mortality after 72 hr.
Gene flow from Sorghum bicolor to its weedy relatives and its ...
African Journals Online (AJOL)
computer user
2015-04-29
Apr 29, 2015 ... 2Africa Harvest Biotechnology Foundation International, P.O. Box 642, ... traditional sorghum varieties in order to assess the potential effect of crop genes in ..... removed by pippeting from PCR products and 1 µl of loading dye.
A study on Sorghum bicolor (L. Moench response to split application of herbicides
Directory of Open Access Journals (Sweden)
Kaczmarek Sylwia
2017-06-01
Full Text Available Field experiments to evaluate the split application of mesotrione + s-metolachlor, mesotrione + terbuthylazine, dicamba + prosulfuron, terbuthylazine + mesotrione + s-metolachlor, and sulcotrione in the cultivation of sorghum var. Rona 1 were carried out in 2012 and 2013. The field tests were conducted at the field experimental station in Winna Góra, Poznań, Poland. Treatments with the herbicides were performed directly after sowing (PE and at leaf stage 1–2 (AE1 or at leaf stage 3–4 (AE2 of sorghum. The treatments were carried out in a laid randomized block design with 4 replications. The results showed that the tested herbicides applied at split doses were effective in weed control. After the herbicide application weed density and weed biomass were significantly reduced compared to the infested control. The best results were achieved after the application of mesotrione tank mixture with s-metolachlor and terbuthylazine. Application of split doses of herbicides was also correlated with the density, biomass, and height of sorghum.
Genetic dissection of bioenerrgy traits in sorghum
Energy Technology Data Exchange (ETDEWEB)
Vermerris, Wilfred; Kresovich, Stephen; Murray, Seth; Pedersen, Jeffery; Rooney, William; Sattler, Scott.
2012-06-15
project is acknowledged 1) Vermerris W, Saballos A (2012) Genetic enhancement of sorghum for biomass utilization. In Paterson, A. (Ed.) Genetics and Genomics of the Saccharinae, Springer, New York, NY. pp. 391-428. 2) Felderhoff T, Murray SC, Klein PE, Sharma A, Hamblin MT, Kresovich S, Vermerris W, Rooney, WL (2012) QTLs for energy-related traits in a sweet x grain sorghum [Sorghum bicolor (L.) Moench] mapping population. Crop Science 52: 2040-2049. 3) Sattler SE, Palmer NA, Saballos A, Greene AM, Xin Z, Sarath G, Vermerris W, Pedersen JF (2012) Identification and characterization of four missense mutations in Brown midrib12 (Bmr12), the caffeic acid O-methyltranferase (COMT) of sorghum. BioEnergy Research (in press) DOI 10.1007/s12155-012-9197-z 4) Saballos A, Sattler S, Sanchez E, Foster TP, Xin Z, Kang CH, Pedersen J, Vermerris W (2012). Brown midrib2 encodes the major 4-coumarate:CoA ligase involved in lignin biosynthesis in sorghum (Sorghum bicolor (L.) Moench). The Plant Journal 70: 818-830. doi: 10.1111/j.1365-313X.2012.04933. 5) Vermerris, W (2011) Survey of genomics approaches to improve bioenergy traits in maize, sorghum and sugarcane. Journal of Integrative Plant Biology 53: 105-119 6) Saballos A, Ejeta G, Sanchez E, Kang CH, Vermerris W (2009) A genome-wide analysis of the cinnamyl alcohol dehydrogenase family in sorghum [Sorghum bicolor (L.) Moench] identifies SbCAD2 as the Brown midrib6 gene. Genetics 181: 783-795. 7) Saballos A, Vermerris W, Rivera L, Ejeta G (2008) Allelic association, chemical characterization and saccharification properties of brown midrib mutants of sorghum (Sorghum bicolor (L.) Moench). BioEnergy Research 2: 193-204 8) Felderhoff TJ. (2012) QTLs for energy related traits in a sweet x grain RIL sorghum [Sorghum bicolor (L.) Moench] population. M.S. Thesis, Texas A&M University. Publications in preparation (tentative titles) 9) Felderhoff T, Murray SC, Klein PE, Sharma A, Hamblin MT, Kresovich S, Vermerris W, Rooney, WL (2013) QTLs for
Directory of Open Access Journals (Sweden)
A. Mehraban
2012-10-01
Full Text Available To evaluate the influence of vesicular arbuscular mycorrhizal (VAM on yield and yield components of three sorghum cultivars, a factorial experiment based randomized complete block design with four replications was carried out in 2007, at the Agricultural Research Center of Zahak, Iran. The treatments were different mycorrhiza species in three levels: without mycorrhiza (M1, Glomus etanicatum (M2 and G. mosseae(M3 and three cultivars of sorghum: local cultivars (C1, KGS25 (C2 and KGS29 (C3. The results showed that all of the traits measured were increased by inoculation of cultivars with mycorrhiza. The highest plant height (165.1 cm, stem diameter (1.61 cm, flag leaf length (27.22 cm, flag leaf width (3.67 cm and ear width (5.00 cm was obtained by inoculation of seed with Glumus etanicatum, and highest ear length (19.21 cm, ear number (2.51, seed number per ear (10252.11, 1000-seed weight (17.56 g and grain yield (1967.32 kg/ha by using Glumus mossea. The highest leaf width and length belonged to local cultivar, and the highest seed yield to KGS 29 cultivar. However, differences of other traits among sorghum cultivars were not significant. Based on the experimental results it can be concluded that highest grain yield may be obtained by inoculating seeds of KGS 29 with Glumus mossea.
Cantoro, Renata; Crocco, Carlos Daniel; Benech-Arnold, Roberto Luis; Rodríguez, María Verónica
2013-12-01
The precise adjustment of the timing of dormancy release according to final grain usage is still a challenge for many cereal crops. Grain sorghum [Sorghum bicolor (L.) Moench] shows wide intraspecific variability in dormancy level and susceptibility to pre-harvest sprouting (PHS). Both embryo sensitivity to abscisic acid (ABA) and gibberellin (GA) metabolism play an important role in the expression of dormancy of the developing sorghum grain. In previous works, it was shown that, simultaneously with a greater embryo sensitivity to ABA and higher expression of SbABA-INSENSITIVE 4 (SbABI4) and SbABA-INSENSITIVE 5 (SbABI5), dormant grains accumulate less active GA4 due to a more active GA catabolism. In this work, it is demonstrated that the ABA signalling components SbABI4 and SbABI5 interact in vitro with a fragment of the SbGA 2-OXIDASE 3 (SbGA2ox3) promoter containing an ABA-responsive complex (ABRC). Both transcription factors were able to bind the promoter, although not simultaneously, suggesting that they might compete for the same cis-acting regulatory sequences. A biological role for these interactions in the expression of dormancy of sorghum grains is proposed: either SbABI4 and/or SbABI5 activate transcription of the SbGA2ox3 gene in vivo and promote SbGA2ox3 protein accumulation; this would result in active degradation of GA4, thus preventing germination of dormant grains. A comparative analysis of the 5'-regulatory region of GA2oxs from both monocots and dicots is also presented; conservation of the ABRC in closely related GA2oxs from Brachypodium distachyon and rice suggest that these species might share the same regulatory mechanism as proposed for grain sorghum.
DEFF Research Database (Denmark)
Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben
2013-01-01
Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...
Effects of PEG-induced osmotic stress on growth and dhurrin levels of forage sorghum
DEFF Research Database (Denmark)
O'Donnell, Natalie H.; Møller, Birger Lindberg; Neale, Alan D.
2013-01-01
Sorghum (Sorghum bicolor L. Moench) is a valuable forage crop in regions with low soil moisture. Sorghum may accumulate high concentrations of the cyanogenic glucoside dhurrin when drought stressed resulting in possible cyanide (HCN) intoxication of grazing animals. In addition, high concentratio...... of plant growth and root activity, increasing the rate of nitrate uptake. Data presented in this article support a role for cyanogenic glucosides in mitigating oxidative stress....... of nitrate, also potentially toxic to ruminants, may accumulate during or shortly after periods of drought. Little is known about the degree and duration of drought-stress required to induce dhurrin accumulation, or how changes in dhurrin concentration are influenced by plant size or nitrate metabolism....... Given that finely regulating soil moisture under controlled conditions is notoriously difficult, we exposed sorghum plants to varying degrees of osmotic stress by growing them for different lengths of time in hydroponic solutions containing polyethylene glycol (PEG). Plants grown in medium containing 20...
Liu, Peng; Yin, Lina; Deng, Xiping; Wang, Shiwen; Tanaka, Kiyoshi; Zhang, Suiqi
2014-09-01
The fact that silicon application alleviates water deficit stress has been widely reported, but the underlying mechanism remains unclear. Here the effects of silicon on water uptake and transport of sorghum seedlings (Sorghum bicolor L.) growing under polyethylene glycol-simulated osmotic stress in hydroponic culture and water deficit stress in sand culture were investigated. Osmotic stress dramatically decreased dry weight, photosynthetic rate, transpiration rate, stomatal conductance, and leaf water content, but silicon application reduced these stress-induced decreases. Although silicon application had no effect on stem water transport capacity, whole-plant hydraulic conductance (Kplant) and root hydraulic conductance (Lp) were higher in silicon-treated seedlings than in those without silicon treatment under osmotic stress. Furthermore, the extent of changes in transpiration rate was similar to the changes in Kplant and Lp. The contribution of aquaporin to Lp was characterized using the aquaporin inhibitor mercury. Under osmotic stress, the exogenous application of HgCl2 decreased the transpiration rates of seedlings with and without silicon to the same level; after recovery induced by dithiothreitol (DTT), however, the transpiration rate was higher in silicon-treated seedlings than in untreated seedlings. In addition, transcription levels of several root aquaporin genes were increased by silicon application under osmotic stress. These results indicate that the silicon-induced up-regulation of aquaporin, which was thought to increase Lp, was involved in improving root water uptake under osmotic stress. This study also suggests that silicon plays a modulating role in improving plant resistance to osmotic stress in addition to its role as a mere physical barrier. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Directory of Open Access Journals (Sweden)
Flânia Mônego Argenta
2014-02-01
Full Text Available This study aimed to evaluate the parameters related to feedlot beef steers fed with Alexander grass silage or sorghum silage as roughage source. Twelve animals with initial average of weight and age of 245 kg and 20 months, respectively, belonging to Nellore (N, Charolais (C, 21/32 N 11/32 C, 21/32 C 11/32 N; 43/64 N 21/64 C and 43/64 C 21/64 N genetic groups were used. The ration was composed by a roughage:concentrate relation of 50:50 (dry matter basis, offered at ease. The dry matter, crude protein, ether extract, neutral detergent fiber and acid detergent fiber daily intake didn’t differ between roughage sources, being the medium values of 10.18; 1.28; 0.20; 4.96 and 2.51 kg/day, respectively. However, the ether extract intake by metabolic size and by corporal weight percentage were higher for the one that consumed sorghum silage, obtaining values of 2.74 and 2.36 g/metabolic size and 0.06 and 0.05 kg/100 kg of live weight. The same behavior was observed for digestible energy intake, presenting values of 364.87 and 302.83 g/metabolic size and 8.10 and 7.02 kg/100 kg of live weight. The daily average gain, final corporal score and feed conversion weren’t influenced by roughage type, being the values of 1.31 kg; 4.05 points and 7.78 kg of DM/kg of weight gain, respectively. The Alexander grass silage is a feasible alternative as its substitution in relation to sorghum silage.
Evaluation of sweet sorghum as a potential ethanol crop in Mississippi
Energy Technology Data Exchange (ETDEWEB)
Horton, David Scott
2011-08-01
Petroleum prices have made alternative fuel crops a viable option for ethanol production. Sweet sorghum [Sorghum bicolor] is a non-food crop that may produce large quantities of ethanol with minimal inputs. Eleven cultivars were planted in 2008 and 2009 as a half-season crop. Four-row plots 6.9 m by 0.5 m, were monitored bimonthly for ÃÂðBrix, height, and sugar accumulation. Yield and extractable sap were taken at the end of season. Stalk yield was greatest for the cultivar Sugar Top (4945 kg ha-1) and lowest for Simon (1054 kg ha-1). Dale ranked highest ethanol output (807 L ha-1) while Simon (123 L ha-1) is the lowest. All cultivars peak Brix accumulation occurs in early October. Individual sugar concentrations indicated sucrose is the predominant sugar with glucose and fructose levels dependent on cultivar. Supplemental ethanol in fermented wort was the best preservative tested to halt degradation of sorghum wort.
Application Of Database Program in selecting Sorghum (Sorghum bicolor L) Mutant Lines
International Nuclear Information System (INIS)
H, Soeranto
2000-01-01
Computer database software namely MSTAT and paradox have been exercised in the field of mutation breeding especially in the process of selecting plant mutant lines of sorghum. In MSTAT, selecting mutant lines can be done by activating the SELECTION function and then followed by entering mathematical formulas for the selection criterion. Another alternative is by defining the desired selection intensity to the analysis results of subprogram SORT. Including the selected plant mutant lines in BRSERIES program, it will make their progenies be easier to be traced in subsequent generations. In paradox, an application program for selecting mutant lines can be made by combining facilities of Table, form and report. Selecting mutant lines with defined selection criterion can easily be done through filtering data. As a relation database, paradox ensures that the application program for selecting mutant lines and progeny trachings, can be made easier, efficient and interactive
Ben-Israel, Imri; Kilian, Benjamin; Nida, Habte; Fridman, Eyal
2012-01-01
Identifying intra-locus interactions underlying heterotic variation among whole-genome hybrids is a key to understanding mechanisms of heterosis and exploiting it for crop and livestock improvement. In this study, we present the development and first use of the heterotic trait locus (HTL) mapping approach to associate specific intra-locus interactions with an overdominant heterotic mode of inheritance in a diallel population using Sorghum bicolor as the model. This method combines the advantages of ample genetic diversity and the possibility of studying non-additive inheritance. Furthermore, this design enables dissecting the latter to identify specific intra-locus interactions. We identified three HTLs (3.5% of loci tested) with synergistic intra-locus effects on overdominant grain yield heterosis in 2 years of field trials. These loci account for 19.0% of the heterotic variation, including a significant interaction found between two of them. Moreover, analysis of one of these loci (hDPW4.1) in a consecutive F2 population confirmed a significant 21% increase in grain yield of heterozygous vs. homozygous plants in this locus. Notably, two of the three HTLs for grain yield are in synteny with previously reported overdominant quantitative trait loci for grain yield in maize. A mechanism for the reproductive heterosis found in this study is suggested, in which grain yield increase is achieved by releasing the compensatory tradeoffs between biomass and reproductive output, and between seed number and weight. These results highlight the power of analyzing a diverse set of inbreds and their hybrids for unraveling hitherto unknown allelic interactions mediating heterosis.
Avanços tecnológicos na obtenção de Etanol a partir de Sorgo Sacarino: Sorghum Bicolor (l. Moench
Directory of Open Access Journals (Sweden)
Sandro Pedroso Cunha
2010-01-01
Full Text Available A substituição da utilização de gasolina por etanol em veículos reduz em até 90% a emissão de CO2, isto justifica o interesse nautilização de bioetanol como energia renovável. Além da cana-de-açúcar, mandioca, milho e beterraba especial destaque vemsendo dado ao sorgo sacarino (Sorgo bicolor L. Moench para produção de etanol pela sua produtividade e resistência. O sorgo écultivado no Rio Grande do Sul com uma produção de cerca de 70.000 t/ano. A Embrapa possui um programa de desenvolvimentode cultivares de sorgo sacarino desde a época do Pró-Álcool e atualmente novas variedades estão sendo avaliadas. Diversos fatorestêm relevância na otimização da produção como, aumento da produtividade e redução de custos na produção do etanol. Estetrabalho objetivou o levantamento de dados recentes que possibilitem avaliar parâmetros produtivos de etanol a partir de sorgo.Fatores como a diminuição dos riscos de contaminação bacteriana, meios propícios aos processos fermentativos do grão ou talo desorgo através da utilização do pré tratamento da amostra, têm sido de grande importância, pois trata-se de transformar biomassabasicamente celulósica em açúcares fermentáveis. Genótipos superiores de sorgo sacarino para produção de etanol são de sumaimportância, assim como processos mais adequados à conversão de açúcares em etanol. A lignina, tóxica frente aosmicrorganismos, impede a conversão da lignocelulose em etanol. A conversão de compostos lignocelulósicos a etanol baseia-seem: hidrólise da celulose produzindo açúcares simples e fermentação destes açúcares a etanol por via microbiológica.Abstract Replacing the use of gasoline by ethanol invehicles reduces by 90% the emission of CO2 which justifiesthe interest in the use of bioethanol as renewable energy.Besides sugar cane, cassava, maize and sugar beet therehave been given emphasis to sweet sorghum (Sorghumbicolor L. Moench to produce ethanol
Study on genotypic variation for ethanol production from sweet sorghum juice
Energy Technology Data Exchange (ETDEWEB)
Ratnavathi, C.V.; Suresh, K.; Kumar, B.S. Vijay; Pallavi, M.; Komala, V.V.; Seetharama, N. [Directorate of Sorghum Research, Rajendranagar, Hyderabad 500030, Andhra Pradesh (India)
2010-07-15
Sugarcane molasses is the main source for ethanol production in India. Sweet sorghum with its juicy stem containing sugars equivalent to that of sugarcane is a very good alternative for bio-ethanol production to meet the energy needs of the country. Sweet sorghum is drought resistant, water logging resistant and saline-alkaline tolerant. Growing sweet sorghum for ethanol production is relatively easy and economical and ethanol produced from sweet sorghum is eco-friendly. In view of this, it is important to identify superior genotypes for ethanol production in terms of percent juice brix, juice extractability, total fermentable sugars, ethanol yield and fermentation efficiency. This paper presents the study on the variability observed for the production of ethanol by various sweet sorghum genotypes in a laboratory fermentor. Five Sweet Sorghum (Sorghum bicolor L. Moench) genotypes were evaluated for ethanol production from stalk juice (Keller, SSV 84, Wray, NSSH 104 and BJ 248). Sweet sorghum juice differs from cane juice mainly in its higher content of starch and aconitic acid. Data were collected for biomass yield; stalk sugar yield and ethanol production in five genotypes. Maximum ethanol production of 9.0%w/v ethanol was obtained with Keller variety (20% sugar concentration was used), and decreased for other genotypes. A distiller's strain of Saccharomyces cerevisiae (gifted by Seagram Distilleries Ltd.) was employed for fermentation. The fermentation efficiency (FE) was 94.7% for this strain. High biomass of yeast was obtained with BJ 248 variety. When the similar experiments were conducted with unsterile sweet sorghum juice (15% sugar concentration) 6.47%w/v ethanol was produced. (author)
Effects of Cadmium on the Growth and Physiological Characteristics ...
African Journals Online (AJOL)
Administrator
2011-11-09
Nov 9, 2011 ... The effects of cadmium (Cd) stress on the growth and physiological characteristics were studied in 3 sorghum species viz., sweet sorghum [Sorghum bicolor (L.) Moench. cv. Hunnigreen], sorghum hybrid sudangrass (Sorghum bicolor × Sorghum sudanense, cv. Everlush) and sudangrass [Sorghum.
Effects of cadmium on the growth and physiological characteristics ...
African Journals Online (AJOL)
The effects of cadmium (Cd) stress on the growth and physiological characteristics were studied in 3 sorghum species viz., sweet sorghum [Sorghum bicolor (L.) Moench. cv. Hunnigreen], sorghum hybrid sudangrass (Sorghum bicolor × Sorghum sudanense, cv. Everlush) and sudangrass [Sorghum sudanense (Piper) Stapf ...
Characterization of Nitrogen use efficiency in sweet sorghum
Energy Technology Data Exchange (ETDEWEB)
Dweikat, Ismail [University of Nebraska; Clemente, Thomas [University of Nebrask
2014-09-09
Sweet sorghum (Sorghum bicolor L. Moench) has the potential to augment the increasing demand for alternative fuels and for the production of input efficient, environmentally friendly bioenergy crops. Nitrogen (N) and water availability are considered two of the major limiting factors in crop growth. Nitrogen fertilization accounts for about 40% of the total production cost in sorghum. In cereals, including sorghum, the nitrogen use efficiency (NUE) from fertilizer is approximately 33% of the amount applied. There is therefore extensive concern in relation to the N that is not used by the plant, which is lost by leaching of nitrate, denitrification from the soil, and loss of ammonia to the atmosphere, all of which can have deleterious environmental effects. To improve the potential of sweet sorghum as a leading and cost effective bioenergy crop, the enhancement of NUE must be addressed. To this end, we have identified a sorghum line (SanChi San) that displays about 25% increase in NUE over other sorghum lines. As such, the overarching goal of this project is to employ three complementary strategies to enhance the ability of sweet sorghum to become an efficient nitrogen user. To achieve the project goal, we will pursue the following specific objectives: Objective 1: Phenotypic characterization of SanChi San/Ck60 RILs under low and moderate N-availability including biochemical profiles, vegetative growth and seed yield Objective 2: Conduct quantitative trait loci (QTL) analysis and marker identification for nitrogen use efficiency (NUE) in a grain sorghum RIL population. Objective 3: Identify novel candidate genes for NUE using proteomic and gene expression profiling comparisons of high- and low-NUE RILs. Candidate genes will be brought into the pipeline for transgenic manipulation of NUE This project will apply the latest genomics resources to discover genes controlling NUE, one of the most complex and economically important traits in cereal crops. As a result of the
Lignin is known to impede conversion of lignocellulose into ethanol. In this study, forage sorghum plants carrying brown midrib (bmr) mutations, which reduce lignin contents, were evaluated as bioenergy feedstocks. The near isogenic lines evaluated were: wild-type, bmr-6, bmr-12, and bmr-6 bmr-12...
Granivorous birds and sorghum crop in the province of Villa Clara,Cuba
Directory of Open Access Journals (Sweden)
Orlando Miguel Saucedo Castillo
2017-07-01
Full Text Available In order to reduce the damages granivorous birds cause to sorghum (Sorghum bicolor L. Moench in the province of Villa Clara, Cuba, research based on the determination of the major endemic, migratory birds and their relationship with the distribution were made space of historical meteorological variables in the province in the seasonal behavior of birds in different climatic regions. Population to sorghum producers grouped in different forms surveys were conducted, which yielded a large database, such as the determination of the main grain-eating birds percentage damage incurred, varieties, grain color, growth stage and other indicators. Nine main species affecting sorghum grain-eating birds in our province were recorded; Passer domesticus, Lonchura malacca, Lonchura punctulata, Dives atroviolaceus, Passerina cyanea, Zonotrichia leucophrys, Columbina passerine, Zenaida macroura y Zenaida asiatica. The spatial distribution of meteorological variables and their relation to the seasonal behavior of birds in different climatic regions of the province was determined, based on record four preferential habitat areas. The results allowed us to provide companies and different forms of production in Villa Clara, the possibility of a varietal structure planting of sorghum on the basis of different preferential areas granivorous birds, together with the morphological and physiological characteristics of different genotypes introduced in agricultural production of the province and nationally.
Jia, Weitao; Lv, Sulian; Feng, Juanjuan; Li, Jihong; Li, Yinxin; Li, Shizhong
2016-09-01
Cadmium (Cd) contamination is a worldwide environmental problem, and remediation of Cd pollution is of great significance for food production as well as human health. Here, the responses of sweet sorghum cv. 'M-81E' to cadmium stress were studied for its potential as an energy plant in restoring soils contaminated by cadmium. In hydroponic experiments, the biomass of 'M-81E' showed no obvious change under 10 μM cadmium treatment. Cadmium concentration was the highest in roots of seedlings as well as mature plants, but in agricultural practice, the valuable and harvested parts of sweet sorghum are shoots, so promoting the translocation of cadmium to shoots is of great importance in order to improve its phytoremediation capacity. Further histochemical assays with dithizone staining revealed that cadmium was mainly concentrated in the stele of roots and scattered in intercellular space of caulicles. Moreover, the correlation analysis showed that Cd had a negative relationship with iron (Fe), zinc (Zn), and manganese (Mn) in caulicles and leaves and a positive relationship with Fe in roots. These results implied that cadmium might compete with Fe, Zn, and Mn for the transport binding sites and further prevent their translocation to shoots. In addition, transmission electron microscopic observations showed that under 100 μM cadmium treatment, the structure of chloroplast was impaired and the cell wall of vascular bundle cells in leaves and xylem and phloem cells in roots turned thicker compared to control. In summary, morphophysiological characteristic analysis demonstrated sweet sorghum can absorb cadmium and the growth is not negatively affected by mild level cadmium stress; thus, it is a promising material for the phytoremediation of cadmium-contaminated soils considering its economic benefit. This study also points out potential strategies to improve the phytoremediation capacity of sweet sorghum through genetic modification of transporters and cell wall
The effect of alpha amylase enzyme on quality of sweet sorghum juice for chrystal sugar
Marwati, T.; Cahyaningrum, N.; Widodo, S.; Astiati, U. T.; Budiyanto, A.; Wahyudiono; Arif, A. B.; Richana, N.
2018-01-01
Sweet sorghum juice (Sorghum bicolor L. Moench) has characteristics similar to sugar cane juice and potentially used for sugar substitutes that can support food security. Nevertheless the sweet sorghum juicecontain starch which impede sorghum sugar crystallization. Therefore, research on the enzymatic process is needed to convert starch into reducing sugar. The experimental design used was the Factorial Randomized Design with the first factor was alpha amylase enzyme concentration (0, 20, 40, 60, 80, 100, 120 μL/100 mL) and second factor was incubation time (0, 30, 60, 90 minute) at temperature 100°C. The experiment was conducted on fresh sweet sorghum. The results showed that the addition of the alpha amylase enzyme increased the content of reducing sugar and decreased levels of starch. Elevating concentration of alpha amylase enzyme will increase the reducing sugar content in sweet sorghum juice. The optimum alpha amylase enzyme concentration to produce the highest total sugar was 80 μL/100 mL of sweet sorghum juice with the optimum incubation time was 90 minutes. The results of this study are expected to create a new sweetener for sugar substitution. From the economic prospective aspect, sorghum is a potential crop and can be relied upon to support the success of the food diversification program which further leads to the world food security
DEFF Research Database (Denmark)
Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben
2013-01-01
(Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...
International Nuclear Information System (INIS)
Kanimoli, S.; Marimuthu, P.; Arulmozhiselvan, K.
2010-01-01
For studying the benefits of inoculation of N 2 fixing diazotrophs in the root zone of sorghum crop, a pot culture was conducted on neutral red sandy loam soil with sorghum cv. CO26, using 15 N tracer. At the end of 45 days duration after sowing, Beijerinckia indica inoculation contributed 56.9 per cent N derived from N 2 fixation, out of total N concentration in whole drymatter of sorghum plant. It proved to be the efficient N 2 fixer by contributing N from N 2 fixation to the tune of 17.6 Kg -1 . Accumulation of N derived from N 2 fixation from B. indica was primarily in leaf blade (50.0%) followed by stem (31.8%), leaf sheath (14.0%) and root (4.2%). Inoculation of Azospirillum brasllense accelerated uptake of N from soil and fertilizer N sources compared to B. indica and hence registered low N fixation. (author)
Energy Technology Data Exchange (ETDEWEB)
Mullins, J T; NeSmith, C
1988-01-01
Selected varieties of sorghum, Sorghum bicolor (L.) Moench, give high crop yields and they also return to favorable energy balance in terms of energy calories produced per cultural energy invested. The brown, condensed-tannin, bird- and mold-resistant varieties illustrate these advantages, but their nutritional value and ability to support the expected rate of ethanol fermentation is significantly lower than that of non-brown sorghums. It has been previously shown that the addition of nitrogen to brown sorghum mash supports a high rate of fermentative metabolism without removing the tannins, and suggested that the basis for the inhibition of ethanol fermentation was nitrogen starvation of the yeast cells. In this investigation, it is demonstrated that the addition of protease enzyme to mash results in an increase in amino nitrogen sufficient to support accelerated rates of ethanol fermentation by yeast cells. Thus, the hypothesis commonly cited in the literature that the presumed inhibitor, condensed tannins, function to reduce fermentative metabolism solely via the binding and precipitation of proteins is rejected.
Transcriptome Characterization and Functional Marker Development in Sorghum Sudanense.
Directory of Open Access Journals (Sweden)
Jieqin Li
Full Text Available Sudangrass, Sorghum sudanense, is an important forage in warm regions. But little is known about its genome. In this study, the transcriptomes of sudangrass S722 and sorghum Tx623B were sequenced by Illumina sequencing. More than 4Gb bases were sequenced for each library. For Tx623B and S722, 88.79% and 83.88% reads, respectively were matched to the Sorghum bicolor genome. A total of 2,397 differentially expressed genes (DEGs were detected by RNA-Seq between the two libraries, including 849 up-regulated genes and 1,548 down-regulated genes. These DEGs could be divided into three groups by annotation analysis. A total of 44,495 single nucleotide polymorphisms (SNPs were discovered by aligning S722 reads to the sorghum reference genome. Of these SNPs, 61.37% were transition, and this value did not differ much between different chromosomes. In addition, 16,928 insertion and deletion (indel loci were identified between the two genomes. A total of 5,344 indel markers were designed, 15 of which were selected to construct the genetic map derived from the cross of Tx623A and Sa. It was indicated that the indel markers were useful and versatile between sorghum and sudangrass. Comparison of synonymous base substitutions (Ks and non-synonymous base substitutions (Ka between the two libraries showed that 95% orthologous pairs exhibited Ka/Ks<1.0, indicating that these genes were influenced by purifying selection. The results from this study provide important information for molecular genetic research and a rich resource for marker development in sudangrass and other Sorghum species.
Directory of Open Access Journals (Sweden)
Jaime Humberto Bernal
2014-12-01
Full Text Available Sugar production in sweet sorghums is affected by the environment. Therefore, in this study on the effects of the genotype x environment interaction on sugar accumulation, plant traits associated with the sugar content in the stem were evaluated in ten sorghum genotypes grown in six contrasting environments. The results indicated that the stem dry weight, juice sugar concentration (°Brix, stem sugar content and juice volume were controlled by the genetic constitution of the genotype, with a large environmental contribution to their expression. The results allowed for the identification of the sweet sorghum genotypes that have a high potential for the biofuel agroindustry due to their high sugar contents in the environmental conditions of Palmira, Espinal, Cerete and Codazzi. Humid tropical environments such as Gaitan and Villavicencio were less favorable for the competitive production of sweet sorghums for bioethanol due to their low levels of solar radiation and soil fertility.
Directory of Open Access Journals (Sweden)
Oluwatoyin Olugbemi
2016-01-01
Full Text Available A study was carried out in two locations, Ilorin (8° 29′ N; 4° 35′ E; about 310 m asl and Ejiba (8° 17′ N; 5° 39′ E; about 246 m asl, at the Southern Guinea Savannah agroecological zone of Nigeria to assess the effect of nitrogen fertilizer on the growth and ethanol yield of four sweet sorghum varieties (NTJ-2, 64 DTN, SW Makarfi 2006, and SW Dansadau 2007. Five N fertilizer levels (0, 40, 80, 120, and 160 kg ha−1 were used in a 4 × 5 factorial experiment, laid out in split-plots arrangement. The application of nitrogen fertilizer was shown to enhance the growth of sweet sorghum as observed in the plant height, LAI, CGR, and other growth indices. Nitrogen fertilizer application also enhanced the ethanol yield of the crop, as variations in growth parameters and ethanol yield were observed among the four varieties studied. The variety SW Dansadau 2007 was observed as the most promising in terms of growth and ethanol yield, and the application of 120 kg N ha−1 resulted in the best ethanol yield at the study area.
Directory of Open Access Journals (Sweden)
Ilaria Proietti
2015-03-01
Full Text Available Sorghum (Sorghum bicolor (L. Moench is a drought-resistant crop and an important food resource in terms of nutritional as well as social-economic values, especially in semi-arid environments. Cultivar selection and processing methods have been observed to impact on composition and functional and nutritional value of sorghum. Amino acid imbalance, cyanogenic glycosides, endogenous anti-nutrients, mycotoxins and toxic elements are among factors impairing its nutritional value. This paper reviews possible approaches (varieties selection, production practices, cooking processes to improve the benefits-to-risks balance of sorghum meal, to mitigate the risk of deficiencies and/or imbalances and to improve effects on human nutrition. Opportunity for avoiding dietary diversification in high sorghum consumers is also discussed, e.g., tryptophan and niacin deficits potentially related to pellagra, or unavailability of proteins and divalent cations (e.g., Fe, Zn due to the antinutrient activity of phytic acid and tannins. As potential candidate for production investments, the role of sorghum in preserving biological diversity is also considered.
Green, Abigail R; Lewis, Kevin M; Barr, John T; Jones, Jeffrey P; Lu, Fachuang; Ralph, John; Vermerris, Wilfred; Sattler, Scott E; Kang, ChulHee
2014-08-01
Using S-adenosyl-methionine as the methyl donor, caffeic acid O-methyltransferase from sorghum (Sorghum bicolor; SbCOMT) methylates the 5-hydroxyl group of its preferred substrate, 5-hydroxyconiferaldehyde. In order to determine the mechanism of SbCOMT and understand the observed reduction in the lignin syringyl-to-guaiacyl ratio of three brown midrib12 mutants that carry COMT gene missense mutations, we determined the apo-form and S-adenosyl-methionine binary complex SbCOMT crystal structures and established the ternary complex structure with 5-hydroxyconiferaldehyde by molecular modeling. These structures revealed many features shared with monocot ryegrass (Lolium perenne) and dicot alfalfa (Medicago sativa) COMTs. SbCOMT steady-state kinetic and calorimetric data suggest a random bi-bi mechanism. Based on our structural, kinetic, and thermodynamic results, we propose that the observed reactivity hierarchy among 4,5-dihydroxy-3-methoxycinnamyl (and 3,4-dihydroxycinnamyl) aldehyde, alcohol, and acid substrates arises from the ability of the aldehyde to stabilize the anionic intermediate that results from deprotonation of the 5-hydroxyl group by histidine-267. Additionally, despite the presence of other phenylpropanoid substrates in vivo, sinapaldehyde is the preferential product, as demonstrated by its low K m for 5-hydroxyconiferaldehyde. Unlike its acid and alcohol substrates, the aldehydes exhibit product inhibition, and we propose that this is due to nonproductive binding of the S-cis-form of the aldehydes inhibiting productive binding of the S-trans-form. The S-cis-aldehydes most likely act only as inhibitors, because the high rotational energy barrier around the 2-propenyl bond prevents S-trans-conversion, unlike alcohol substrates, whose low 2-propenyl bond rotational energy barrier enables rapid S-cis/S-trans-interconversion. © 2014 American Society of Plant Biologists. All Rights Reserved.
PENENTUAN DOSIS OPTIMUM PEMUPUKAN N, P, DAN K PADA SORGUM (SORGHUM BICOLOR [L.] MOENCH
Directory of Open Access Journals (Sweden)
Ratna Suminar
2017-04-01
Full Text Available Development of sorghum processing industries is essential in expanding sorghum market as wells as it’s an economic value. Fertilizer is needed in planting. Nitrogen, phosphorus, and potassium availabilities are the most limiting factors for maximum growth and yield. Sorghum (Numbu Variety was planted to evaluate the maximum and optimum rates of N, P, and K fertilizers. The research was conducted in Cikarawang field, Darmaga, Bogor from MarchJuly 2015 with multi-nutrient response method. Each experiment evaluated different rates of N, P, and K fertilizer with randomized complete block design and three replications. The fertilizer rates were 0, 50, 100, 150, and 200% of recommendation rate (100% N = 120 kg N ha-1, 100% P = 36 kg P2O5 ha-1, and 100% K = 90 kg K2O ha-1. The result showed relative yields of sorghum increased quadratically based on y = -0,0015x2 + 0,4011x + 67,571 for N, y = -0,0012x2 + 0,2917x + 78,457 for P2O5, and y = -0,001x2 + 0,2777x + 74,457 for K2O. The maximum rate for each nutrient was 160,4-43,7-124,9 kg N-P2O5-K2O ha-1. Fertilizer recommendation based on P threshold (no P was 36,7-0,0-13,7 kg N-P2O5-K2O ha-1, K threshold (no K was 22,0-0,0-0,0 kg N-P2O5-K2O ha-1, and no fertilizer needed on N threshold. The optimum rate fertilizer based on the yield vs. cost rule, therefore, the most economical recommendation would be 160,4-43,7-124,9 kg N-P2O5-K2O ha-1.
Simulating the Probability of Grain Sorghum Maturity before the First Frost in Northeastern Colorado
Directory of Open Access Journals (Sweden)
Gregory S. McMaster
2016-09-01
Full Text Available Expanding grain sorghum [Sorghum bicolor (L. Moench] production northward from southeastern Colorado is thought to be limited by shorter growing seasons due to lower temperatures and earlier frost dates. This study used a simulation model for predicting crop phenology (PhenologyMMS to estimate the probability of reaching physiological maturity before the first fall frost for a variety of agronomic practices in northeastern Colorado. Physiological maturity for seven planting dates (1 May to 12 June, four seedbed moisture conditions affecting seedling emergence (from Optimum to Planted in Dust, and three maturity classes (Early, Medium, and Late were simulated using historical weather data from nine locations for both irrigated and dryland phenological parameters. The probability of reaching maturity before the first frost was slightly higher under dryland conditions, decreased as latitude, longitude, and elevation increased, planting date was delayed, and for later maturity classes. The results provide producers with estimates of the reliability of growing grain sorghum in northeastern Colorado.
Directory of Open Access Journals (Sweden)
Mvondo-Awono, JP.
2013-01-01
Full Text Available Recovery of sorghum (Sorghum bicolor [L.] Moench production capacity in degraded vertisols in the Far North Region of Cameroon. In Northern Cameroon, degraded soils represent 10 to 20% of arable land. Recovering the production capacity of these degraded soils is one of the main challenges faced by agriculture in the region. The objective of the present study, conducted from 2007 to 2009, was to examine the possibility of growing sorghum on degraded and bare vertisols. A combination of the following techniques was used in a randomized complete block design: two land preparation techniques (plowing or mounding, two levels of cow dung dust (6 or 12 t·ha-1 and three rates of urea application (0, 50 or 100 kg·ha-1. The soil was sampled at a depth of up to 25 cm and was analyzed for its properties following standard analytical procedures. Critical levels established for tropical soils were used to declare sufficiency or deficiency of soil nutrients within the samples. Sorghum straw and grain yields were obtained and analyzed. Soil characteristics were found to be similar to those of other degraded vertisols found in the Far North Region of Cameroon. The hard top soil layer was found to be unfavorable to the establishment of sorghum. On the other hand, levels of organic carbon (0.85% and the sum of cations (4.91 meq·100 g-1 of soil were found to be favorable. The ratio of cations was found to be unfavorable to Ca. Available phosphorus (5.35 mg·kg-1 of soil and total N (0.04 g·kg-1 were very low. Following the application of treatments, 2.4 to 3.5 t·ha-1 of sorghum straw were produced and 1.3 to 2.8 t·ha-1 of grain were harvested during the experimental period. Soil plowing and mounding successfully disturbed the hard top soil layer. Soil mounding resulted into in a 16% increase in straw production in comparison with soil plowing alone. The application of 12 t·ha-1 of cow dung dust produced an additional grain yield of 17% in 2008 and of 39% in
Directory of Open Access Journals (Sweden)
alireza beheshti
2017-12-01
Full Text Available Introduction Dry matter production is a function of photosynthesis active radiation absorption (APAR and radiation use efficiency. Sorghum genotypes are different in total dry matter, but the reason of these different is not clear. Producing dry matter is affected by nitrogen distributing method, but the way of this effectiveness on producing of dry matter in sorghum genotypes is not also specified. This paper focused on evaluation of receiving and absorbing PAR, which is affected by nitrogen usage method in forage sorghum genotypes, and reasons of the differences between these genotypes in production of dry matter. The variation in efficiency of APAR depends on two chemical and morphological characteristics of the vegetation, including canopy nitrogen content (NCANOPY and the canopy average for mass per unit of area (Merea. Material and Methods In order to investigate the cumulative photosynthetically active radiation (CPAR and radiation use efficiency (RUE under distributing of nitrogen side dressing and non-distributing conditions, an experiment was conducted at Khorasan Razavei Agriculture and Natural Resources , Research Center Mashhad , Iran. The statical method was according to spilt plots base on randomized complete block design with three replicates. The main plots were fifteen forage sorghum genotypes (Promising lines kfs1, kfs2, kfs3, kfs6, kfs7, kfs8, kfs9, kfs10, kfs11, kfs12, kfs13, kfs15, kfs16, kfs17, kfs18 and the subplots consisted of distributing of nitrogen side dressing and non-distributing. The samples were obtained 5 times during the growing season for determination of some characteristics including dry matter (TDM, leaf area index (LAI and Photosynthetically active radiation (PAR. Then total dry matter (TDM, cumulative Photosynthetically active radiation (CPAR and radiation use efficiency (RUE were calculated by these traits. Absorbed radiation measured by Sub Scan model SSI-UM-1.05 on five location of each plot on bottom
Directory of Open Access Journals (Sweden)
Thompson Karen J
2002-01-01
Full Text Available Abstract Background Factors that affect flowering vary among different plant species, and in the grasses in particular the exact mechanism behind this transition is not fully understood. The brown midrib (bm mutants of maize (Zea mays L., which have altered cell wall composition, have different flowering dynamics compared to their wild-type counterparts. This is indicative of a link between cell wall biogenesis and flowering. In order to test whether this relationship also exists in other grasses, the flowering dynamics in sorghum (Sorghum bicolor (L. Moench were investigated. Sorghum is evolutionarily closely related to maize, and a set of brown midrib (bmr mutants similar to the maize bm mutants is available, making sorghum a suitable choice for study in this context. Results We compared the flowering time (time to half-bloom of several different bmr sorghum lines and their wild-type counterparts. This revealed that the relationship between cell wall composition and flowering was conserved in sorghum. Specifically, the mutant bmr7 flowered significantly earlier than the corresponding wild-type control, whereas the mutants bmr2, bmr4, bmr6, bmr12, and bmr19 flowered later than their wild-type controls. Conclusion The change in flowering dynamics in several of the brown midrib sorghum lines provides evidence for an evolutionarily conserved mechanism that links cell wall biosynthesis to flowering dynamics. The availability of the sorghum bmr mutants expands the germplasm available to investigate this relationship in further detail.
Effects of Cerium Oxide Nanoparticles on Sorghum Plant Traits
Mu, L.; Chen, Y.; Darnault, C. J. G.; Rauh, B.; Kresovich, S.; Korte, C.
2015-12-01
Nanotechnology and nanomaterials are considered as the development of the modern science. However, besides with that wide application, nanoparticles arouse to the side effects on the environment and human health. As the catalyst of ceramics and fuel industry, Cerium (IV) oxide nanoparticles (CeO2 NPs) can be found in the environment following their use and life-cycle. Therefore, it is critical to assess the potential effects that CeO2 NPs found in soils may have on plants. In this study, CeO2 NPs were analyzed for the potential influence on the sorghum [Sorghum bicolor (L.) Moench] (Reg. no. 126) (PI 154844) growth and traits. The objectives of this research were to determine whether CeO2 NPs impact the sorghum germination and growth characteristics. The sorghum was grown in the greenhouse located at Biosystems Research Complex, Clemson University under different CeO2 NPs treatments (0mg; 100mg; 500mg; 1000mg CeO2 NPs/Kg soil) and harvested around each month. At the end of the each growing period, above ground vegetative tissue was air-dried, ground to 2mm particle size and compositional traits estimated using near-infrared spectroscopy. Also, the NPK value of the sorghum tissue was tested by Clemson Agriculture Center. After the first harvest, the result showed that the height of above ground biomass under the nanoparticles stress was higher than that of control group. This difference between the control and the nanoparticles treatments was significant (F>F0.05; LSD). Our results also indicated that some of the compositional traits were impacted by the different treatments, including the presence and/or concentrations of the nanoparticles.
The wheat Lr34 multipathogen resistance gene confers resistance to anthracnose and rust in sorghum.
Schnippenkoetter, Wendelin; Lo, Clive; Liu, Guoquan; Dibley, Katherine; Chan, Wai Lung; White, Jodie; Milne, Ricky; Zwart, Alexander; Kwong, Eunjung; Keller, Beat; Godwin, Ian; Krattinger, Simon G; Lagudah, Evans
2017-11-01
The ability of the wheat Lr34 multipathogen resistance gene (Lr34res) to function across a wide taxonomic boundary was investigated in transgenic Sorghum bicolor. Increased resistance to sorghum rust and anthracnose disease symptoms following infection with the biotrophic pathogen Puccinia purpurea and the hemibiotroph Colletotrichum sublineolum, respectively, occurred in transgenic plants expressing the Lr34res ABC transporter. Transgenic sorghum lines that highly expressed the wheat Lr34res gene exhibited immunity to sorghum rust compared to the low-expressing single copy Lr34res genotype that conferred partial resistance. Pathogen-induced pigmentation mediated by flavonoid phytoalexins was evident on transgenic sorghum leaves following P. purpurea infection within 24-72 h, which paralleled Lr34res gene expression. Elevated expression of flavone synthase II, flavanone 4-reductase and dihydroflavonol reductase genes which control the biosynthesis of flavonoid phytoalexins characterized the highly expressing Lr34res transgenic lines 24-h post-inoculation with P. purpurea. Metabolite analysis of mesocotyls infected with C. sublineolum showed increased levels of 3-deoxyanthocyanidin metabolites were associated with Lr34res expression, concomitant with reduced symptoms of anthracnose. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
Soper, Alysha M; Whitworth, R Jeff; McCornack, Brian P
2013-01-01
Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed.
Soper, Alysha M.; Whitworth, R. Jeff; McCornack, Brian P.
2013-01-01
Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed. PMID:24219328
Woldesemayat, Adugna Abdi; Van Heusden, Peter; Ndimba, Bongani K; Christoffels, Alan
2017-12-22
Drought is the most disastrous abiotic stress that severely affects agricultural productivity worldwide. Understanding the biological basis of drought-regulated traits, requires identification and an in-depth characterization of genetic determinants using model organisms and high-throughput technologies. However, studies on drought tolerance have generally been limited to traditional candidate gene approach that targets only a single gene in a pathway that is related to a trait. In this study, we used sorghum, one of the model crops that is well adapted to arid regions, to mine genes and define determinants for drought tolerance using drought expression libraries and RNA-seq data. We provide an integrated and comparative in silico candidate gene identification, characterization and annotation approach, with an emphasis on genes playing a prominent role in conferring drought tolerance in sorghum. A total of 470 non-redundant functionally annotated drought responsive genes (DRGs) were identified using experimental data from drought responses by employing pairwise sequence similarity searches, pathway and interpro-domain analysis, expression profiling and orthology relation. Comparison of the genomic locations between these genes and sorghum quantitative trait loci (QTLs) showed that 40% of these genes were co-localized with QTLs known for drought tolerance. The genome reannotation conducted using the Program to Assemble Spliced Alignment (PASA), resulted in 9.6% of existing single gene models being updated. In addition, 210 putative novel genes were identified using AUGUSTUS and PASA based analysis on expression dataset. Among these, 50% were single exonic, 69.5% represented drought responsive and 5.7% were complete gene structure models. Analysis of biochemical metabolism revealed 14 metabolic pathways that are related to drought tolerance and also had a strong biological network, among categories of genes involved. Identification of these pathways, signifies the
Directory of Open Access Journals (Sweden)
J.J.O Pinto
2009-12-01
áveis ao sorgo cultivado em safra subsequente ao arroz.The objective of this research was to evaluate the field persistence of the herbicide Only (imazethapyr+imazapic, to grain sorghum, planted in rotation after one, two or three years of Clearfield® (CL rice. The field study was carried out at Universidade Federal de Pelotas, Capão do Leão, state of Rio Grande do Sul. Clearfield rice was established as the main crop, Italian ryegrass as a succession crop and grain sorghum, as a rotation crop after CL rice. Except for the first rice crop, all the other cultures were planted as no-till rice. Ryegrass plants were burned down in every experiment using glyphosate (760 g a.e. ha-1. The experimental design was a factorial with treatments arranged in a complete randomized design, with four replications, where factor A was the number of CL rice seasons and B was the herbicide rate. The rice cultivar was IRGA 422 CL, and the herbicide treatments were Only (imazethapyr+imazapic at 0; (75+25; (112.5+37.5 and (150+50 g ha-1. Adjuvant Dash was added to the herbicide at 0.5% v/v. The experiments were labeled as A1, A2 or A3, respectively, for one, two or three years of CL rice. Grain sorghum, cv. BR 304, was planted as a bioindicator of herbicide residue. The following parameters were evaluated: plant population, plant height; above ground biomass, 1000-grain weight and grain yield. As for grain sorghum plant height and 1000-seed weight, an interaction was observed between the different environments (years of CL rice and herbicide rate (imazethapyr+imazapic. For the other parameters, only effect for herbicide rat was detected. The results suggested that all grain sorghum parameters were affected by the herbicides (imazethapyr+ imazapic in the soil. Grain sorghum injury increased with herbicide rate. In conclusion, grain sorghum, planted in rotation with rice is affected by the residue of the herbicide Only (imazethapyr+imazapic applied to Clearfield® rice.
Utilization of Iles-Iles and Sorghum Starch for Bioethanol Production
Directory of Open Access Journals (Sweden)
Kusmiyati Kusmiyati
2014-05-01
Full Text Available The aims of this study were to convert the starches from iles-iles tubers (Amorphophalus campanulatus and sorghum grains (Sorghum bicolor L into bioethanol as an alternative energy. Both of these agricultural products contains a high content starches and they do not use as the major foods in Indonesia. To find out the maximum ethanol concentration and yield, both the raw materials were converted to ethanol on various process variables including the concentration of flour substrate solution (100-300 g/L, β-amylase enzyme concentration (0.8 - 6.4 ml/kg of flour , the concentration of dry yeast S. cerevisiae (2-15 g, and fermentation time (72-168 hours. The results showed that at the flour substrate concentration of 250 g/L produced the maximum ethanol contents of 100.29 g/L and 95.11 g/L for iles-iles and sorghum, respectively. Effect of β-amylase enzyme in the saccharification process showed that at concentration of 3.2 ml/kg the maximum reducing sugar content of 204.94 g/L and 193.15 g/L for iles-iles and sorghum substrate, respectively were generated therefore it was corresponding to the maximum ethanol production. The concentration effect of dry yeast S. cerevisiae in the fermentation stage for the iles-iles and sorghum substrate revealed that the maximum ethanol obtained at 5 g yeast activated in 100 ml medium starter resulted the highest ethanol content 100.29 g/L 95.11 g/L for iles-iles and sorghum substrate, respectively. To determine the effect of fermentation time on ethanol yield from iles-iles and sorghum substrate, the fermentation process were performed at 3, 5, and 7 days. The maximum ethanol fermentation was obtained at 5 days fermentation. The ethanol yield is calculated by weight of ethanol is formed (g divided by the weight of flour (g. Based on the experiment results, conducted, generally the highest ethanol yield of iles-iles was higher than that of sorghum flour. The highest yield (g/g iles-iles and sorghum
Green, Abigail R.; Lewis, Kevin M.; Barr, John T.; Jones, Jeffrey P.; Lu, Fachuang; Ralph, John; Vermerris, Wilfred; Sattler, Scott E.; Kang, ChulHee
2014-01-01
Using S-adenosyl-methionine as the methyl donor, caffeic acid O-methyltransferase from sorghum (Sorghum bicolor; SbCOMT) methylates the 5-hydroxyl group of its preferred substrate, 5-hydroxyconiferaldehyde. In order to determine the mechanism of SbCOMT and understand the observed reduction in the lignin syringyl-to-guaiacyl ratio of three brown midrib12 mutants that carry COMT gene missense mutations, we determined the apo-form and S-adenosyl-methionine binary complex SbCOMT crystal structures and established the ternary complex structure with 5-hydroxyconiferaldehyde by molecular modeling. These structures revealed many features shared with monocot ryegrass (Lolium perenne) and dicot alfalfa (Medicago sativa) COMTs. SbCOMT steady-state kinetic and calorimetric data suggest a random bi-bi mechanism. Based on our structural, kinetic, and thermodynamic results, we propose that the observed reactivity hierarchy among 4,5-dihydroxy-3-methoxycinnamyl (and 3,4-dihydroxycinnamyl) aldehyde, alcohol, and acid substrates arises from the ability of the aldehyde to stabilize the anionic intermediate that results from deprotonation of the 5-hydroxyl group by histidine-267. Additionally, despite the presence of other phenylpropanoid substrates in vivo, sinapaldehyde is the preferential product, as demonstrated by its low Km for 5-hydroxyconiferaldehyde. Unlike its acid and alcohol substrates, the aldehydes exhibit product inhibition, and we propose that this is due to nonproductive binding of the S-cis-form of the aldehydes inhibiting productive binding of the S-trans-form. The S-cis-aldehydes most likely act only as inhibitors, because the high rotational energy barrier around the 2-propenyl bond prevents S-trans-conversion, unlike alcohol substrates, whose low 2-propenyl bond rotational energy barrier enables rapid S-cis/S-trans-interconversion. PMID:24948836
Directory of Open Access Journals (Sweden)
Sri Utami Lestari
2015-02-01
Full Text Available ABSTRACT Sorghum has the advantage on agroecology broad adaptability, resistant to drought, higher production, and greater resistance to pests and diseases than other food crops. In addition to food substitution of sorghum utilization can also be used as a raw material source of alternative energy, namely as a fertilizer industry bioethanol.Dengan the bones of calcium and magnesium in the soil can be supplied and is also expected to increase the soil pH. The purpose of this study was to determine the effect and get a good dose of fertilizer tlang on the growth of sorghum. Research conducted an experiment with completely randomized design consisting of 4 levels treatments and 3 replications. S0 = Without treatment (control, S1 = Giving bone meal 5 g / plant, S2 = Giving bone flour 10 gr / plant, S3 = Giving bone flour 15 gr / plant. Data were analyzed using analysis of variance if F count ≥ F tables at the level of 5%, then followed by a further test Duncans. The results Award bone meal no real effect on all parameters of plant growth (plant height, leaf width and leaf length, results showed an increasing trend of numerical results with increasing dose given bone meal.
Directory of Open Access Journals (Sweden)
Nano Alemu Daba
2017-04-01
Full Text Available The study was conducted on farmers' field in sofi district of Harari Regional State during 2013/2014 main cropping season, eastern Ethiopia, to investigate the impact of brewery sludge on sorghum production and soil fertility. The treatments comprised seven levels of brewery sludges (0, 2.5, 5.0, 7.5, 10.0, 12.5 and 15.0 t ha-1 and NP inorganic fertilizer at recommended rate, arranged in randomized complete block design with four replications. Application of brewery sludge at 15 t ha-1 significantly increased the yield and biomass yield of sorghum by 79 and 85% over control and by 57 and 67% over NP application, respectively. There was no effect of brewery sludge application on heavy metals concentrations in soil after crop harvest, compared to international standard tolerable level. Co and Se levels were high in the control as well as in the soils treated with brewery sludge indicating the already high concentration of these heavy metals in the soils of the area. Plots, which received higher brewery sludge application, resulted in decreased or less percentage of grain nitrogen content showing the independence of grain protein content on lower brewery sludge level. The nitrogen uptake by sorghum grain, straw and the total was maximum (52.68, 44.25 and 79.03 kg ha-1, respectively with the application of brewery waste sludge at 10 and 15 t ha-1 which were significantly higher than the other brewery sludge and NP mineral fertilizer applications.
Czech Academy of Sciences Publication Activity Database
Soudek, Petr; Rodriguez Valseca, I. M.; Petrová, Šárka; Song, J.; Vaněk, Tomáš
2017-01-01
Roč. 182, NOV (2017), s. 157-165 ISSN 0375-6742 R&D Projects: GA MŠk(CZ) LD13029 Institutional support: RVO:61389030 Keywords : polycyclic aromatic-hydrocarbons * sorption behavior * soil * copper * lead * contaminants * remediation * amendments * mobility * compost * Biochar * Copper * Lead * Cadmium * Seed germination * Sorghum bicolor * PAHs * Sorption Subject RIV: DN - Health Impact of the Environment Quality OBOR OECD: Plant sciences, botany Impact factor: 2.464, year: 2016
Li, Ying; Yuan, Fang; Wang, Baoshan
2018-02-01
In order to investigate the maximum storage period during their natural growth state, the sweet sorghum (Sorghum bicolor L. Moench) stems of four cultivars were analyzed to determine changes in contents of water, total sugars, main soluble sugars and the enzyme activity. From early November 2016 to late January 2017, the decrease in the total sugar content and the contents of sucrose, glucose and fructose slowed down, and the enzyme activities (sucrose synthase and sucrose phosphate synthase) involving sucrose metabolism in the stem remained stable. However, these indicators decreased significantly after the end of January 2017. Low temperatures and a dry environment were conducive to the storage of the sweet sorghum stems. During the winter (from early November 2016 to late January 2017) in northern China, the sweet sorghum plants can be stored naturally in the field via regulating sowing dates, which saves a lot of storage space and production costs for bioethanol company.
Radiation-use efficiency response to vapor pressure deficit for maize and sorghum
International Nuclear Information System (INIS)
Kiniry, J.R.; Landivar, J.A.; Witt, M.; Gerik, T.J.; Cavero, J.; Wade, L.J.
1998-01-01
Variability within a crop species in the amount of dry mass produced per unit intercepted solar radiation, or radiation-use efficiency (RUE), is important for the quantification of plant productivity. RUE has been used to integrate (1) leaf area, (2) solar radiation interception, and (3) productivity per unit leaf area into crop productivity. Responsiveness of RUE to vapor pressure deficit (VPD) should relate closely to responsiveness of CO 2 exchange rate (CER) to VPD. The objective of this study was to compare independent RUE measurements to published response functions relating VPD with RUE of maize (Zea mays L.) and grain sorghum [Sorghum bicolor L. (Moench)]. Data sets from five locations covering a wide range of mean VPD values were compared to published response functions. Predicted RUE values were nearly always within the 95% confidence intervals of measurements. Measured RUE of maize decreased as VPD increased from 0.9 to 1.7 kPa. For sorghum, measured values of RUE agreed closely with predictions. RUE of sorghum decreased as VPD increased from 1.1 to 2.2 kPa. The relative RUE:VPD responses for these two species were similar to CER:VPD responses reported in the literature. Thus, these RUE:VPD responses may be general and appear to be related to carbon exchange rates. We calculated the expected impacts of VPD on RUE at three USA locations during maize and sorghum growing seasons. The RUE:VPD equations offer hope in describing location effects and time-of-year effects on RUE. (author)
Fina, Brenda L; Lupo, Maela; Dri, Nicolas; Lombarte, Mercedes; Rigalli, Alfredo
2016-08-01
Fluorosis is a disease caused by over-exposure to fluoride (F). Argentina's rural lands have higher fluorine content than urban lands. Evidence confirms that plants grown in fluoridated areas could have higher F content. We compared F uptake and growth of crops grown in different F concentrations. The effect of 0-8 ppm F concentrations on maize, soybeans and sorghum germination and growth was compared. After 6 days seeding, the germination was determined, the roots and aerial parts lengths were measured, and vigor index was calculated. F content was measured in each part of the plants. Controls with equal concentrations of NaCl were carried out. Significant decrease in roots and aerial parts lengths, and in vigor index of maize and soybeans plants was observed with F concentrations greater than 2 ppm. This was not observed in sorghum seedlings. Also, the amount of F in all crops augmented as F increases, being higher in roots and ungerminated seeds. Sorghum was the crop with the highest F content. Fluoride decreased the germination and growth of maize and soybeans and therefore could influence on their production. Conversely, sorghum seems to be resistant to the action of F. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Genomic prediction applied to high-biomass sorghum for bioenergy production.
de Oliveira, Amanda Avelar; Pastina, Maria Marta; de Souza, Vander Filipe; da Costa Parrella, Rafael Augusto; Noda, Roberto Willians; Simeone, Maria Lúcia Ferreira; Schaffert, Robert Eugene; de Magalhães, Jurandir Vieira; Damasceno, Cynthia Maria Borges; Margarido, Gabriel Rodrigues Alves
2018-01-01
The increasing cost of energy and finite oil and gas reserves have created a need to develop alternative fuels from renewable sources. Due to its abiotic stress tolerance and annual cultivation, high-biomass sorghum ( Sorghum bicolor L. Moench) shows potential as a bioenergy crop. Genomic selection is a useful tool for accelerating genetic gains and could restructure plant breeding programs by enabling early selection and reducing breeding cycle duration. This work aimed at predicting breeding values via genomic selection models for 200 sorghum genotypes comprising landrace accessions and breeding lines from biomass and saccharine groups. These genotypes were divided into two sub-panels, according to breeding purpose. We evaluated the following phenotypic biomass traits: days to flowering, plant height, fresh and dry matter yield, and fiber, cellulose, hemicellulose, and lignin proportions. Genotyping by sequencing yielded more than 258,000 single-nucleotide polymorphism markers, which revealed population structure between subpanels. We then fitted and compared genomic selection models BayesA, BayesB, BayesCπ, BayesLasso, Bayes Ridge Regression and random regression best linear unbiased predictor. The resulting predictive abilities varied little between the different models, but substantially between traits. Different scenarios of prediction showed the potential of using genomic selection results between sub-panels and years, although the genotype by environment interaction negatively affected accuracies. Functional enrichment analyses performed with the marker-predicted effects suggested several interesting associations, with potential for revealing biological processes relevant to the studied quantitative traits. This work shows that genomic selection can be successfully applied in biomass sorghum breeding programs.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Siderophore production by mycorrhizal sorghum roots under micronutrient deficient condition
Directory of Open Access Journals (Sweden)
N. Aliasgharzad
2009-05-01
Full Text Available It has widely been accepted that mycorrhizal symbiosis improves micronutrients uptake by most of the plants. In this study, sorghum (Sorghum bicolor L. plants were grown in sterile perlite and were inoculated with either Glomus etunicatum (GE or G.intraradices (GI, while the control set was left un-inoculated. Rorison's nutrient solution with three levels of 0, half and full strength (C0, C0.5 and C1, respectively of Fe, Cu, Zn and Mn was applied to the pots during 85 days of growth period. Chrome azurol-S assay was used for determination of siderophores in root leachates on 45, 65 and 85 days after sowing (DAS. Siderophore production per unit volume of root was higher in mycorrhizal than non-mycorrhizal plants. Both GE and GI were efficient fungi in this respect. Siderophore production was significantly induced at C0 level of the micronutrients. Amount of siderophores produced on 45 and 85 DAS was more than 65 DAS. Mycorrhizal root colonization by GE or GI was not significantly affected by micronutrient levels.
International Nuclear Information System (INIS)
Kurdali, F.; Al-Ain, F.; Razok, A.; Al-Shamma, M.
2008-01-01
A field experiment was conducted on a salt-affected soil to determine the effect of application of three types of Dhaincha (Sesbania aculeata pers.) residues (R, roots; L, shoots; L+R, shoots plus roots) of on the performance of sorghum (Sorghum bicolor L.) using the indirect 15 N isotopic dilution technique. Results indicated that Sesbania residues (L and L+R), used as green manures significantly increased grain yield, dry matter production, N uptake, and water use efficiency of sorghum. Percentages of N derived from residues (%Ndfr) in sorghum ranged from 6.4 to 28%. The N recoveries in sorghum were 52, 19. and 19.7% of the total amount contained in Sesbania roots, shoots and roots plus shoots, respectively. The beneficial effects of Sesbania residues are attributed not only to the additional N availability to the plants, but also to effects on the enhancement of soil N uptake, particularly in the L+R treatment. The findings suggest that the use of Sesbania aculeata residues, as a green manure, can provide a substantial portion of total N in sorghum. In addition, the use of Sesbania green manure in salt-affected soils, as a bio-reclaiming material, can be a promising approach for enhancing plant growth on a sustainable basis. (author)
Directory of Open Access Journals (Sweden)
M.E.V. Lourenço
2007-01-01
Full Text Available Fazem-se algumas considerações sobre a importância dos biocombustíveis (biodiesel e bioetanol, num futuro próximo, e acerca das potencialidades do sorgo sacarino para a produção de bioetanol. Apresentam-se resultados de um ensaio de quatro dotações de rega (1500, 2500, 3500 e 4500 m³/ha aplicadas a uma variedade de sorgo sacarino. Avaliou-se a concentração em sólidos solúveis (ºBrix nos caules verdes e a altura das plantas ao longo do ciclo. Determinou-se a produção de matéria verde em caules e de matéria seca em caules, folhas e inflorescências. Estimou-se também a produção de açúcar e bioetanol por hectare. Os dados revelaram que a dotação de rega mais aconselhável foi a de 4500 m³/ha pois conduziu aos melhores resultados em todos os parâmetros, excepto no que se refere ao Brix que foi semelhante à da dotação de 3500 m ³/ha (17 e 16%, respectivamente. Com aquela dotação de rega, se os resultados se confirmarem, será de esperar que, no Alentejo, as produções de bioetanol, da referida cultura, sejam superiores a 5000 l/ha.The importance of biofuels (biodiesel and bioethanol in the next future, and the potential of sweet sorghum for bioethanol production are discussed. Results of a trial with four irrigation treatments (1500, 2500, 3500 e 4500 m³/ha applied, to one variety of sweet sorghum, are presented. The soluble solids content (ºBrix of the fresh stalks and plant height were monitored along the life cycle of the crop. The yield of fresh stalks and the dry matter yield of stalks, leaves and inflorescences were determined. Sugar and bioethanol yields were also estimated. The results showed that the 4500 m³/ha irrigation treatment conducted to the best results in all variables, except for the Brix values that were similar to the 3500 m³/ha treatment (17 and 16%, respectively. With that irrigation treatment, and if the results are confirmed in the future, it will be expected that bioethanol yields from
Yamaba, Kazuo
1999-03-01
In case of robot vision, most important problem is the processing speed of acquiring and analyzing images are less than the speed of execution of the robot. In an actual robot color vision system, it is considered that the system should be processed at real time. We guessed this problem might be solved using by the bicolor analysis technique. We have been testing a system which we hope will give us insight to the properties of bicolor vision. The experiment is used the red channel of a color CCD camera and an image from a monochromatic camera to duplicate McCann's theory. To mix the two signals together, the mono image is copied into each of the red, green and blue memory banks of the image processing board and then added the red image to the red bank. On the contrary, pure color images, red, green and blue components are obtained from the original bicolor images in the novel color system after the scaling factor is added to each RGB image. Our search for a bicolor robot vision system was entirely successful.
International Nuclear Information System (INIS)
Sumi, A.; Katayama, T.C.
2000-01-01
The effects of nitrogen fertilizer application and solar radiation on the growth response to soil moisture were examined in sorghum seedlings grown in culture boxes. The effects of soil moisture (f) and amount of nitrogen fertilizer application (g) on the increment of total dry matter weight of sorghum seedling (ΔW) were represented satisfactorily by the following reciprocal equation, 1/ΔW = A/(f - f 0 ) + B(g + g 0 )/(f - f 0 ) + C/[(f - f 0 ) (g + g 0 )] + D/(g + g 0 ) + E, where f 0 and g 0 were the uppermost value of unavailable soil moisture and the amount of nitrogen supplied from soil and seeds. A, B, C, D and E were coefficients. The effects of soil moisture (f) and solar radiation (S) on ΔW were expressed approximately by the following reciprocal equation, 1/ΔW = A/(S - S 0 ) + B/(f - f 0 ) + C(f - f 0 ) + D, where S 0 was the daily compensation point. These results indicated that the effects of solar radiation and soil moisture are additive, but the interaction between soil moisture and nitrogen fertilizer is not negligible. The transpiration efficiency was unaffected by soil moisture, nitrogen fertilizer and solar radiation
Lifescience Database Archive (English)
Full Text Available 28 0.36 3 BZ330174 |BZ330174.1 hv90e08.b1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor gen...S-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone hv90e08 5', DNA sequence. 36 0.63 ...2 BZ335743 |BZ335743.1 hz26f02.g1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clon...e hz26f02 5', DNA sequence. 36 0.68 2 BZ628823 |BZ628823.1 ih62d12.g1 WGS-SbicolorF (DH5a methyl filtered) S...06.1 ic39h07.b1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ic39h07 5', DNA
Directory of Open Access Journals (Sweden)
sh Khalesro
2012-02-01
Full Text Available Abstract In order to compare three summer forage grasses including sorghum (Sorghum bicolor cv. Speedfeed, corn (Zea mayz S.C. 704 and pearl millet (Pennisetum americanum cv. Nutrifeed for green chop forage production in double cropping system, a field experiment was conducted at research field of Tarbiat Modares University on 2006 growing season. Treatments were arranged in a split- plot design based on randomized complete blocks with four replications. In this research three forage crops as main factor and nitrogen rates (100, 200 and 300 kg N. ha-1 from the urea source as the sub- plot were studied. Results showed the positive response of crops to nitrogen increment, in such a manner that millet with 300 kg N ha-1 produced 85.8 t ha-1 fresh forage (%20.3 more than sorghum and %30.9 more than corn. Regarding to the sustainable agriculture objects, millet and sorghum with 200 kg N ha-1could be suggested. Forage yield advantages of millet and sorghum to corn was %10 and %12 respectively. They produce 72.4 and 73.5 t ha-1 fresh forage under this treatment. Finally regarding to general advantages of sorghum and millet to corn, especially in unsuitable condition like as drought and poor soil fertility, it seems that changing the corn with sorghum or pearl millet could be an appropriate option. Also decision making for recommending one of sorghum and millet need to more information like qualitative attributes in details and determining animal feeding indices (voluntary intake using in vivo methods. Keywords: Sorghum, Pearl millet, Corn, Nitrogen, Forage, Organic matter, Crud protein
Hormonal Regulation of Dormancy in Developing Sorghum Seeds.
Steinbach, H. S.; Benech-Arnold, R. L.; Sanchez, R. A.
1997-01-01
The role of abscisic acid (ABA) and gibberellic acid (GA) in determining the dormancy level of developing sorghum (Sorghum bicolor [L.] Moench.) seeds from varieties presenting contrasting preharvest sprouting behavior (Redland B2, susceptible; IS 9530, resistant) was investigated. Panicles from both varieties were sprayed soon after pollination with fluridone or paclobutrazol to inhibit ABA and GA synthesis, respectively. Fluridone application to the panicles increased germinability of Redland B2 immature caryopses, whereas early treatment with paclobutrazol completely inhibited germination of this variety during most of the developmental period. Incubating caryopses in the presence of 100 [mu]M GA4+7 overcame the inhibitory effect of paclobutrazol, but also stimulated germination of seeds from other treatments. IS 9530 caryopses presented germination indices close to zero until physiological maturity (44 d after pollination) in control and paclobutrazol-treated particles. However, fluridone-treated caryopses were released from dormancy earlier than control and paclobutrazol-treated caryopses. Incubation in the presence of GA4+7 stimulated germination of caryopses from all treatments. Our results support the proposition that a low dormancy level (which is related to a high preharvest sprouting susceptibility) is determined not only by a low embryonic sensitivity to ABA, but also by a high GA content or sensitivity.
Directory of Open Access Journals (Sweden)
Mikael Neumann
2002-01-01
Full Text Available O experimento foi conduzido com o objetivo de avaliar as características qualitativas dos componentes da planta e da silagem e as características de fermentação da silagem de diferentes híbridos de sorgo forrageiros AGX-213 e AG-2002 e de duplo propósito AGX-217 e AG-2005E. O componente panícula apresentou maiores teores de matéria seca (MS, proteína bruta (PB, matéria mineral (MM e digestibilidade in vitro da matéria seca (DIVMS e menores teores dos constituintes da parede celular da planta com relação aos componentes colmo e folhas. Não houve diferenças entre as silagens dos híbridos de sorgo para os teores de MM e DIVMS. A silagem do AG-2005E apresentou maior teor de MS (35,50%, PB (6,69%, extrato etéreo (2,28% e extrativos não-nitrogenados (58,56% frente aos demais genótipos. Não houve diferença entre as silagens para os teores de nitrogênio insolúvel na FDA. As silagens de híbridos de sorgo forrageiro (AGX-213 e AG-2002 apresentaram menor pH e teor de N-NH3 (% do N total em comparação aos híbridos de duplo propósito (AGX-217 e AG-2005E.The experiment was conducted with the purpose to evaluate the qualitative traits of the plant components and fermentation characteristics of silages from different sorghum hybrids AGX-213, AG-2002 (forage and AGX-217, AG-2005E (double purpose. The panicle component showed higher percentages of dry matter (DM, crude protein (CP, mineral material (MM and in vitro dry matter digestibility (IVDMD, and lower percentages of plant cell wall than the stems and leaves. No differences were observed among the sorghum silages for MM and IVDMD percentages. The AG-2005E silage showed higher contents of DM (35.5%, CP (6.69%, ether extract (2.28% and nitrogen-free extract (58.56% in comparison with the other genotypes. No difference was observed among the sorghum silages for acid detergent insoluble nitrogen (ADIN content. The silages of the forage hybrids (AGX-213 and AG-2002 showed lower pH and
Characterization of novel Sorghum brown midrib mutants from an EMS-mutagenized population.
Sattler, Scott E; Saballos, Ana; Xin, Zhanguo; Funnell-Harris, Deanna L; Vermerris, Wilfred; Pedersen, Jeffrey F
2014-09-02
Reducing lignin concentration in lignocellulosic biomass can increase forage digestibility for ruminant livestock and saccharification yields of biomass for bioenergy. In sorghum (Sorghum bicolor (L.) Moench) and several other C4 grasses, brown midrib (bmr) mutants have been shown to reduce lignin concentration. Putative bmr mutants isolated from an EMS-mutagenized population were characterized and classified based on their leaf midrib phenotype and allelism tests with the previously described sorghum bmr mutants bmr2, bmr6, and bmr12. These tests resulted in the identification of additional alleles of bmr2, bmr6, and bmr12, and, in addition, six bmr mutants were identified that were not allelic to these previously described loci. Further allelism testing among these six bmr mutants showed that they represented four novel bmr loci. Based on this study, the number of bmr loci uncovered in sorghum has doubled. The impact of these lines on agronomic traits and lignocellulosic composition was assessed in a 2-yr field study. Overall, most of the identified bmr lines showed reduced lignin concentration of their biomass relative to wild-type (WT). Effects of the six new bmr mutants on enzymatic saccharification of lignocellulosic materials were determined, but the amount of glucose released from the stover was similar to WT in all cases. Like bmr2, bmr6, and bmr12, these mutants may affect monolignol biosynthesis and may be useful for bioenergy and forage improvement when stacked together or in combination with the three previously described bmr alleles. Copyright © 2014 Sattler et al.
International Nuclear Information System (INIS)
Singh, M.P.; Erickson, J.E.; Sollenberger, L.E.; Woodard, K.R.; Vendramini, J.M.B.; Fedenko, J.R.
2012-01-01
Biomass yield and tissue mineral composition can affect total energy yield potential, conversion efficiencies and environmental impacts, but relatively few data are available for sweet sorghum [Sorghum bicolor (L.) Moench] grown in the southeastern USA. Therefore, a study was conducted at two locations in North and Central Florida on marginal sand soils comparing the effects of planting date (PD) on dry biomass yield and mineral composition of leaf, stem, and grain heads for ‘M-81E’ and ‘Dale’ sweet sorghum cultivars. Overall tissue mineral concentrations were relatively low for sweet sorghum, attributable to low K and Ca concentrations. Ash and mineral concentrations were generally greater for Dale, especially for the early PD. Leaf and grain heads were greater in mineral concentrations compared to stems. Dry biomass yield averaged 19.4 Mg ha −1 and was greater for M-81E and the early PD. Stems accounted for 73% of the total biomass compared to leaves (13%) across all treatments. Total N, P, and K removals averaged 136, 27.6, and 81.4 kg ha −1 , respectively. Overall, leaves removed 30, 23, and 19% of total N, P, and K compared to 34, 34, and 61% by stem, respectively. Considering lower biomass but greater mineral concentrations in leaf and grain heads compared to stems, returning leaf residues and possibly grain heads to the soil have the potential to offset nutrient and energy inputs needed on these marginal soils and enhance the sustainability of sweet sorghum cropping systems.
Preparation of Hulu-mur flavored carbonated beverage based on Feterita sorghum (Sorghum bicolor malt
Directory of Open Access Journals (Sweden)
Sara F. A. Baidab
2016-10-01
Full Text Available In this study, sorghum Feterita malt extract was used to prepare carbonated beverages flavored with traditional Hulu-mur spices extract. The beverages produced were assessed for their physicochemical, sensory, and nutritional qualities. Malting (3–5 days of the Feterita grains showed significant (P ≤ 0.05 differences in proximate composition from that of unmalted grains. Protein and sugars increased significantly (P ≤ 0.05 with increased the malting time (days, while there was a significant (P ≤ 0.05 reduction in oil and starch content during malting progress. The kilning temperature of 150°C for 20 minutes was found to produce the most acceptable Hulu-mur carbonated beverage analogue in terms of flavor and taste. Significant differences (P ≤ 0.05 were observed in physicochemical and nutritional qualities between the Hulu-mur analogue carbonated beverage and commercial non-alcoholic beverage. The Hulu-mur carbonated beverage analogue was rich in Na, K, Ca, and Fe (26.45, 21.84, 24.00, and 0.57 mg /100 g, respectively compared to levels of the same minerals in the non-alcoholic beverage (22.31, 8.19, 22.00 and 0.15 mg/100 g, respectively. The Hulu-mur analogue also had a higher calorific value (35.85 kcal /100 mL compared to the non-alcoholic beverage (32.96 kcal/100 mL.
Mahmood-Ul-Hassan, Muhammad; Suthar, Vishandas; Ahmad, Rizwan; Yousra, Munazza
2017-10-30
The abilities of sorghum (Sorghum bicolor L.) and oat (Avena sativa L.) to take up heavy metals from soils amended with ethylenediaminetetraacetic acid (EDTA) were assessed under greenhouse conditions. Both plants were grown in two soils contaminated with heavy metals (Gujranwala-silty loam and Pacca-clay loam). The soils were treated with 0, 0.625, 1.25, and 2.5 mM EDTA kg -1 soil applied at both 45 and 60 days after sowing (DAS); the experiment was terminated at 75 DAS. Addition of EDTA significantly increased concentrations of Cd, Cr, and Pb in roots and shoots, and bio-concentration factors and phytoextraction rates were also increased. Post-harvest soil analysis showed that soluble fractions of metals were also increased significantly. The increase in Cd was ≈ 3-fold and Pb was ≈ 15-fold at the highest addition of EDTA in Gujranwala soil; in the Pacca soil, the increase was less. Similarly, other phytoremediation factors, such as metal translocation, bio-concentration factor, and phytoextraction, efficiency were also maximum when soils were treated with 2.5 mM EDTA kg -1 soil. The study demonstrated that sorghum was better than oat for phytoremediation.
Afify, Abd El-Moneim M. R.; El-Beltagi, Hossam S.; Abd El-Salam, Samiha M.; Omran, Azza A.
2011-01-01
The changes in phytate, phytase activity and in vitro bioavailability of iron and zinc during soaking and germination of three white sorghum varieties (Sorghum bicolor L. Moench), named Dorado, Shandweel-6, and Giza-15 were investigated. Sorghum varieties were soaked for 20 h and germinated for 72 h after soaking for 20 h to reduce phytate content and increase iron and zinc in vitro bioavailability. The results revealed that iron and zinc content was significantly reduced from 28.16 to 32.16% and 13.78 to 26.69% for soaking treatment and 38.43 to 39.18% and 21.80 to 31.27% for germination treatments, respectively. Phytate content was significantly reduced from 23.59 to 32.40% for soaking treatment and 24.92 to 35.27% for germination treatments, respectively. Phytase enzymes will be activated during drying in equal form in all varieties. The results proved that the main distinct point is the change of phytase activity as well as specific activity during different treatment which showed no significant differences between the varieties used. The in vitro bioavailability of iron and zinc were significantly improved as a result of soaking and germination treatments. PMID:22003395
Assimilation, partitioning, and nonstructural carbohydrates in sweet compared with grain sorghum
International Nuclear Information System (INIS)
Vietor, D.M.; Miller, F.R.
1990-01-01
Nonstructural carbohydrate concentrations in stems are greater for sweet than grain sorghums [Sorghum bicolor (L.) Moench]. Knowledge of plant characteristics associated with high nonstructural carbohydrates in sweet sorghum will air efforts to increase nonstructural carbohydrates in grain sorghum stems. This study tested the hypothesis that variation of CO 2 assimilation rate, leaf area, branching at upper nodes, and partitioning of 14 C-labeled assimilate to main stems are associated with variation of stem nonstructural carbohydrates. A sweet (Atlas X Rio) and a grain (ATx623 X RTx5388) hybrid, stages near and after physiological maturity, and defoliation and gibberellic acid (GA 3 ) treatments provided sources of variation for study. Concentrations of nonstructural carbohydrates in lower and upper stems of the sweet hybrid were 1.4 and 2.7 times higher, respectively, than for the grain hybrid, after physiological maturity. Variation in branching, including 14 C-assimilate partitioning to branches, was not consistently associated with hybrid differences in stem nonstructural carbohydrates. Increased recovery (twofold) of 14 C-assimilate in roots and labeled leaves corresponded with lower percentages of 14 C-assimilate and lower concentrations of nonstructural carbohydrates in stems of the grain hybrid. Leaf areas and leaf CO 2 exchange rate were twice as great for the sweet hybrid. Although defoliation of the sweet hybrid minimized leaf area differences between hybrids, the sweet hybrid accumulated twice as much nonstructural carbohydrates in branches after physiological maturity. Greater potentials for CO 2 assimilation and for 14 C-assimilate accumulation in mature stem tissue were associated with higher levels of stem nonstructural carbohydrates in the sweet compared with the grain hybrid
Coelho, M.R.R.; Vos, de M.; Carneiro, N.P.; Marriel, I.E.; Paiva, E.; Seldin, L.
2008-01-01
The diversity of nitrogen-fixing bacteria was assessed in the rhizospheres of two cultivars of sorghum (IS 5322-C and IPA 1011) sown in Cerrado soil amended with two levels of nitrogen fertilizer (12 and 120 kg ha(-1)). The nifH gene was amplified directly from DNA extracted from the rhizospheres,
Compartmentation of sucrose during radial transfer in mature sorghum culm
Directory of Open Access Journals (Sweden)
Vietor Donald M
2007-06-01
Full Text Available Abstract Background The sucrose that accumulates in the culm of sorghum (Sorghum bicolor (L. Moench and other large tropical andropogonoid grasses can be of commercial value, and can buffer assimilate supply during development. Previous study conducted with intact plants showed that sucrose can be radially transferred to the intracellular compartment of mature ripening sorghum internode without being hydrolysed. In this study, culm-infused radiolabelled sucrose was traced between cellular compartments and among related metabolites to determine if the compartmental path of sucrose during radial transfer in culm tissue was symplasmic or included an apoplasmic step. This transfer path was evaluated for elongating and ripening culm tissue of intact plants of two semidwarf grain sorghums. The metabolic path in elongating internode tissue was also evaluated. Results On the day after culm infusion of the tracer sucrose, the specific radioactivity of sucrose recovered from the intracellular compartment of growing axillary-branch tissue was greater (nearly twice than that in the free space, indicating that sucrose was preferentially transferred through symplasmic routes. In contrast, the sucrose specific radioactivity in the intracellular compartment of the mature (ripening culm tissue was probably less (about 3/4's than that in free space indicating that sucrose was preferentially transferred through routes that included an apoplasmic step. In growing internodes of the axillary branch of sorghum, the tritium label initially provided in the fructose moiety of sucrose molecules was largely (81% recovered in the fructose moiety, indicating that a large portion of sucrose molecules is not hydrolysed and resynthesized during radial transfer. Conclusion During radial transfer of sucrose in ripening internodes of intact sorghum plants, much of the sucrose is transferred intact (without hydrolysis and resynthesis and primarily through a path that includes an
International Nuclear Information System (INIS)
Lee, K.J.; Gaskins, M.H.
1982-01-01
Organic components leaked from Sorghum bicolor seedlings ('root exudates') were examined by recovering 14 C labelled compounds from root solutions of seedlings inoculated with Azospirillum brasilense, Azotobacter vinelandii or Klebsiella pneumoniae nif-. Up to 3.5% of the total 14 C recovered from shoots, roots, and nutrient solutions was found in the root solutions. Inoculation with Azospirillum and Azotobacter increased the amounts of 14 C and decreased the amounts of carbohydrates in the root solutions. When sucrose was added as a carbon source for the bacteria, the increase of 14 C in the solutions did not occur. Quantities of 14 C found in the root solutions were proportional to amounts of mineral nitrogen supplied to the plants. Bacterial growth also was proportional to nitrogen levels. When sorghum plants were grown in soil and labelled with 14 CO 2 , about 15% of the total 14 C recovered within 48 hours exposure was found in soil leachates. (orig.)
Directory of Open Access Journals (Sweden)
Farhad Parnian
2013-01-01
Full Text Available Effects of microwave irradiation (900 W for 3, 5 and 7 min on the nutritive value of sorghum and wheat grains were evaluated by in vitro gas production technique. Gas volume was recorded at 2, 4, 6, 8, 12, 16, 24, 36, 48, 72 and 96 h of incubation and kinetics of gas production were estimated using model: GP = A exp {– exp [1 + (be/A (LAG – t]}. Cumulative gas production at 24 h was used for estimation of metabolizable energy, net energy for lactation, short chain fatty acids, digestible organic matter and microbial protein. For sorghum grain, microwave irradiation increased cumulative gas production for most times of incubation linearly. Microwave treatments for 5 and 7 min increased the A fraction linearly in both cereal grain, whereas the maximum rate of gas production (b decreased linearly only in wheat grain. Microwave treatments for 3, 5 and 7 min increased (P<0.05 metabolizable energy, net energy for lactation and short chain fatty acids content of sorghum grain, but not of wheat grain. It was concluded that microwave irradiation changed the gas production parameters resulting changed ruminal fermentation characteristics that can be considered in ration formulation.
Directory of Open Access Journals (Sweden)
Rafael Montanari
2013-12-01
Full Text Available The cultivation of sorghum (Sorghum bicolor L. Moench is increasing in the Midwest region of Brazil with the aim of expanding the production of silage to be used in animal feed, with good adaptability to climatic conditions of the arid and semi-arid brazilian. The productive capacity of sorghum is influenced by soil physical properties (RP, UG, UV e DS, with these values appropriate to the development of the root system positively affect the productivity. In order to study the spatial and linear correlations between the yield of sorghum for forage and soil physical properties, an experiment was conducted in the Miranda city, MS, in an Planosol. The data were obtained by analysis of samples of plant (MVF and soil (RP, UG, UV e DS collected at random, having been demarcated using a GPS receiver 51 points in the cultivation area with irregular spacing. The attributes studied (plant and soil, and have spatial correlation, the variability between medium and high and well-defined spatial patterns, with a range between 130.0 and 352.0 m. The RP and UG were good indicators of soil physical quality, as for the productivity of green biomass forage sorghum. =
Directory of Open Access Journals (Sweden)
Jaime Ru\\u00EDz Vega
2005-01-01
Full Text Available Con el propósito de identificar cultivares de sorgo y mijo forrajeros con alta eficienciade producción de materia seca y calidad para condiciones deriego restringido, situación cada vez mas frecuente debido alabatimiento de los niveles freáticos en el período primavera-verano, se sembraron el 23 de marzo de 1998 en Santa CruzXoxocotlán, Oaxaca, México, seis variedades comerciales desorgo forrajero (Sorghum bicolor y una de mijo perla (Pennisetum americanum, además de seis líneas de mijo perla provenientes del International Crop Research Institute for the Semiarid Tropics (ICRISAT, Hyderabad, India. Apartir de losdatos de producción de materia seca, se generaron dos índices,uno llamado de productividad modificado (IPM y otro de productividad (IP, para facilitar la selección de materiales. ElIPM superó al IPen su capacidad para discriminar los materiales por mayor eficiencia de producción de forraje de calidad.En promedio, los genotipos de sorgo fueron más eficientes para producir materia seca, especialmente Sweet Sioux y Domor,este último caracterizado por mostrar poca variación entre cortes. Sin embargo, los mijos NELC C4 y ICMH 423, podríanser utilizados por campesinos que dispongan de menos agua ytengan urgencia de forraje, dada su alta eficiencia de producción de materia seca de buena calidad en el primer corte.
Directory of Open Access Journals (Sweden)
Ulises A Gonzalez Garcia
2017-08-01
Full Text Available The knowledge of the digestibility of the food is basic to establish its nutritive value and bioavailability of the nutrients. Numerous laboratory tests have been used to estimate the ruminal and intestinal digestion of the food such as in vitro (Gas and Daisy production and in sacco, to be compared with the in vivo method. Sorghum presented the highest (P 0.05 were found between grains. With regard to the digestibility methods, the DMD was lower (P 0.01 for the in sacco and in vitro methods (Daisy. The production of VFA's was similar for both cereals. In situ and in vitro techniques (DaisyII® allow the determination of digestibility quick and easy compared to conventional methods. Sorghum grinding improves its nutritional value by increasing its digestibility, which represents an alternative to maize for feeding calves for fattening.
Determining water use of sorghum from two-source energy balance and radiometric temperatures
Directory of Open Access Journals (Sweden)
J. M. Sánchez
2011-10-01
Full Text Available Estimates of surface actual evapotranspiration (ET can assist in predicting crop water requirements. An alternative to the traditional crop-coefficient methods are the energy balance models. The objective of this research was to show how surface temperature observations can be used, together with a two-source energy balance model, to determine crop water use throughout the different phenological stages of a crop grown. Radiometric temperatures were collected in a sorghum (Sorghum bicolor field as part of an experimental campaign carried out in Barrax, Spain, during the 2010 summer growing season. Performance of the Simplified Two-Source Energy Balance (STSEB model was evaluated by comparison of estimated ET with values measured on a weighing lysimeter. Errors of ±0.14 mm h−1 and ±1.0 mm d−1 were obtained at hourly and daily scales, respectively. Total accumulated crop water use during the campaign was underestimated by 5%. It is then shown that thermal radiometry can provide precise crop water necessities and is a promising tool for irrigation management.
Energy Technology Data Exchange (ETDEWEB)
Lee, K.J. (Institute of Forest Genetics, Suweon (Republic of Korea)); Gaskins, M.H. (Florida Univ., Gainesville (USA). Dept. of Agriculture)
1982-01-01
Organic components leaked from Sorghum bicolor seedlings ('root exudates') were examined by recovering /sup 14/C labelled compounds from root solutions of seedlings inoculated with Azospirillum brasilense, Azotobacter vinelandii or Klebsiella pneumoniae nif-. Up to 3.5% of the total /sup 14/C recovered from shoots, roots, and nutrient solutions was found in the root solutions. Inoculation with Azospirillum and Azotobacter increased the amounts of /sup 14/C and decreased the amounts of carbohydrates in the root solutions. When sucrose was added as a carbon source for the bacteria, the increase of /sup 14/C in the solutions did not occur. Quantities of /sup 14/C found in the root solutions were proportional to amounts of mineral nitrogen supplied to the plants. Bacterial growth also was proportional to nitrogen levels. When sorghum plants were grown in soil and labelled with /sup 14/CO/sub 2/, about 15% of the total /sup 14/C recovered within 48 hours exposure was found in soil leachates.
Single-nucleotide polymorphism discovery by high-throughput sequencing in sorghum
Directory of Open Access Journals (Sweden)
White Frank F
2011-07-01
Full Text Available Abstract Background Eight diverse sorghum (Sorghum bicolor L. Moench accessions were subjected to short-read genome sequencing to characterize the distribution of single-nucleotide polymorphisms (SNPs. Two strategies were used for DNA library preparation. Missing SNP genotype data were imputed by local haplotype comparison. The effect of library type and genomic diversity on SNP discovery and imputation are evaluated. Results Alignment of eight genome equivalents (6 Gb to the public reference genome revealed 283,000 SNPs at ≥82% confirmation probability. Sequencing from libraries constructed to limit sequencing to start at defined restriction sites led to genotyping 10-fold more SNPs in all 8 accessions, and correctly imputing 11% more missing data, than from semirandom libraries. The SNP yield advantage of the reduced-representation method was less than expected, since up to one fifth of reads started at noncanonical restriction sites and up to one third of restriction sites predicted in silico to yield unique alignments were not sampled at near-saturation. For imputation accuracy, the availability of a genomically similar accession in the germplasm panel was more important than panel size or sequencing coverage. Conclusions A sequence quantity of 3 million 50-base reads per accession using a BsrFI library would conservatively provide satisfactory genotyping of 96,000 sorghum SNPs. For most reliable SNP-genotype imputation in shallowly sequenced genomes, germplasm panels should consist of pairs or groups of genomically similar entries. These results may help in designing strategies for economical genotyping-by-sequencing of large numbers of plant accessions.
Mutants with increased resistance to herbicide in Guinea corn Sorghum bicolor (L.) Moench
International Nuclear Information System (INIS)
Odeigah, P.G.C.; Adewoyin, A.F.; Obatayo, O.O.
1990-01-01
Sorghum is an important staple food in many tropical countries. In Nigeria, it is extensively cultivated for food and, in recent times, as raw material for the brewing, baking and starch-making industries. We have investigated the possibilities of breeding crop cultivars of Sorghum with improved seed protein, amylase activities and resistance to herbicide by means of induced mutation. Seeds were treated by soaking them in an aqueous solution of ethyl methane sulphonate (EMS) 8 or 64 mM at room temperature 3, 6, 9, 12, 15 or 24 hours. After the treatment, the seeds were briefly rinsed in water and transferred to petri dishes containing moist filter paper for germination. The seedlings were later transplanted to loamy sand soil in plastic trays. M, seedlings were grown to maturity in the greenhouse. The M 1 contained plants with variegated leaves and other morphological abnormalities. Only the progenies of normal plants were grown for further generations. Resistance to Igran 500 E.G. (2-tert-butylamino-4-ethylamino-6-methylthio-striazine; from Ciba Geigy) was tested in M 2 seedlings by mixing 1 part per 100 (by volume) of the herbicide with the soil a day before sowing the seeds. Preliminary screening of 2,500 M 2 plants revealed a number of morphological and leaf colour mutations. 50 seedlings were more resistant to the herbicide but no seedling resistance was observed in the parent cultivar. There was a 23.43% reduction in seedling weight of the M 2 lines grown in soil treated with Igran 500, whereas the reduction in seedling weight of the original cultivar was 42.46%. The resistant M 2 seedlings had longer and better roots
On the extent of genetic variation for transpiration efficiency in sorghum
International Nuclear Information System (INIS)
Hammer, G.L.; Broad, I.J.; Farquhar, G.D.
1997-01-01
A glasshouse study examined 49 diverse sorghum lines for variation in transpiration efficiency. Three of the 49 lines grown were Sorghum spp. native to Australia; one was the major weed Johnson grass (Sorghum halepense), and the remaining 45 lines were cultivars of Sorghum bicolor. All plants were grown under non-limiting water and nutrient conditions using a semi-automatic pot watering system designed to facilitate accurate measurement of water use. Plants were harvested 56-58 days after sowing and dry weights of plant parts were determined. Transpiration efficiency differed significantly among cultivars. The 3 Australian native sorghums had much lower transpiration efficiency than the other 46 cultivars, which ranged from 7.7 to 6.0 g/kg. For the 46 diverse cultivars, the ratio of range in transpiration efficiency to its l.s.d. was 2.0, which was similar to that found among more adapted cultivars in a previous study. This is a significant finding as it suggests that there is likely to be little pay-off from pursuing screening of unadapted material for increased variation in transpiration efficiency. It is necessary, however, also to examine absolute levels of transpiration efficiency to determine whether increased levels have been found. The cultivar with greatest transpiration efficiency in this study (IS9710) had a value 9% greater (P < 0.05) than the accepted standard for adapted sorghum cultivars. The potential impact of such an increase in transpiration efficiency warrants continued effort to capture it. Transpiration efficiency has been related theoretically and experimentally to the degree of carbon isotope discrimination in leaf tissue in sorghum, which thus offers a relatively simple selection index. In this study, the variation in transpiration efficiency was not related simply to carbon isotope discrimination. Significant associations of transpiration efficiency with ash content and indices of photosynthetic capacity were found. However, the
Directory of Open Access Journals (Sweden)
Patrick O. Ongom
2018-01-01
Full Text Available Multi-parent advanced generation intercross (MAGIC populations are powerful next-generation mapping resources. We describe here the mating design and structure of the first MAGIC population in sorghum, and test its utility for mapping. The population was developed by intercrossing 19 diverse founder lines through a series of paired crosses with a genetic male sterile (MS source, followed by 10 generations of random mating. At the final stage of random mating, 1000 random fertile plants in the population were identified and subjected to six generations of selfing to produce 1000 immortal MAGIC inbred lines. The development of this sorghum MAGIC population took over 15 yr. Genotyping-by-sequencing (GBS of a subset of 200 MAGIC lines identified 79,728 SNPs, spanning high gene-rich regions. Proportion of SNPs per chromosome ranged from 6 to 15%. Structure analyses produced no evidence of population stratification, portraying the desirability of this population for genome-wide association studies (GWAS. The 19 founders formed three clusters, each with considerable genetic diversity. Further analysis showed that 73% of founder alleles segregated in the MAGIC population. Linkage disequilibrium (LD patterns depicted the MAGIC population to be highly recombined, with LD decaying to r2 ≤ 0.2 at 40 kb and down to r2 ≤ 0.1 at 220 kb. GWAS detected two known plant height genes, DWARF1 (chromosome 9 and DWARF3 (chromosome 7, and a potentially new plant height quantitative trait locus (QTL (QTL-6 on chromosome 6. The MAGIC population was found to be rich in allelic content with high fragmentation of its genome, making it fit for both gene mapping and effective marker-assisted breeding.
Anjaneyulu, Ediga; Reddy, Palle Surender; Sunita, Merla Srilakshmi; Kishor, Polavarapu B Kavi; Meriga, Balaji
2014-06-15
A vacuolar proton pyrophosphatase cDNA clone was isolated from Sorghum bicolor (SbVPPase) using end-to-end gene-specific primer amplification. It showed 80-90% homology at the nucleotide and 85-95% homology at the amino acid level with other VPPases. The gene was introduced into expression vector pCAMBIA1301 under the control of the cauliflower mosaic virus 35S (CaMV35S) promoter and transformed into Agrobacterium tumifaciens strain LBA4404 to infect embryogenic calli of finger millet (Eleusine coracana). Successful transfer of SbVPPase was confirmed by a GUS histochemical assay and PCR analysis. Both, controls and transgenic plants were subjected to 100 and 200mM NaCl and certain biochemical and physiological parameters were studied. Relative water content (RWC), plant height, leaf expansion, finger length and width and grain weight were severely reduced (50-70%), and the flowering period was delayed by 20% in control plants compared to transgenic plants under salinity stress. With increasing salt stress, the proline and chlorophyll contents as well as the enzyme activities of superoxide dismutase (SOD), catalase (CAT), ascorbate peroxidase (APX), guaiacol peroxidase (GPX) and glutathione reductase (GR) increased by 25-100% in transgenics, while malondialdehyde (MDA) showed a 2-4-fold decrease. The increased activities of antioxidant enzymes and the reduction in the MDA content suggest efficient scavenging of reactive oxygen species (ROS) in transgenics and, as a consequence, probably alleviation of salt stress. Also, the leaf tissues of the transgenics accumulated 1.5-2.5-fold higher Na(+) and 0.4-0.8-fold higher K(+) levels. Together, these results clearly demonstrate that overexpression of SbVPPase in transgenic finger millet enhances the plant's performance under salt stress. Copyright © 2014 Elsevier GmbH. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Luo, Shenglian; Xu, Taoying; Chen, Liang [Hunan Univ., Changsha (China). College of Environmental Science and Engineering] [and others
2012-02-15
The effects of Bacillus sp. SLS18, a plant-growth-promoting endophyte, on the biomass production and Mn/Cd uptake of sweet sorghum (Sorghum bicolor L.), Phytolacca acinosa Roxb., and Solanum nigrum L. were investigated. SLS18 displayed multiple heavy metals and antibiotics resistances. The strain also exhibited the capacity of producing indole-3-acetic acid, siderophores, and 1-aminocyclopropane-1-carboxylic acid deaminase. In pot experiments, SLS18 could not only infect plants effectively but also significantly increase the biomass of the three tested plants in the presence of Mn/Cd. The promoting effect order of SLS18 on the biomass of the tested plants was sweet sorghum > P. acinosa > S. nigrum L. In the presence of Mn (2,000 mg kg{sup -1}) and Cd (50 mg kg{sup -1}) in vermiculite, the total Mn/Cd uptakes in the aerial parts of sweet sorghum, P. acinosa, and S. nigrum L. were increased by 65.2%/40.0%, 55.2%/31.1%, and 18.6%/25.6%, respectively, compared to the uninoculated controls. This demonstrates that the symbiont of SLS18 and sweet sorghum has the potential of improving sweet sorghum biomass production and its total metal uptake on heavy metal-polluted marginal land. It offers the potential that heavy metal-polluted marginal land could be utilized in planting sweet sorghum as biofuel feedstock for ethanol production, which not only gives a promising phytoremediation strategy but also eases the competition for limited fertile farmland between energy crops and food crops. (orig.)
Exploitation of allelopathy for weed control in annual and perennial cropping systems.
Putnam, A R; Defrank, J; Barnes, J P
1983-08-01
A variety of crops, cultivars, and accessions have been evaluated over the past six years for superior capability to suppress weed growth. The most successful of these approaches has been to grow cover crops of rye (Secale cereale), wheat (Triticum aestivum), sorghum (Sorghum bicolor), or barley (Hordeum vulgare) to a height of 40-50 cm, desiccate the crops by contact herbicides or freezing, and allow their residues to remain on the soil surface. Often, up to 95% control of important agroecosystem weed species was obtained for a 30- to 60-day period following desiccation of the cover crop. The plant residues on the soil surface exhibit numerous physical and chemical attributes that contribute to weed suppression. Physical aspects include shading and reduced soil temperatures which were similarly achieved using poplar (Populus) excelsior as a control mulch. Chemical aspects apparently include direct release of toxins, as well as production of phytotoxic microbial products. Numerous chemicals appear to work in concert or in an additive or synergistic manner to reduce weed germination and growth.
Pre-harvest Sprouting and Grain Dormancy in Sorghum bicolor: What Have We Learned?
Directory of Open Access Journals (Sweden)
Roberto L. Benech-Arnold
2018-06-01
Full Text Available The possibility of obtaining sorghum grains with quality to match the standards for a diversity of end-uses is frequently hampered by the susceptibility to pre-harvest sprouting (PHS displayed by many elite genotypes. For these reasons, obtaining resistance to PHS is considered in sorghum breeding programs, particularly when the crop is expected to approach harvest maturity under rainy or damp conditions prevalence. As in other cereals, the primary cause for sprouting susceptibility is a low dormancy prior to crop harvest; in consequence, most research has focused in understanding the mechanisms through which the duration of dormancy is differentially controlled in genotypes with contrasting sprouting behavior. With this aim two tannin-less, red-grained inbred lines were used as a model system: IS9530 (sprouting resistant and Redland B2 (sprouting susceptible. Redland B2 grains are able to germinate well before reaching physiological maturity (PM while IS9530 ones can start to germinate at 40–45 days after pollination, well after PM. Results show that the anticipated dormancy loss displayed by Redland B2 grains is related reduced embryo sensitivity to abscisic acid (ABA and increased levels of GA upon imbibition. In turn, transcriptional data showed that ABA signal transduction is impaired in Redland B2, which appears to have an impact on GA catabolism, thus affecting the overall GA/ABA balance that regulates germination. QTL analyses were conducted to test whether previous candidate genes were located in a dormancy QTL, but also to identify new genes involved in dormancy. These analyses yielded several dormancy QTL and one of them located in chromosome 9 (qGI-9 was consistently detected even across environments. Fine mapping is already in progress to narrow down the number of candidate genes in qGI-9.
Coelho, Marcia Reed Rodrigues; de Vos, Marjon; Carneiro, Newton Portilho; Marriel, Ivanildo Evódio; Paiva, Edilson; Seldin, Lucy
2008-02-01
The diversity of nitrogen-fixing bacteria was assessed in the rhizospheres of two cultivars of sorghum (IS 5322-C and IPA 1011) sown in Cerrado soil amended with two levels of nitrogen fertilizer (12 and 120 kg ha(-1)). The nifH gene was amplified directly from DNA extracted from the rhizospheres, and the PCR products cloned and sequenced. Four clone libraries were generated from the nifH fragments and 245 sequences were obtained. Most of the clones (57%) were closely related to nifH genes of uncultured bacteria. NifH clones affiliated with Azohydromonas spp., Ideonella sp., Rhizobium etli and Bradyrhizobium sp. were found in all libraries. Sequences affiliated with Delftia tsuruhatensis were found in the rhizosphere of both cultivars sown with high levels of nitrogen, while clones affiliated with Methylocystis sp. were detected only in plants sown under low levels of nitrogen. Moreover, clones affiliated with Paenibacillus durus could be found in libraries from the cultivar IS 5322-C sown either in high or low amounts of fertilizer. This study showed that the amount of nitrogen used for fertilization is the overriding determinative factor that influenced the nitrogen-fixing community structures in sorghum rhizospheres cultivated in Cerrado soil.
Mukisa, Ivan M.; Muyanja, Charles M. B. K.; Byaruhanga, Yusuf B.; Schüller, Reidar B.; Langsrud, Thor; Narvhus, Judith A.
2012-03-01
Malted and un-malted sorghum ( Sorghum bicolor (L.) Moench) flour was gamma irradiated with a dose of 10 kGy and then re-irradiated with 25 kGy. The effects of irradiation on microbial decontamination, amylase activity, fermentability (using an amylolytic L. plantarum MNC 21 strain), starch granule structure and viscosity were determined. Standard methods were used during determinations. The 10 kGy dose had no effect on microbial load of un-malted flour but reduced that of malted flour by 3 log cycles. Re-irradiation resulted in complete decontamination. Irradiation of malt caused a significant ( palpha and beta amylase activity (22% and 32%, respectively). Irradiation of un-malted flour increased the rates of utilization of glucose and maltose by 53% and 100%, respectively, during fermentation. However, microbial growth, rate of lactic acid production, final lactic acid concentration and pH were not affected. Starch granules appeared normal externally even after re-irradiation, however, granules ruptured and dissolved easily after hydration and gelatinization. Production of high dry matter density porridge (200 g dry matter/L) with a viscosity of 3500 cP was achieved by irradiation of un-malted flout at 10 kGy. Gamma irradiation can be used to decontaminate flours and could be utilized to produce weaning porridge from sorghum.
International Nuclear Information System (INIS)
Mukisa, Ivan M.; Muyanja, Charles M.B.K.; Byaruhanga, Yusuf B.; Schüller, Reidar B.; Langsrud, Thor; Narvhus, Judith A.
2012-01-01
Malted and un-malted sorghum (Sorghum bicolor (L.) Moench) flour was gamma irradiated with a dose of 10 kGy and then re-irradiated with 25 kGy. The effects of irradiation on microbial decontamination, amylase activity, fermentability (using an amylolytic L. plantarum MNC 21 strain), starch granule structure and viscosity were determined. Standard methods were used during determinations. The 10 kGy dose had no effect on microbial load of un-malted flour but reduced that of malted flour by 3 log cycles. Re-irradiation resulted in complete decontamination. Irradiation of malt caused a significant (p<0.05) reduction in alpha and beta amylase activity (22% and 32%, respectively). Irradiation of un-malted flour increased the rates of utilization of glucose and maltose by 53% and 100%, respectively, during fermentation. However, microbial growth, rate of lactic acid production, final lactic acid concentration and pH were not affected. Starch granules appeared normal externally even after re-irradiation, however, granules ruptured and dissolved easily after hydration and gelatinization. Production of high dry matter density porridge (200 g dry matter/L) with a viscosity of 3500 cP was achieved by irradiation of un-malted flout at 10 kGy. Gamma irradiation can be used to decontaminate flours and could be utilized to produce weaning porridge from sorghum. - Highlights: ► Malted and un-malted Sorghum flours irradiated (10 kGy) and re-irradiated (25 kGy). ► Complete decontamination only achieved after re-irradiation. ► Significant reduction (p<0.05) in malt amylase activity. ► Microbial growth, starch breakdown and acidification unaffected during fermentation. ► Viscosity of sorghum porridge lowered due to weakened starch granules.
Zhou, Tingting; Meng, Lingyang; Ma, Yue; Liu, Qing; Zhang, Yunyun; Yang, Zhenming; Yang, Deguang; Bian, Mingdi
2018-02-01
This work provides the bioinformatics, expression pattern and functional analyses of cryptochrome 1a from sweet sorghum (SbCRY1a), together with an exploration of the signaling mechanism mediated by SbCRY1a. Sweet sorghum [Sorghum bicolor (L.) Moench] is considered to be an ideal candidate for biofuel production due to its high efficiency of photosynthesis and the ability to maintain yield under harsh environmental conditions. Blue light receptor cryptochromes regulate multiple aspects of plant growth and development. Here, we reported the function and signal mechanism of sweet sorghum cryptochrome 1a (SbCRY1a) to explore its potential for genetic improvement of sweet sorghum varieties. SbCRY1a transcripts experienced almost 24 h diurnal cycling; however, its protein abundance showed no oscillation. Overexpression of SbCRY1a in Arabidopsis rescued the phenotype of cry1 mutant in a blue light-specific manner and regulated HY5 accumulation under blue light. SbCRY1a protein was present in both nucleus and cytoplasm. The photoexcited SbCRY1a interacted directly with a putative RING E3 ubiquitin ligase constitutive photomorphogenesis 1 (COP1) from sweet sorghum (SbCOP1) instead of SbSPA1 to suppress SbCOP1-SbHY5 interaction responding to blue light. These observations indicate that the function and signaling mechanism of cryptochromes are basically conservative between monocotyledons and dicotyledons. Moreover, SbCRY1a-overexpressed transgenic Arabidopsis showed oversensitive to abscisic acid (ABA) and salinity. The ABA-responsive gene ABI5 was up-regulated evidently in SbCRY1a transgenic lines, suggesting that SbCRY1a might regulate ABA signaling through the HY5-ABI5 regulon.
De Souza, Amanda P; Cocuron, Jean-Christophe; Garcia, Ana Carolina; Alonso, Ana Paula; Buckeridge, Marcos S
2015-11-01
Projections indicate an elevation of the atmospheric CO2 concentration ([CO2]) concomitant with an intensification of drought for this century, increasing the challenges to food security. On the one hand, drought is a main environmental factor responsible for decreasing crop productivity and grain quality, especially when occurring during the grain-filling stage. On the other hand, elevated [CO2] is predicted to mitigate some of the negative effects of drought. Sorghum (Sorghum bicolor) is a C4 grass that has important economical and nutritional values in many parts of the world. Although the impact of elevated [CO2] and drought in photosynthesis and growth has been well documented for sorghum, the effects of the combination of these two environmental factors on plant metabolism have yet to be determined. To address this question, sorghum plants (cv BRS 330) were grown and monitored at ambient (400 µmol mol(-1)) or elevated (800 µmol mol(-1)) [CO2] for 120 d and subjected to drought during the grain-filling stage. Leaf photosynthesis, respiration, and stomatal conductance were measured at 90 and 120 d after planting, and plant organs (leaves, culm, roots, prop roots, and grains) were harvested. Finally, biochemical composition and intracellular metabolites were assessed for each organ. As expected, elevated [CO2] reduced the stomatal conductance, which preserved soil moisture and plant fitness under drought. Interestingly, the whole-plant metabolism was adjusted and protein content in grains was improved by 60% in sorghum grown under elevated [CO2]. © 2015 American Society of Plant Biologists. All Rights Reserved.
Duval, Benjamin D; Ghimire, Rajan; Hartman, Melannie D; Marsalis, Mark A
2018-01-01
External inputs to agricultural systems can overcome latent soil and climate constraints on production, while contributing to greenhouse gas emissions from fertilizer and water management inefficiencies. Proper crop selection for a given region can lessen the need for irrigation and timing of N fertilizer application with crop N demand can potentially reduce N2O emissions and increase N use efficiency while reducing residual soil N and N leaching. However, increased variability in precipitation is an expectation of climate change and makes predicting biomass and gas flux responses to management more challenging. We used the DayCent model to test hypotheses about input intensity controls on sorghum (Sorghum bicolor (L.) Moench) productivity and greenhouse gas emissions in the southwestern United States under future climate. Sorghum had been previously parameterized for DayCent, but an inverse-modeling via parameter estimation method significantly improved model validation to field data. Aboveground production and N2O flux were more responsive to N additions than irrigation, but simulations with future climate produced lower values for sorghum than current climate. We found positive interactions between irrigation at increased N application for N2O and CO2 fluxes. Extremes in sorghum production under future climate were a function of biomass accumulation trajectories related to daily soil water and mineral N. Root C inputs correlated with soil organic C pools, but overall soil C declined at the decadal scale under current weather while modest gains were simulated under future weather. Scaling biomass and N2O fluxes by unit N and water input revealed that sorghum can be productive without irrigation, and the effect of irrigating crops is difficult to forecast when precipitation is variable within the growing season. These simulation results demonstrate the importance of understanding sorghum production and greenhouse gas emissions at daily scales when assessing annual
Savadogo, M.; Zemmelink, G.; Nianogo, A.J.; Keulen, van H.
2000-01-01
Two feeding trials were conducted to study the combined effects of (i) varying degrees of selective consumption and (ii) supplementation with cowpea (Trail 1) or groundnut haulms (Trial 2), on intake of organic matter (IOM) from sorghum stover, and total intake of digestible organic matter (IDOM).
Basahi, Mohammed
2015-11-01
Inter simple sequence repeats (ISSR) analysis was used to determine the genetic diversity among 15 genotypes of sorghum [Sorghum bicolor (L.) Moench] growing in some parts of Saudi Arabia and Yemen. A total of 92 alleles were amplified, with an average of 13 ISSR alleles per primer. Cluster analysis divided the 15 genotypes into two main groups. Group A consisted of five genotypes with white grains from Jazan and Abha with a similarity coefficient range of 0.527 to 0.818. Group B was comprised of 10 genotypes; two genotypes from Al-Qassim were clearly delimited from the remaining eight samples with a coefficient range from 0.709 to 0.490. The eight genotypes were divided into two clusters; one was comprised of landraces with dark grains from Abha in Saudi Arabia and Ab in Yemen, with a similarity coefficient range between 0.563 and 0.781, and the other cluster was differentiated into three white-colored-grain genotypes and one colored-grain genotype; all samples from North Yemen had a similarity coefficient range from 0.454 to 0.800. The current results encourage further collection and authentication of sorghum landraces in the gene banks of Saudi Arabia. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.
Carrari, F; Perez-Flore, L; Lijavetzky, D; Enciso, S; Sanchez, R; Benech-Arnold, R; Iusem, N
2001-04-01
Pre-harvest sprouting (PHS) in sorghum is related to the lack of a normal dormancy level during seed development and maturation. Based on previous evidence that seed dormancy in maize is controlled by the vp1 gene, we used a PCR-based approach to isolate two Sorghum bicolor genomic and cDNA clones from two genotypes exhibiting different PHS behaviour and sensitivity to abscisic acid (ABA). The two 699 amino acid predicted protein sequences differ in two residues at positions 341 (Gly or Cys within the repression domain) and 448 (Pro or Ser) and show over 80, 70 and 60% homology to maize, rice and oat VP1 proteins respectively. Expression analysis of the sorghum vp1 gene in the two lines shows a slightly higher level of vp1 mRNA in the embryos susceptible to PHS than in those resistant to PHS during embryogenesis. However, timing of expression was different between these genotypes during this developmental process. Whereas for the former the main peak of expression was observed at 20 days after pollination (DAP), the peak in the latter was found at later developmental stages when seed maturation was almost complete. Under favourable germination conditions and in the presence of fluridone (an inhibitor of ABA biosynthesis), sorghum vp1 mRNA showed to be consistently correlated with sensitivity to ABA but not with ABA content and dormancy.
Lifescience Database Archive (English)
Full Text Available WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone hv90e08 5', DNA sequence. 36 1.2... 2 BZ330175 |BZ330175.1 hv90e08.g1 WGS-SbicolorF (JM107 adapted methyl filtered) ...rF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone hz26f02 5', DNA sequence. 36 1.4 2 BZ628823... |BZ628823.1 ih62d12.g1 WGS-SbicolorF (DH5a methyl filtered) Sorghum bicolor geno...mic clone ih62d12 5', DNA sequence. 36 1.7 2 BZ340606 |BZ340606.1 ic39h07.b1 WGS-SbicolorF (JM107 adapted methyl filter
Influence of Sowing Times, Densities, and Soils to Biomass and Ethanol Yield of Sweet Sorghum
Directory of Open Access Journals (Sweden)
Tran Dang Xuan
2015-08-01
Full Text Available The use of biofuels helps to reduce the dependency on fossil fuels and therefore decreases CO2 emission. Ethanol mixed with gasoline in mandatory percentages has been used in many countries. However, production of ethanol mainly depends on food crops, commonly associated with problems such as governmental policies and social controversies. Sweet sorghum (Sorghum bicolor (L. Moench is one of the most potential and appropriate alternative crops for biofuel production because of its high biomass and sugar content, strong tolerance to environmental stress conditions and diseases, and wide adaptability to various soils and climates. The aim of this study was to select prospective varieties of sweet sorghum, optimum sowing times and densities to achieve high yields of ethanol production and to establish stable operational conditions in cultivating this crop. The summer-autumn cropping season combined with the sowing densities of 8.3–10.9 plant m−2 obtained the highest ethanol yield. Among cultivated locations, the soil with pH of 5.5 and contents of Al and Zn of 39.4 and 0.6 g kg−1, respectively, was the best condition to have an ethanol yield >5000 L ha−1. The pH ≥ 6.0 may be responsible for the significant reduction of zinc content in soils, which decreases both biomass of sweet sorghum and ethanol yield, while contents of N, P, K, organic carbon (OC and cation exchange capacity (CEC, and Fe likely play no role. The cultivar 4A was the preferred candidate for ethanol production and resistant to pests and diseases, especially cut worm (Agrotis spp..
Mohemed Ahmed Mohamed, Nasr Eldin; Charnikhova, Tatsiana; Bakker, Evert J.; Ast, van Aad; Babiker, Abdelgabar Gt; Bouwmeester, Harro J.
2016-01-01
BACKGROUND: Significant losses in sorghum biomass and grain yield occur in sub-Saharan Africa owing to infection by the root-parasitic weed Striga hermonthica (Del.) Benth. One strategy to avoid these losses is to adopt resistant crop varieties. For further delineation of the role of germination
Directory of Open Access Journals (Sweden)
João Restle
2000-04-01
Full Text Available O experimento teve como objetivo avaliar a utilização da palha de soja como substituto parcial da silagem de sorgo forrageiro na fração volumosa da dieta de terneiros confinados, sendo testados os seguintes tratamentos: T0 constituído por 100% de silagem de sorgo; T33 constituído por 66,67% de silagem de sorgo, mais 33,33% de feno de palha de soja; T66 constituído por 33,33% de silagem de sorgo, mais 66,67% de feno de palha de soja. As dietas foram fornecidas durante 77 dias para terneiros cruzas Charolês-Nelore com peso e idade média inicial de 165,6kg e 11 meses, respectivamente. A dieta alimentar foi isonitrogenada com 14% de proteína bruta (PB na matéria seca (MS, sendo 20% suprida na forma de uréia. A relação volumoso:concentrado com base na MS, foi de 70:30. Os dados foram submetidos à análise de regressão sendo obtidas as seguintes equações de regressão: para ganho de peso médio diário em kg (GMD = 1,166273 - 0,00186 PI (peso inicial - 0,00351 NS (nível de substituição; consumo médio diário de MS em kg/100 kg peso vivo/dia (CMSPPV = 2,284983 + 0,002679 PI - 0,002303 NS; consumo médio diário de energia digestível Mcal/100kg peso vivo/dia (CEDPPV = 5,709589 + 0,010964 PI - 0,018736 NS; conversão alimentar (CA = - 4,426857 + 0,064579 PI + 0,023165 NS. Verificou-se que a cada aumento de 1% na substituição da silagem de sorgo por feno de palha de soja, ocorreu um decréscimo de 3,51g no GMD e 2,3g no CMSPPV, enquanto que a conversão alimentar piorou em 0,023 unidades. O aumento na proporção de palha de soja na dieta em substituição à silagem de sorgo resultou em um decréscimo linear no desempenho dos animais. No entanto, mesmo no maior nível de substituição, o ganho de peso médio diário foi satisfatório.The objective of the experiment was to evaluate the use of soybean straw as partial substitute for sorghum silage in the roughage fraction of the diet of confined calves, being tested the following
Duval, B.; Ghimire, R.; Hartman, M. D.; Marsalis, M.
2016-12-01
Large tracts of semi-arid land in the Southwestern USA are relatively less important for food production than the US Corn Belt, and represent a promising area for expansion of biofuel/bioproduct crops. However, high temperatures, low available water and high solar radiation in the SW represent a challenge to suitable feedstock development, and future climate change scenarios predict that portions of the SW will experience increased temperature and temporal shifts in precipitation distribution. Sorghum (Sorghum bicolor) is a valuable forage crop with promise as a biofuel feedstock, given its high biomass under semi-arid conditions, relatively lower N fertilizer requirements compared to corn, and salinity tolerance. To evaluate the environmental impact of expanded sorghum cultivation under future climate in the SW USA, we used the DayCent model in concert with a suite of downscaled future weather projections to predict biogeochemical consequences (greenhouse gas flux and impacts on soil carbon) of sorghum cultivation in New Mexico. The model showed good correspondence with yield data from field trials including both dryland and irrigated sorghum (measured vs. modeled; r2 = 0.75). Simulation experiments tested the effect of dryland production versus irrigation, low N versus high N inputs and delayed fertilizer application. Nitrogen application timing and irrigation impacted yield and N2O emissions less than N rate and climate. Across N and irrigation treatments, future climate simulations resulted in 6% increased yield and 20% lower N2O emissions compared to current climate. Soil C pools declined under future climate. The greatest declines in soil C were from low N input sorghum simulations, regardless of irrigation (>20% declines in SOM in both cases), and requires further evaluation to determine if changing future climate is driving these declines, or if they are a function of prolonged sorghum-fallow rotations in the model. The relatively small gain in yield for
Proximate composition and antinutrient content of pumpkin ...
African Journals Online (AJOL)
Proximate composition and antinutrient content of pumpkin ( Cucurbita pepo ) and sorghum ( Sorghum bicolor ) flour blends fermented with Lactobacillus plantarum , Aspergillus niger and Bacillus subtilis.
Directory of Open Access Journals (Sweden)
Amir MOOSAVI
2011-05-01
Full Text Available Seed germination under field conditions is highly influenced by the presence of other plants. Allelopathy is an important mechanism of plant competition, by producing phytotoxins to the plant environment in order to decline other plants growth. Soil sickness problem in farm lands is also known as an allelopathic effect or even autotoxicity. The toxicity of released allelochemicals by a plant in the environment is attributed to its function of concentration, age and metabolic stage. In this study we investigate the effect (5, 20, 35 and 50 g l-1 of leaf, stem and root water extract of sorghum on seed germination and seedling growth of mung bean. The results of the experiment showed that allelopathic effect of different concentrations was not significant for germination percentage, but germination rate and mean germination time decreased significantly by increasing the concentration of allelopathic extracts; also, there was a clear allelopathic effect of sorghum extract on seedling growth of mung bean. 50 g l-1 sorghum stem extract exhibited the highest inhibitory effect on root and shoot growth of mung bean. Among all parts of sorghum, stem extracts showed the highest allelopatic effect on seedling growth. Root extract showed higher inhibitory effect than leaf extracts.
Directory of Open Access Journals (Sweden)
Amir MOOSAVI
2011-05-01
Full Text Available Seed germination under field conditions is highly influenced by the presence of other plants. Allelopathy is an important mechanism of plant competition, by producing phytotoxins to the plant environment in order to decline other plants� growth. Soil sickness problem in farm lands is also known as an allelopathic effect or even autotoxicity. The toxicity of released allelochemicals by a plant in the environment is attributed to its function of concentration, age and metabolic stage. In this study we investigate the effect (5, 20, 35 and 50 g l-1 of leaf, stem and root water extract of sorghum on seed germination and seedling growth of mung bean. The results of the experiment showed that allelopathic effect of different concentrations was not significant for germination percentage, but germination rate and mean germination time decreased significantly by increasing the concentration of allelopathic extracts; also, there was a clear allelopathic effect of sorghum extract on seedling growth of mung bean. 50 g l-1 sorghum stem extract exhibited the highest inhibitory effect on root and shoot growth of mung bean. Among all parts of sorghum, stem extracts showed the highest allelopatic effect on seedling growth. Root extract showed higher inhibitory effect than leaf extracts.
Directory of Open Access Journals (Sweden)
Paulo Henrique Pereira Peixoto
2007-01-01
Full Text Available Os efeitos do alumínio (Al+3 sobre a morfologia e o acúmulo de compostos fenólicos foram avaliados em duas cultivares de sorgo (Sorghum bicolor (L. Moench com tolerância diferencial ao Al+3. As plantas foram mantidas em solução nutritiva durante dez dias, na presença (185 mM ou na ausência de Al+3. Os ápices radiculares foram coloridos com hematoxilina férrica, sendo a intensidade da coloração observada na presença do Al+3 muito próxima entre as cultivares, o que inviabiliza a aplicação desse teste, isoladamente, para discriminação entre o genótipo sensível e o tolerante ao Al+3. As análises da morfologia externa e interna dos ápices radiculares de plantas tratadas com Al+3 também foram muito similares entre as duas cultivares, não permitindo a utilização dessas características para seleção entre a cultivar sensível e a tolerante. O maior acúmulo de lignina e, principalmente, a menor produção de compostos fenólicos, observados na presença do Al+3 nas raízes das plantas da cultivar tolerante (BR006R, são parâmetros que possibilitam a discriminação das cultivares quanto à tolerância ao Al+3.The Al+3 effects on the morphology and on the phenolics accumulation were evaluated in two sorghum cultivars exhibiting differential tolerance to Al+3. The plants were kept in nutrient solution, for ten days, in the presence (185 mM or Al+3 absence. The root apexes were colored with ferric hematoxylin, and because the intensity of color development is very similar among evaluated cultivars, the use of this method as a selection parameter for Al+3-tolerance is not indicated. Analyses of superficial and internal morphology from tissues treated with Al+3 also expressed very similar alterations among the two cultivars, not allowing its use for selection between sensitive and Al+3-tolerant genotype. The higher lignin accumulation and, mainly, the lower phenolics production in roots of the BR006R cultivar in Al+3's presence
Directory of Open Access Journals (Sweden)
A Beheshti
2011-02-01
Full Text Available Abstract Production, remobilization and accumulation of assimilates in crops especially under water stress are essential factors for determination and studying the yield differences of species and cultivars. Field experiment was conducted using a split plot design based on a randomized complete block design with 3 replication s during 2007 growing season in agricultural research station (Khorasan Agricultural and Natural Resource Research Center, Mashhad-Iran. Main plots were consisted of 2 levels of water, water deficit after anthesis and normal condition (with out water stress and factorial arrangement of photosynthesis status (non desiccation and chemical desiccation with potassium iodide and 3 grain sorghum genotypes (Sepide, M5 and M2 promising lines were assigned to sub plots. Results of variance analysis showed, that the effects of water stress on dry matter accumulation, efficiency of remobilization (REE, percent of remobilization (REP, biologic yield were significant in (p≤0.01 (and grain yield (economic yield was significant in p≤0.05, respectively. Water deficit caused an increase of 10.08%, 24.45 % and 12.43% in dry matter accumulation, percent of remobilization and efficiency of remobilization, respectively as compared to normal conditions. This in turn was led to decrease in seed yield, biological yield and harvest index by 36.38%, 5.43% and 31.60%, respectively. The effect of disturbance in current photosynthesis was significant in all of traits and caused the increase of 15.58%, 17.5% and 36.62% in dry matter accumulation, efficiency of remobilization and percent of remobilization, respectively. The role of remobilization was crucial in sorghum genotypes. Interaction between factors showed that highest dry matter accumulation, percentage of remobilization and efficiency of remobilization was in drought stress and disturbance in current photosynthesis and was 16.62%, 62.54 and 24.60%, respectively and was significantly
Directory of Open Access Journals (Sweden)
Aisha Siddiq A.
2015-12-01
Full Text Available Whole grains are rich in antioxidant components (AC, most of which are bound to fibre fraction and released during digestion. The study investigated the effect of digestive enzymes on the antioxidant properties of fibre-rich fractions from wheat (Triticum aestivum, finger millet (Eleusine coracana, pearl millet (Pennisetum typhoides and sorghum (Sorghum bicolor. Coarse (CF and fine fractions (FF of milled flour were separated using a standard sieve and analysed for nutritional composition, AC extractable in different solvents and antioxidant activity (AA in untreated and enzyme-treated fractions. The CF had a higher range of insoluble dietary fibre (17.26–20.93% than FF (10.65–17.29%. The highest amount of polyphenols and flavonoids was extractable in different solvents from finger millet and pearl millet, respectively. FF of pearl millet showed higher total AA in all solvents. Enzyme-treated samples had a much higher content of AC as well as higher total AA. Free radical scavenging assay revealed that enzyme-treated millet flours had higher activity in comparison to wheat. Between fractions, wheat exhibited variable results. Among millets, CF of finger millet and FF of pearl millet and sorghum had higher AA. In conclusion, digestive enzyme treatment released more AC from grains, and exhibited a higher AA.
Directory of Open Access Journals (Sweden)
Salvador Barros Torres
1997-03-01
Full Text Available Com o objetivo de estudar a eficiência do teste de estresse hídrico na avaliação da qualidade fisiológica de sementes de sorgo (Sorghum bicolor (L. Moench, seis lotes de sementes básicas da cultivar IPA-1011, safra 1995, foram analisados pêlos testes de germinação, primeira contagem, de frio sem solo, envelhecimento acelerado, condutividade elétrica, emergência em campo e comprimento das plântulas sob estresse hídrico nos potenciais de 0, -0,3. -0,6 e -0,9 MPa. Os trabalhos foram realizados no Laboratório de Análise de Sementes e no campo experimental da EMBRAPA-CPATSA, em Petrolina, PE. As determinações foram conduzidas com quatro repetições em delineamento experimental inteiramente casualizado. Os resultados indicaram que o teste de germinação sob estresse hídrico de -0,6MPa, pode ser usado para estimar o desempenho das sementes de sorgo em situações desfavoráveis de disponibilidade hídrica no solo.This work was carried out with the objective of testing the efficiency of the water stress test of the evaluation of physiological quality of grain sorghum (Sorghum bicolor (L. Moench seeds. Six lots of basic seeds of the cultivar IPA-1011 were analyzed by the following tests: germination, first count, cold without soil test, accelerated aging, electrical conductivity, field emergency, and seedling length under hydric stress at 0, - 0.3, - 0.6 and -0.9MPa matric potentials. The trials were carried out at the Seed Laboratory at the experimental field of EMBRAPA-CPATSA, Petrolina - PE, in a completely randomized design with four replications. The results indicated that the germination test under water stress of -0,6MPa can be used to estimate the performance of grain sorghum seeds under unfavorable soil water conditions.
Directory of Open Access Journals (Sweden)
Gustavo Pavan Mateus
2011-12-01
Full Text Available A escolha de espécies com elevada produção de fitomassa para utilização como plantas de cobertura no sistema de semeadura direta é extremamente importante em regiões de inverno seco. O objetivo deste trabalho foi avaliar a produção de fitomassa e acúmulo de nutrientes na parte aérea das plantas de sorgo Guiné gigante (Sorghum bicolor subespécie bicolor raça guinea, semeados em diferentes épocas de semeadura. Foi utilizado um delineamento em blocos ao acaso, com seis tratamentos e quatro repetições. Os tratamentos foram constituídos por seis épocas de semeadura (25/09/2000; 25/10/2000; 24/11/2000; 22/12/2000; 22/02/2001 e 03/04/2001. Por ocasião do florescimento das plantas, avaliou-se a produção de matéria seca, o número e diâmetro de colmos e a altura das plantas. Também foi determinado o teor e acúmulo de macro e micronutrientes, além da relação C/N. O ciclo das plantas diminuiu com o atraso da época de semeadura, e, conseqüentemente, a produção de matéria seca e a relação C/N também foram menores. Comportamento contrário foi observado para o teor de nutrientes. O sorgo de Guiné gigante é sensível ao fotoperíodo e, portanto, semeaduras mais tardias ocasionam diminuição do crescimento das plantas, produção de biomassa e acúmulo de nutrientes. Esta espécie consiste em uma boa opção para cultivo como planta de cobertura no sistema de semeadura direta devido a alta produção de fitomassa e ciclagem de N, P e K.Choosing species with high phytomass production to be cropped in no tillage system is extremely important in dry winter regions. The purpose of this research was to study plant biomass production and accumulation of nutrients in shoots of Giant Guinea sorghum plants (Sorghum bicolor subspecies bicolor race Guinea sown in different sowing dates. A randomized complete block design with six treatments and four replications was performed. Treatments consisted of six sowing dates (09/25/2000; 10
The nutritional value of sorghum bicolor stem flour used for infusion drinks in nigeria
International Nuclear Information System (INIS)
Adetuyi, A.O.; Akpambang, V.O.E.
2006-01-01
The black purple sheath (stem) of Sorgum bicolor, used locally as colour additive in cooked meals and infusion drinks taken as beverages, was examined for its nutritive value. The stem made into flour, was found to be rich in energy (1121.3 kJ/100 g), and in some micronutrients (mg/100 g), such as Mg (185.33), Ca (151.70), K (138.87), Na (127.61), and Fe (10.98). High Mg content of stem may be useful for overcoming Mg deficiency. The Fe content was sufficient to meet the daily-required intake (DRI) value for human beings. The presence of Cu, Zn and Mn was also observed. The content of crude fibre (32.0%) and carbohydrates (44.50%) were useful for making the stem a fodder for animal consumption. However, the protein content of the stem was low (3.20%). The functional properties observed for the stem compared favourably with those already reported for some other plants such as pigeon pea flour, African yam bean, and wheat flour. (author)
Directory of Open Access Journals (Sweden)
KRISHAN MOHAN RAI
2016-08-01
Full Text Available Biomass based alternative fuels offer a solution to the world’s ever-increasing energy demand. With the ability to produce high biomass in marginal lands with low inputs, sorghum has a great potential to meet second-generation biofuel needs. Despite the sorghum crop importance in biofuel and fodder industry, there is no comprehensive information available on the cell wall related genes and gene families (biosynthetic and modification. It is important to identify the cell wall related genes to understand the cell wall biosynthetic process as well as to facilitate biomass manipulation. Genome-wide analysis using gene family specific Hidden Markov Model of conserved domains identified 520 genes distributed among 20 gene families related to biosynthesis/modification of various cell wall polymers such as cellulose, hemicellulose, pectin and lignin. Chromosomal localization analysis of these genes revealed that about 65% of cell wall related genes were confined to four chromosomes (Chr. 1-4. Further, 53 tandem duplication events involving 146 genes were identified in these gene families which could be associated with expansion of genes within families in sorghum. Additionally, we also identified 137 Simple Sequence Repeats related to 112 genes and target sites for 10 miRNAs in some important families such as cellulose synthase, cellulose synthase-like and laccases, etc. To gain further insight into potential functional roles, expression analysis of these gene families was performed using publicly available data sets in various tissues and under abiotic stress conditions. Expression analysis showed tissue specificity as well as differential expression under abiotic stress conditions. Overall, our study provides a comprehensive information on cell wall related genes families in sorghum which offers a valuable resource to develop strategies for altering biomass composition by plant breeding and genetic engineering approaches.
Characterization of Transposable Elements in Laccaria bicolor
Energy Technology Data Exchange (ETDEWEB)
Labbe, Jessy L [ORNL; Murat, Claude [INRA, Nancy, France; Morin, Emmanuelle [INRA, Nancy, France; Tuskan, Gerald A [ORNL; Le Tacon, F [UMR, France; Martin, Francis [INRA, Nancy, France
2012-01-01
Background: The publicly available Laccaria bicolor genome sequence has provided a considerable genomic resource allowing systematic identification of transposable elements (TEs) in this symbiotic ectomycorrhizal fungus. Using a TE-specific annotation pipeline we have characterized and analyzed TEs in the L. bicolor S238N-H82 genome. Methodology/Principal Findings: TEs occupy 24% of the 60 Mb L. bicolor genome and represent 25,787 full-length and partial copies elements distributed within 172 families. The most abundant elements were the Copia-like. TEs are not randomly distributed across the genome, but are tightly nested or clustered. The majority of TEs are ancient except some terminal inverted repeats (TIRS), long terminal repeats (LTRs) and a large retrotransposon derivative (LARD) element. There were three main periods of TEs expansion in L. bicolor; the first from 57 to 10 Mya, the second from 5 to 1 Mya and the most recent from 500,000 years ago until now. LTR retrotransposons are closely related to retrotransposons found in another basidiomycete, Coprinopsis cinerea. Conclusions: This analysis represents an initial characterization of TEs in the L. bicolor genome, contributes to genome assembly and to a greater understanding of the role TEs played in genome organization and evolution, and provides a valuable resource for the ongoing Laccaria Pan-Genome project supported by the U.S.-DOE Joint Genome Institute.
DEFF Research Database (Denmark)
Andresen, Marianne; Wulff, Ednar Gadelha; Mbega, Ernest R.
2015-01-01
An aqueous extract of the sisal agave, A. sisalana, was prepared from dried stem tissue by boiling in water. The sisal extract (SE) displayed a broad inhibition of the seed-borne mycoflora when applied to farmer-saved seeds of Sorghum bicolor. Species of Fusarium (belonging to the Gibberella......-old plants (p agave, Yucca schidigera. Both extracts were found to reduce seed-borne Fusarium and crown rot more efficiently than fungicides based on tebuconazole, enilconazole...... and fludioxonil (p agave is a waste product in fiber production. From our findings A. sisalana stem appears to represent an abundant source of antifungal activity, simple to extract, easy to store and with a promising potential in biological seed treatment....
Role of Pigments and Tannins in the Reaction of Tan and Red Near ...
African Journals Online (AJOL)
Sorghum (Sorghum bicolor L. Moench) plant pigments have been associated with resistance to leaf diseases and grain deterioration. Four near-isogenic pairs of tan and non-tan (red) sorghum lines were assayed for their phenolic content and evaluated for their reaction to leaf diseases along with six other sorghum lines.
Antioxidant Capacity, Cytotoxicity, and Acute Oral Toxicity of Gynura bicolor
Directory of Open Access Journals (Sweden)
Wuen Yew Teoh
2013-01-01
Full Text Available Gynura bicolor (Compositae which is widely used by the locals as natural remedies in folk medicine has limited scientific studies to ensure its efficacy and nontoxicity. The current study reports the total phenolic content, antioxidant capacity, cytotoxicity, and acute oral toxicity of crude methanol and its fractionated extracts (hexane, ethyl acetate, and water of G. bicolor leaves. Five human colon cancer cell lines (HT-29, HCT-15, SW480, Caco-2, and HCT 116, one human breast adenocarcinoma cell line (MCF7, and one human normal colon cell line (CCD-18Co were used to evaluate the cytotoxicity of G. bicolor. The present findings had clearly demonstrated that ethyl acetate extract of G. bicolor with the highest total phenolic content among the extracts showed the strongest antioxidant activity (DPPH radical scavenging assay and metal chelating assay, possessed cytotoxicity, and induced apoptotic and necrotic cell death, especially towards the HCT 116 and HCT-15 colon cancer cells. The acute oral toxicity study indicated that methanol extract of G. bicolor has negligible level of toxicity when administered orally and has been regarded as safe in experimental rats. The findings of the current study clearly established the chemoprevention potential of G. bicolor and thus provide scientific validation on the therapeutic claims of G. bicolor.
Harper, M T; Oh, J; Giallongo, F; Lopes, J C; Roth, G W; Hristov, A N
2017-07-01
Double cropping and increasing crop diversity could improve dairy farm economic and environmental sustainability. In this experiment, corn silage was partially replaced with 2 alternative forages, brown midrib-6 brachytic dwarf forage sorghum (Sorghum bicolor) or fall-grown oat (Avena sativa) silage, in the diet of lactating dairy cows. We investigated the effect on dry matter (DM) intake, milk yield (MY), milk components and fatty acid profile, apparent total-tract nutrient digestibility, N utilization, enteric methane emissions, and income over feed cost. We analyzed the in situ DM and neutral detergent fiber disappearance of the alternative forages versus corn silage and alfalfa haylage. Sorghum was grown in the summer and harvested in the milk stage. Oats were grown in the fall and harvested in the boot stage. Compared with corn silage, neutral detergent fiber and acid detergent fiber concentrations were higher in the alternative forages. Lignin content was highest for sorghum silage and similar for corn silage and oat silage. The alternative forages had less than 1% starch compared with the approximately 35% starch in the corn silage. Ruminal in situ DM effective degradability was similar, although statistically different, for corn silage and oat silage, but lower for sorghum silage. Diets with the alternative forages were fed in a replicated 3 × 3 Latin square design experiment with three 28-d periods and 12 Holstein cows. The control diet contained 44% (DM basis) corn silage. In the other 2 diets, sorghum or oat silages were included at 10% of dietary DM, replacing corn silage. Sorghum silage inclusion decreased DM intake, MY, and milk protein content but increased milk fat and maintained energy-corrected MY similar to the control. Oat silage had no effect on DM intake, MY, or milk components compared to the control. The oat silage diet increased apparent total-tract digestibility of dietary nutrients, except starch, whereas the sorghum diet slightly
African Journals Online (AJOL)
sunny
2014-11-12
Nov 12, 2014 ... 1Department of Agricultural Engineering, Federal Polytechnic Bida Niger State, ... Guinea corn residue was collected from the Teaching and Research Farm of the ... experimental methods developed so far, can somehow.
African Journals Online (AJOL)
Mara
2016-05-04
May 4, 2016 ... 1Departamento De Solos E Adubos, Universidade Estadual Paulista Júlio de ..... Salinidade modula negativamente a absorção e assimilação de NO3- ... Kavi Kishor PB, Sangam S, Amrutha RN, Sri Laxmi P, Naidu KR, Rao.
African Journals Online (AJOL)
Tuoyo Aghomotsegin
2016-06-08
-dimensional space. Population structure analysis ... Despite similar weather characteristics in the two regions, preliminary results ..... results generated through STRUCTURE were used to color-code the neighbor-joining tree.
African Journals Online (AJOL)
sgopalakrishnan
2010-08-05
Aug 5, 2010 ... acetic acid (IAA) and siderophore (Vivas et al., 2006;. Hanane et al., 2008). Soil microorganisms not ... Among the soil microorganisms, bacteria and fungi have received considerable attention as plant ... solubilizing substances and intracellular siderophores, which induce germination of seeds and their ...
African Journals Online (AJOL)
user
2017-11-13
Nov 13, 2017 ... major cereal crop with multi-purposes in lower and mid altitude regions ... efficiency and grain yield for different cereal crops (Malakouti, 2008). .... The analysis of variance (ANOVA) was ..... Agriculture and environment in EU-15 – the IRENA ... Moench) varieties to blended fertilizer on yield, yield component ...
Anthracnose (Collectrotichum sublineolum) is considered one of the most destructive diseases of sorghum (Sorghum bicolor L. Moench) because it infects all aerial tissues of the plant. The best strategy to control the disease is the incorporation of resistance genes. At present, eighteen sorghum line...
This project compared lambs grazing forage chicory (Cichorium intybus L.) with lambs grazing brown mid-rib forage sorghum (Sorghum bicolor (L.) Moench.) x sudangrass (Sorghum sudanense Piper) hybrid (BMR) to determine if anti-parasitic effects of chicory could be demonstrated. Lambs grazed these fo...
Screening and identification of lactic acid bacteria isolated from ...
African Journals Online (AJOL)
The lactic acid bacteria (LAB) isolated from sorghum (Sorghum bicolor. L.) silage were identified during different periods of evolution of sorghum silage in west Algeria. Morphological, physiological, biochemical and technological techniques were used to characterize lactic acid bacteria isolates. A total number of 27 ...
Directory of Open Access Journals (Sweden)
G. Marchi
2008-01-01
Full Text Available Hybrids of Sorghum sudanensis (sudangrass and Sorghum bicolor genotypes can produce high amounts of biomass, sorgoleone (a long chain hydroquinone, and other phytotoxic substances. Shoots and roots of a sorghum-sudangrass hybrid (cv. Trudan 8 were collected 10, 20, 30, 40, and 50 days after emergence. Four concentrations of aqueous extracts from the shoots and roots (0, 0.4, 2, and 10 g L-1, w/v were used to treat seeds of lettuce (Lactuca sativa, tomato (Lycopersicum sculentum, purslane (Portulaca oleracea, and pigweed (Amaranthus retroflexus. Seed germination of lettuce, tomato, and pigweed was inhibited by extracts from sorghum-sudangrass shoots at 10 g L-1 when made from sorghum-sudangrass plants 20 days or less in age. Seed germination of purslane was not inhibited by any sorghum-sudangrass extract. Growth of the four species evaluated were systematically inhibited when treated with 10 g L-1 extracts from sorghum-sudangrass shoots harvested up to 10 days after emergence.Os capins híbridos obtidos pelo cruzamento entre Sorghum sudanensis (capim-sudão e genótipos de Sorghum bicolor possuem alto potencial para produção de biomassa e para controle de plantas daninhas pela produção de substâncias fitotóxicas, como o sorgoleone (uma hidroquinona de cadeia longa. Sementes de alface (Lactuca sativa, tomate (Lycopersicum sculentum, beldroega (Portulaca oleracea e caruru (Amaranthus retroflexus foram submetidas a tratamentos com extratos aquosos da parte aérea e das raízes do híbrido de sorgo com capim-sudão, cv. Trudan 8, colhido em cinco diferentes estádios de crescimento (10, 20, 30, 40 e 50 dias após a emergência. Os extratos foram preparados em quatro concentrações (0, 0,4, 2 e 10 g L-1, p/v e aplicados em quatro repetições. Após os tratamentos, a germinação e o comprimento de plântulas das espécies foram avaliados. A germinação de sementes de tomate, caruru e alface foi inibida pelos extratos da parte aérea das
Evaluation of some sorghum genotypes under normal and moisture-stress conditions
International Nuclear Information System (INIS)
Abu Assar, A. H.; Salih, M.; Wagner, C.; Friedt, W.; Abdelmula, A. A.; Ordon, F.; Steffens, D.
2008-01-01
This study was undertaken to identify the morphological and physiological attributes related to drought tolerance in sorghum (sorghum bicolor (L) Moench). Eight genotypes were tested in a pot experiment carried out at Giessen, Germany. Drought conditions were imposed by withholding watering of the plants when filed water-holding capacity was at 40% and 70%. The tested genotypes differed significantly in most of the measured traits. Grain yield under drought stress ranged from 28 to 61 g/ plant, and relative yield ranged 30% to 56% with an average of 47%. Based on yield/plant, the genotypes Wad Ahmed (61g). SAR 41 (55 g) and ICSR 91030 (54 g) were the best under drought stress conditions, and based on relative yield, the best genotypes were SAR 41 (56%), Wad Ahmed (55%), and Red Mugud (53%). The mean potassium content was 18 mg/g, with a range of 14 mg/g (Red Mugud) to 22 mg/g (Arfa Gadamak). Significant difference were obtained for protein percentage of the dry matter under conditions of drought stress. The values ranged form 14.1% (Red Mugud) to 16.7% (Tabat) with a mean of 15.3%. Grain yield under drought stress was positively correlated with relative yield (r= 0.89), total biomass (r= 0.56), number of seeds per panicle (r= 0.66) and harvest index (r= 0.81), but negatively correlated with 1000-grain (r= 0.37). (Author)
Advances in sorghum genetic mapping with implications for sorghum improvement
International Nuclear Information System (INIS)
Lee, M.
1998-01-01
Despite the importance of the sorghum crop, comprehensive genetic characterization has been limited. Therefore, the primary goal of this research program was to develop basic genetic tools to facilitate research in the genetics and breeding of sorghum. The first phase of this project consisted of constructing a genetic map based on restriction fragment length polymorphisms (RFLPs). The ISU sorghum map was created through linkage analysis of 78 F2 plants of an intraspecific cross between inbred CK60 and accession PI229828. Subsequent mapping, efforts in several labs have enriched the sorghum map to the point where it now contains over 1,500 loci defined by RFLPs and many others defined by mutant phenotypes and QTLs. The ISU map consists of 201 loci distributed among 10 linkage groups covering 1299 cM. Comparison of sorghum and maize RFLP maps on the basis of common sets of DNA probes revealed a high degree of conservation as reflected by homology, copy number, and colinearity. Examples of conserved and rearranged locus orders were observed. The same sorghum population was used to map genetic factors (mutants and QTLS) for several traits including vegetative and reproductive morphology, maturity, insect, and disease resistance. Four QTLs for plant height, an important character for sorghum adaptation in temperate latitudes for grain production, were identified in a sample of 152 F2 plants whereas 6 QTLs were detected among their F3 progeny. These observations and assessments of other traits at 4 QTLs common to F2 plants and their F3 progeny indicate some of these regions correspond to loci (dw) previously identified on the basis of alleles with highly qualitative effects. Four of the six sorghum plant height QTLs seem to be orthologous to plant height QTLs in maize. Other possible instances of orthologous QTLs included regions for maturity and tillering. These observations suggest that the conservation of the maize and sorghum genomes encompasses sequence homology
Directory of Open Access Journals (Sweden)
Rahul M. Phuke
2017-05-01
Full Text Available The low grain iron and zinc densities are well documented problems in food crops, affecting crop nutritional quality especially in cereals. Sorghum is a major source of energy and micronutrients for majority of population in Africa and central India. Understanding genetic variation, genotype × environment interaction and association between these traits is critical for development of improved cultivars with high iron and zinc. A total of 336 sorghum RILs (Recombinant Inbred Lines were evaluated for grain iron and zinc concentration along with other agronomic traits for 2 years at three locations. The results showed that large variability exists in RIL population for both micronutrients (Iron = 10.8 to 76.4 mg kg−1 and Zinc = 10.2 to 58.7 mg kg−1, across environments and agronomic traits. Genotype × environment interaction for both micronutrients (iron and zinc was highly significant. GGE biplots comparison for grain iron and zinc showed greater variation across environments. The results also showed that G × E was substantial for grain iron and zinc, hence wider testing needed for taking care of G × E interaction to breed micronutrient rich sorghum lines. Iron and zinc concentration showed high significant positive correlation (across environment = 0.79; p < 0.01 indicating possibility of simultaneous effective selection for both the traits. The RIL population showed good variability and high heritabilities (>0.60, in individual environments for Fe and Zn and other traits studied indicating its suitability to map QTL for iron and zinc.
Differences in Fusarium Species in brown midrib Sorghum and in Air Populations in Production Fields.
Funnell-Harris, Deanna L; Scully, Erin D; Sattler, Scott E; French, Roy C; O'Neill, Patrick M; Pedersen, Jeffrey F
2017-11-01
Several Fusarium spp. cause sorghum (Sorghum bicolor) grain mold, resulting in deterioration and mycotoxin production in the field and during storage. Fungal isolates from the air (2005 to 2006) and from leaves and grain from wild-type and brown midrib (bmr)-6 and bmr12 plants (2002 to 2003) were collected from two locations. Compared with the wild type, bmr plants have reduced lignin content, altered cell wall composition, and different levels of phenolic intermediates. Multilocus maximum-likelihood analysis identified two Fusarium thapsinum operational taxonomic units (OTU). One was identified at greater frequency in grain and leaves of bmr and wild-type plants but was infrequently detected in air. Nine F. graminearum OTU were identified: one was detected at low levels in grain and leaves while the rest were only detected in air. Wright's F statistic (F ST ) indicated that Fusarium air populations differentiated between locations during crop anthesis but did not differ during vegetative growth, grain development, and maturity. F ST also indicated that Fusarium populations from wild-type grain were differentiated from those in bmr6 or bmr12 grain at one location but, at the second location, populations from wild-type and bmr6 grain were more similar. Thus, impairing monolignol biosynthesis substantially effected Fusarium populations but environment had a strong influence.
Energy Technology Data Exchange (ETDEWEB)
Dahlberg, Jeffrey A. [Univ. of California, Parlier, CA (United States). Kearney Research and Extension Center; Wolfrum, Edward J. [National Renewable Energy Lab. (NREL), Golden, CO (United States). Process and Analytical Engineering Group
2010-09-28
The development of a robust source of renewable transportation fuel will require a large amount of biomass feedstocks. It is generally accepted that in addition to agricultural and forestry residues, we will need crops grown specifically for subsequent conversion into fuels. There has been a lot of research on several of these so-called "dedicated bioenergy crops" including switchgrass, miscanthus, sugarcane, and poplar. It is likely that all of these crops will end up playing a role as feedstocks, depending on local environmental and market conditions. Many different types of sorghum have been grown to produce syrup, grain, and animal feed for many years. It has several features that may make it as compelling as other crops mentioned above as a renewable, sustainable biomass feedstock; however, very little work has been done to investigate sorghum as a dedicated bioenergy crop. The goal of this project was to investigate the feasibility of using sorghum biomass to produce ethanol. The work performed included a detailed examination of the agronomics and composition of a large number of sorghum varieties, laboratory experiments to convert sorghum to ethanol, and economic and life-cycle analyses of the sorghum-to-ethanol process. This work showed that sorghum has a very wide range of composition, which depended on the specific sorghum cultivar as well as the growing conditions. The results of laboratory- and pilot-scale experiments indicated that a typical high-biomass sorghum variety performed very similarly to corn stover during the multi-step process required to convert biomass feedstocks to ethanol; yields of ethanol for sorghum were very similar to the corn stover used as a control in these experiments. Based on multi-year agronomic data and theoretical ethanol production, sorghum can achieve more than 1,300 gallons of ethanol per acre given the correct genetics and environment. In summary, sorghum may be a compelling dedicated bioenergy crop that could help
Directory of Open Access Journals (Sweden)
C.C Meinerz
2014-12-01
Full Text Available Este trabalho objetivou a purificação parcial, por precipitação com sulfato de amônio (SA e cromatografia de filtração em gel (CFG, de compostos presentes no decocto de Adiantum capillus-veneris (avenca eficientes na indução de fitoalexinas em mesocótilos de Sorghum bicolor sorgo. Decocto de A. capillus-veneris a 1% (peso seco/volume foi precipitado com concentrações de SA variando de 0 a 100% (em intervalos de 20%, e essas frações foram submetidas à CFG. Para o decocto não precipitado foram obtidos nove picos proteicos e um pico glicídico com massas moleculares variando de 0,61 à 0,01 KDa. Para a precipitação fracionada obteve-se: na fração 0-20% dois picos proteicos (menores que 0,01 KDa e dois glicídicos com concentração de açúcares variando de 4,1 a 17,5 µg mL-1; na fração 20-40% três picos proteicos (111,5 à 0,98 KDa e cinco glicídicos (11,3 a 73,7 µg de açúcares mL-1; na fração 40-60% dois picos proteicos (111,5 à 0,09 KDa e dois glicídicos (5,6 a 7, 5 µg de açúcares mL-1; na fração 60-80% seis picos proteicos (menores que 0,02 KDa e dois glicídicos (16,5 a 51,3 µg de açúcares mL-1; e na fração 80-100% três picos proteicos (menores que 0,09 KDa. Mesocótilos de sorgo foram tratados com as frações provenientes da CFG, além do decocto a 1%, acibenzolar-S-metil (ASM (125 mg L-1 do i.a. como eliciador de referência e tampão fosfato de sódio 10 mM pH 6,0. O pico proteico II (0,09 KDa do decocto não precipitado induziu fitoalexinas, 6,68% superior a ASM. Entre os precipitados, a fração 60-80% de SA induziu 76% mais que ASM. Dessa forma, pôde-se obter frações proteicas e/ou glicídicas indutoras de fitoalexinas em sorgo de maneira superior ao extrato (decocto do qual é originária, indicando o potencial dessas moléculas para trabalhos futuros sobre indução de resistência.
Directory of Open Access Journals (Sweden)
Renius Mello
2004-10-01
Full Text Available O trabalho caracteriza e quantifica as frações dos carboidratos e proteínas de silagens de milho, sorgo e girassol, com a finalidade de disponibilizar dados bromatológicos que possibilitem maximizar o aproveitamento desses alimentos e otimizar o desempenho animal. Foram avaliados dois híbridos de milho (Zea mays, DKB-215 e DKB-344, dois híbridos de sorgo (Sorghum bicolor, Ambar e AG-2005 e dois híbridos de girassol (Helianthus annuus, Rumbosol e M-734. A silagem de girassol apresentou menor valor de carboidratos totais (CT e B2 (celulose e hemicelulose e maior de C (lignina e fibra associada à lignina. A silagem de milho apresentou maior valor de carboidratos não-fibrosos (CNF, A+B1 (açúcares solúveis + amido e pectina e de CT juntamente com a silagem de sorgo, enquanto a de sorgo apresentou maior valor de B2 em função da maior contribuição de colmo. Houve diferença entre híbridos dentro da cultura do girassol para CT, sendo que o Rumbosol obteve maior valor que o M-734, em razão da aptidão dos mesmos, forrageiro e granífero respectivamente. A silagem de girassol apresentou maior valor de proteína bruta (PB e de suas frações. Não foi observada diferença entre híbridos nos valores de PB e de suas frações.This work evaluates and characterizes the carbohydrates and proteins fractions of corn, sorghum and sunflower silages. The purpose was to supply composition data that make it possible to maximize use of foods and optimize animal performance. Two corn (Zea mays hybrids, DKB-215 and DKB-344; sorghum (Sorghum bicolor hybrids, Ambar and AG-2005; and sunflower (Helianthus annuus hybrids, Rumbosol and M-734; were evaluated. Sunflower silage showed the lowest total carbohydrates (TC and B2 (cellulose and hemicelluloses values and the highest content of C (lignin and fiber associated lignin. Corn silages showed higher non-fiber carbohydrates (NFC, A+B1 (soluble sugars + starch and pectin and TC together sorghum silage while
Cover crops growth under water deficitCrescimento de plantas de cobertura sob déficit hídrico
Directory of Open Access Journals (Sweden)
Edison Ulisses Ramos Junior
2013-03-01
Full Text Available One of the challenges to be overcome in no till deploying in tropical regions is the production of straw in the offseason, a period commonly with low water availability. To help in the choice of species to be used as cover crop in dry winter regions, the aim of this work was to evaluate the effect of soil water potential on growth of black oat (Avena strigosa Sckreb, pearl millet (Pennisetum glaucum (L. R. Brown, grain sorghum (Sorghum bicolor L. Moench. e guinea sorghum (Sorghum bicolor subespécie bicolor raça guinea. Pearl millet is a good option to be cropped during offseason by show high yield potencial, even been more sensitive to water deficit. Grain sorghum and guinea sorghum are also good options, particularly by showed abundant root system, which possibly gives them a certain tolerance to low water availability conditions. The black oat, even with high tolerance to water stress (tolerance conferred by highest percentage of fine roots, seems to be much affected by higher temperatures, common to these regions. Um dos desafios a serem vencidos na implantação do sistema de semeadura direta em regiões tropicais é a produção de palhada na entressafra, período comumente com baixa disponibilidade hídrica. Visando auxiliar a escolha das espéciesa serem empregadas como planta de cobertura em regiões de inverno seco, objetivou-se com este trabalho avaliar o efeito de potenciais de água no solo no crescimento de aveia preta (Avena strigosa Sckreb, milheto (Pennisetum glaucum (L. R. Brown, sorgogranífero (Sorghum bicolor L. Moench. esorgo-de-guiné(Sorghum bicolor subespécie bicolor raça guinea, bem como detectar possíveis estratégias destas espécies para contornarem condições de baixa disponibilidade hídrica. O milheto, mesmo sendo mais sensível ao déficit hídrico, é uma boa opção a ser cultivado na entressafra pelo seu elevado potencial produtivo. O sorgo granífero e o sorgo-de-guiné também são boas opções, em
Effect of different cover crops on C and N cycling in sorghum NT systems.
Frasier, Ileana; Quiroga, Alberto; Noellemeyer, Elke
2016-08-15
In many no-till (NT) systems, residue input is low and fallow periods excessive, for which reasons soil degradation occurs. Cover crops could improve organic matter, biological activity, and soil structure. In order to study changes in soil carbon, nitrogen and microbial biomass a field experiment (2010-2012) was set up with sorghum (Sorghum bicolor Moench.) monoculture and with cover crops. Treatments were control (NT with bare fallow), rye (Secale cereale L.) (R), rye with nitrogen fertilization (R+N), vetch (Vicia villosa Roth.) (V), and rye-vetch mixture (VR) cover crops. A completely randomized block design with 4 replicates was used. Soil was sampled once a year at 0.06 and 0.12m depth for total C, microbial biomass carbon (MBC) and-nitrogen (MBN) determinations. Shoot and root biomass of sorghum and cover crops, litter biomass, and their respective carbon and nitrogen contents were determined. Soil temperatures at 0.06 and 0.12m depth, volumetric water contents and nitrate concentrations were determined at sowing, and harvest of each crop, and during sorghum's vegetative phase. NT led to a small increase in MBC and MBN, despite low litter and root biomass residue. Cover crops increased litter, root biomass, total C, MBC, and MBN. Relationships between MBC, MBN, and root-C and -N adjusted to logistic models (R(2)=0.61 and 0.43 for C and N respectively). Litter cover improved soil moisture to 45-50% water filled pore space and soil temperatures not exceeding 25°C during the warmest month. Microbial biomass stabilized at 20.1gCm(-2) and 1.9gNm(-2) in the upper 0.06m. Soil litter disappearance was a good indicator of mineral N availability. These findings support the view that cover crops, specifically legumes in NT systems can increase soil ecosystem services related to water and carbon storage, habitat for biodiversity, and nutrient availability. Copyright © 2016 Elsevier B.V. All rights reserved.
Powdery Mildew Resistance in 268 Entries of Hordeum vulgare
DEFF Research Database (Denmark)
Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J
1984-01-01
A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...
Ali, Amjad; Guo, Di; Mahar, Amanullah; Wang, Ping; Ma, Fang; Shen, Feng; Li, Ronghua; Zhang, Zengqiang
2017-05-01
The increasing industrial, mining and agricultural activities have intensified the release of potential toxic trace elements (PTEs), which are of great concern to human health and environment. The alarming increase in PTEs concentration, stress the need for biotechnological remediation approaches. In order to assist phytoextraction of PTEs, different combinations of Streptomyces pactum (Act12) with biochar were applied to mining and industrial polluted soils of Shaanxi and Hunan Provinces of China, respectively. Act12 affected soil physico-chemical properties in both soils. Bioavailable Zn and Pb increased due to microbial activities, while Cd decreased by adsorption on biochar surface. Phytoextraction of Zn and Pb occurred in TG and CZ soil, while Cd uptake decreased in iron rich CZ soil by conflicting effect of siderophores. Cd in sorghum shoot was below detection level, but uptake increased in the roots due to minimum available fraction in TG soil. Biochar reduced the shoot and root uptake of Cd. Sorghum shoot, root dry weight and chlorophyll significantly increased after Act12 and biochar application. β-glucosidase, alkaline phosphatase and urease activities were significantly enhanced by Act12. Antioxidant enzymatic activities (POD, PAL and PPO) and lipid peroxidation (MDA) were decreased after the application of Act12 and biochar by reduced PTEs stress. Act12 and biochar can be used for different crops to enumerate the transfer rate of PTEs into the food chain. Copyright © 2017 Elsevier Inc. All rights reserved.
Apospory appears to accelerate onset of meiosis and sexual embryo sac formation in sorghum ovules
Directory of Open Access Journals (Sweden)
Elliott Estella
2011-01-01
Full Text Available Abstract Background Genetically unreduced (2n embryo sacs (ES form in ovules of gametophytic apomicts, the 2n eggs of which develop into embryos parthenogenetically. In many apomicts, 2n ES form precociously during ovule development. Whether meiosis and sexual ES formation also occur precociously in facultative apomicts (capable of apomictic and sexual reproduction has not been studied. We determined onset timing of meiosis and sexual ES formation for 569 Sorghum bicolor genotypes, many of which produced 2n ES facultatively. Results Genotype differences for onset timing of meiosis and sexual ES formation, relative to ovule development, were highly significant. A major source of variation in timing of sexual germline development was presence or absence of apomictic ES, which formed from nucellar cells (apospory in some genotypes. Genotypes that produced these aposporous ES underwent meiosis and sexual ES formation precociously. Aposporous ES formation was most prevalent in subsp. verticilliflorum and in breeding lines of subsp. bicolor. It was uncommon in land races. Conclusions The present study adds meiosis and sexual ES formation to floral induction, apomictic ES formation, and parthenogenesis as processes observed to occur precociously in apomictic plants. The temporally diverse nature of these events suggests that an epigenetic memory of the plants' apomixis status exists throughout its life cycle, which triggers, during multiple life cycle phases, temporally distinct processes that accelerate reproduction.
Lipids characterization of ultrasound and microwave processed germinated sorghum.
Hassan, Sadia; Imran, Muhammad; Ahmad, Nazir; Khan, Muhammad Kamran
2017-06-27
Cereal crops and oilseeds provide diverse pool of fatty acids with characteristic properties. Sorghum (Sorghum bicolor (L.) Moench) provides the staple food with serving as main source of energy and protein. Germination of sorghum generally increases the nutritive value of seeds and the effects of germination on lipids composition of seeds vary greatly with processing conditions. Therefore, the current study was conducted to compare the effect of emerging processing techniques such as ultrasound (US) and microwave (MW) on fatty acids composition and oil yield of sorghum seeds before and after germination. Initially sorghum grains were soaked with 5% NaOCl (sodium hypochlorite) for surface sterilization. Afterwards, grains were soaked in excess water for 22 h at room temperature and were divided into four portions. The first portion (100 g grains) was subjected to germination without applying any microwave and ultrasonic treatment (T 0 ). Second portion was further divided into four groups (T 1 , T 2 , T 3 , T 4 ) (100 g of each group) and grains were subjected to ultrasonic treatments using two different ultrasonic intensities (US 1 : 40%; US 2 : 60%) within range of 0-100% and with two different time durations (t US1 : 5 min; t US2 : 10 min) at constant temperature. Third portion was also divided into four groups (T 1 , T 2 , T 3 , T 4 ) (100 g of each group) and exposed to microwave treatments at two different power levels (MW 1 : 450 watt; MW 2 : 700 watt) within the range of 100-900 W for two different time durations (t MW1 : 15 s; t MW2 : 30s). Similarly, fourth portion was divided into four groups (T 1 , T 2 , T 3 , T 4 ) (100 g of each group). Each group was exposed to both MW (MW 1 , MW 2 ) (100-900 watt power) & US (US 1 , US 2 ) (0-100% intensity) treatments at two different time levels (t US , t MW ). Then, germination was carried out and pre-treated raw and pre-treated germinated sorghum grains were analyzed for total oil yield, fatty acid
Brewer, Michael J; Gordy, John W; Kerns, David L; Woolley, James B; Rooney, William L; Bowling, Robert D
2017-10-01
In response to the 2013 outbreak of sugarcane aphid, Melanaphis sacchari (Zehntner) (Hemiptera: Aphididae), on sorghum, Sorghum bicolor (L.), in North America, experiments were conducted at three southern U.S. grain sorghum production locations (Corpus Christi, TX; Winnsboro, LA; Rosenberg, TX). The objectives were to authenticate yield decline on susceptible hybrids (2014 and 2015) and to measure aphid population growth and natural enemy prevalence on susceptible and resistant hybrids with similar genetic background (2014). Yield decline on susceptible hybrids (Tx 2752/Tx430 and DKS53-67) was more substantial when aphid population growth accelerated quickly and peaked above 300 aphids per leaf (50 to nearly 100% yield decline). Location and year variation in maximum aphid density and cumulative aphid-days was high, with doubling time values on the susceptible hybrids ranging between 3.9 and 7.9 d. On resistant Tx2752/Tx2783, leaf injury and yield decline were not seen or less severe than on its paired susceptible Tx2752/Tx430. Aphids declined on Tx2752/Tx2783 after initial colony establishment (Corpus Christi) or took about 60% longer to double in population size when compared with Tx2572/Tx430 (Winnsboro). The predominant natural enemy taxa were aphelinid mummies (Hymenoptera: Aphelinidae), ladybird beetles (Coleoptera: Coccinellidae), and sryphid flies (Diptera: Syrphidae), and they were more prevalent during flowering than prior to flowering. They were generally responsive to changes in aphid density of both susceptible and resistant hybrids, but variability points to need for further study. In future research, full season observations should continue as well as more detailed study of potential compatibility of sorghum resistance and biological control. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Agronomic divergence of sorghum hybrids for silage yield in the semiarid region of Paraiba
Directory of Open Access Journals (Sweden)
Thiago Carvalho da Silva
2011-09-01
Full Text Available The objective of this study was to evaluate the agronomic divergence of 25 sorghum hybrids (Sorghum bicolor L. Moench in the semiarid region of Paraiba. A randomized block design with three replications was used for evaluation of plant height (PH, total natural matter production (TNMP and total dry matter production (TDMP and the percentage of components of DM (panicle, leaf blade, stem and dead matter of the following hybrids: 866005, 866019, 866033, 866034, 866035, 866036, 866037, 866040, 866041, 866042, 866043, 866044, 870025, 870031, 870035, 870041, 870051, 870067, 870081, 870085, 870095, 1F305, BRS 610, Volumax, and XBS60329. Hybrid 1F305, followed by hybrid 866034, presented the highest average PH. There was a range from 7.679 to 20.948 kg/ha (average of 13,799 kg/ha for TDMP. Hybrids 1F305, BRS 610 and Volumax presented less potential, and hybrids 866,041 and 866,042 were the most productive. Based on cluster analysis and subjective cut in 50% of dissimilarity, it was possible to establish four hierarchical groups, from which two stood out concerning productive characteristics. The group formed by hybrids Volumax, BRS 610, and XBS60329 presented lower averages for yield and lower percentage of panicle. Hybrids 866041 and 866042 show a higher total dry matter production, with values around 20,000 kg/ha.
Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F.X.; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno
2013-01-01
Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species. PMID:23184232
Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F X; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno
2013-02-01
Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species.
Influence of Glomus etunicatum and Glomus intraradices fungi ...
African Journals Online (AJOL)
aghomotsegin
The objectives of this study were to determine the effects of micronutrient deficiency on root colonization by arbuscular mycorrhizal fungi (AMF), and to assess the role of AMF on growth of sorghum and tomato plants in perlite bed culture. In a pot culture experiment with sterile perlite, sorghum (Sorghum bicolor L.) and ...
Rhizobial infection in Adesmia bicolor (Fabaceae) roots.
Bianco, Luciana
2014-09-01
The native legume Adesmia bicolor shows nitrogen fixation efficiency via symbiosis with soil rhizobia. The infection mechanism by means of which rhizobia infect their roots has not been fully elucidated to date. Therefore, the purpose of the present study was to identify the infection mechanism in Adesmia bicolor roots. To this end, inoculated roots were processed following conventional methods as part of our root anatomy study, and the shape and distribution of root nodules were analyzed as well. Neither root hairs nor infection threads were observed in the root system, whereas infection sites-later forming nodules-were observed in the longitudinal sections. Nodules were found to form between the main root and the lateral roots. It can be concluded that in Adesmia bicolor, a bacterial crack entry infection mechanism prevails and that such mechanism could be an adaptive strategy of this species which is typical of arid environments.
Establishment of Vespa bicolor in Taiwan (Hymenoptera: Vespidae)
Sung, I-Hsin; Lu, Sheng-Shan; Chao, Jung-Tai; Yeh, Wen-Chi; Lee, Wei-Jie
2014-01-01
Abstract The establishment of a hornet, Vespa bicolor F., in Taiwan was confirmed based on successful field collection of adults of both sexes and two subterranean colonies. Information on nesting habitat, nest measurement, and colony composition of this species are provided in this article. V. bicolor is the ninth hornet species ever recorded from Taiwan. Possible pathway for the introduction of this alien species is also discussed. PMID:25434034
Possible evidence for transport of an iron cyanide complex by plants
International Nuclear Information System (INIS)
Samiotakis, M.; Ebbs, S.D.
2004-01-01
Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to 15 N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots (δ 15 N%o=1000-1500) and shoots (δ 15 N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater 15 N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane
Possible evidence for transport of an iron cyanide complex by plants
Energy Technology Data Exchange (ETDEWEB)
Samiotakis, M.; Ebbs, S.D
2004-01-01
Barley (Hordeum vulgare L.), oat (Avena sativa L.), and wild cane (Sorghum bicolor L.), were exposed to {sup 15}N-labeled ferrocyanide to determine whether these plant species can transport this iron cyanide complex. Plants were treated with ferrocyanide in a nutrient solution that simulated iron cyanide contaminated groundwater and soil solutions. This nutrient solution has been shown to maintain ferrocyanide speciation with minimal dissociation to free cyanide. Following treatment, all three plants showed dramatic enrichments in roots ({delta} {sup 15}N%o=1000-1500) and shoots ({delta} {sup 15}N%o=500). Barley and oat showed enrichment primarily in roots while wild cane showed a near equal enrichment in root and shoot tissues. Nitrogen-deficient barley plants treated with ferrocyanide showed a significantly greater {sup 15}N enrichment as compared to nitrogen-sufficient plants. While the results are suggestive of ferrocyanide transport by these plant species, additional study will be required to verify these results. - Results suggest ferrocyanide transport by barley, oat and wild cane.
Foliar flavonoids from Tanacetum vulgare var. boreale and their geographical variation.
Uehara, Ayumi; Akiyama, Shinobu; Iwashina, Tsukasa
2015-03-01
Foliar flavonoids of Tanacetum vulgare var. boreale were isolated. Eight flavonoid glycosides, 7-O-glucosides of apigenin, luteolin, scutellarein and 6- hydroxyluteolin, and 7-O-glucuronides of apigenin, luteolin, chrysoeriol and eriodictyol were identified. Moreover, eight flavonoid aglycones, apigenin, luteolin, hispidulin, nepetin, eupatilin, jaceosidin, pectolinarigenin and axillarin were also isolated and identified. The flavonoid composition of two varieties of T. vulgare, i.e. var. boreale and var. vulgare, were compared. All samples of var. boreale and one sample of var. vulgare had the same flavonoid pattern, and could be distinguished from almost all the samples of var. vulgare. Thus, the occurrence of chemotypes, which are characterized by either the presence or absence of scutellarein 7-O-glucoside, eriodictyol 7-O-glucuronide and pectolinarigenin was shown in T. vulgare sensu lato.
phenotypic diversity of tunisian durum wheat landraces abstract
African Journals Online (AJOL)
Administrator
Tunisia is considered as a diversification centre of durum wheat (Triticum durum Desf.) and barely ( ... diversification (Devra, 1999), especially within the primary and ..... Geographical patterns of morphological variation in sorghum (Sorghum bicolor (L.) Moench) germplasm from Ethiopia and Eritrea: qualitative characters.
Registration of Plant Varieties
African Journals Online (AJOL)
Registration of two Sorghum Hybrids, ESH-1 and ESH-2. Sorghum (Sorghum bicolor (L) Moench) is an indigenous crop to Ethiopia and staple for many millions of people in most parts of Africa. The crop is one of the most important cereals grown in arid and semi arid areas where others often fail to survive. In Eastern Africa ...
Directory of Open Access Journals (Sweden)
Dea Alecia Martins netto
1999-08-01
Full Text Available Diversas amostras de sementes de sorgo (Sorghum bicolor L. Moench., cultivar BR 303, com diferentes níveis de danos mecânicos, foram analisadas com o objetivo de determinar o efeito imediato de danos mecânicos sobre a qualidade fisiológica. Os percentuais de dano mecânico foram determinados pelo teste de verde rápido, e a qualidade fisiológica das sementes pelos testes de germinação, envelhecimento acelerado, teste de frio, índice de velocidade de emergência e população inicial de plântulas. O experimento foi conduzido no Laboratório de Análises de Sementes da Embrapa-Centro Nacional de Pesquisa de Milho e Sorgo (CNPMS, em Sete Lagoas, MG. Através da análise de regressão, verificou-se que houve redução significativa da germinação e do vigor quando as sementes apresentaram até 5% de dano; de 5% a 15% de dano a redução na qualidade fisiológica não foi significativa. Acima de 15% até 23% de dano a germinação e o vigor sofreram um decréscimo de 22,5%, em comparação com o controle. O efeito prejudicial imediato dos danos mecânicos sobre a qualidade fisiológica das sementes de sorgo pôde ser detectada pelos testes aplicados.Twelve seed lots of sorghum (Sorghum bicolor L. Moench., cultivar BR 303, with different degrees of mechanical damage were evaluated on germination and vigor test. The data of mechanical damage based upon fast green test, accelerating aging, cold test, speed of emergence and stand establishment. The experiment was conducted in Seed Laboratory Analysis of the Embrapa-Centro Nacional de Pesquisa de Milho e Sorgo (CNPMS, in Sete Lagoas, MG, Brazil. There were significantly decrease through regressions analysis on germination and vigor tests, when the seeds were damaged up to 5%; from 5% to 15% of damage the decrease was not significant. From 15% to 23% of damage, the germination and vigor declined 22.5% compared to the control. The immediate hazard effect of mechanical damages on physiological
Foeniculum vulgare Mill (Umbelliferae) Attenuates Stress and ...
African Journals Online (AJOL)
Purpose: To evaluate the anti-stress and memory-enhancing properties of F. vulgare extract in experimental rats. Methods: F. vulgare plant extract was obtained using Soxhlet extraction technique. The extract, at doses of 50, 100 and 200 mg/kg body weight, was administered orally with an orogastric tube. Urinary levels of ...
a survey of sorghum downy mildew in sorghum in the sudano
African Journals Online (AJOL)
DR. AMINU
Sahel savanna AEZs respectively) indicated that the disease was present only at the seedling stage ... In the southern guinea ... northern Nigeria, sorghum downy mildew in sorghum .... There was a significant (P>0.05) difference in SDM.
Effect of Nutrient Supply on Chemical and Energetic Characteristics of Fiber Sorghum Biomass
International Nuclear Information System (INIS)
Ciria, P.; Gonzalez, E.; Negro, M. J.; Solano, M. L.
1998-01-01
The main objective of the present work, is to study the effect of the addition of different nutrients and irrigation doses on the chemical and energetic characteristics of the Sorghum bicolor (L.) Moench ssp. bicolor biomass. The effect of compost addition is compared with the mineral fertilisation in two different irrigation doses . The experimental parcel, is located at CIEMAT-CEDER (Soria), at 1000 m above sea level, with a extremely weather and a loam sandy soil texture. The results obtained in the tested conditions show: a) the average biomass productivity was 9.81 d.m./ha, and no significant differences between treatments were observed. b) Mean values of the proximate analysis were 72.6 volatile matter, 6.2% ashes and 21.2 % fixed carbon. The volatile matter increases (1.1 %) and the ashes decreases (1.4 %) for the highest irrigation dose both in plots with no addition and in plots amended with compost. c) The N, S and Cl contents decreases for the highest irrigation dose in the same cases above mentioned. Mean values of the elemental analysis were: 45.0 % C, 6.3 % H, 1.4 % N, 0.15 % S and 0.49 % Cl. d) The average High Heating Value was 18071 kJ/kg d.m. and no significant differences between treatments were observed e) For the highest irrigation doses, a reduction in the K 2 O, P 2 O 5 , Mg and Si content, and a increase in the Al, Fe and Ti in ashes were detected. (Author) 13 refs
Antioxidant potential of impatiens bicolor royle and zizyphus oxyphylla edgew
International Nuclear Information System (INIS)
Qayum, M.; Kaleem, W.A.; Ahmad, S.
2014-01-01
The present investigation has been carried out to evaluate the antioxidant capacity and phenolic composition of Impatiens bicolor Royle and Zizyphus oxyphylla Edgew. The content of phenolic compounds ranged from 15.77 to 27.61 mg catechin equivalents/g of different parts of Zizyphus oxyphylla Edgew., extract and 17.74 mg catechin equivalents/g for Impatiens bicolor Royle extract. The HPLC-ESI-MS/MS analysis of phenolic compounds showed that ferulic acid-hexosides was the only compound detected in I. bicolor, while Z. oxyphylla fruit, stem and leaves exhibited several compounds. Total antioxidant capacity values measured by TEAC assay were 46.32 +- 0.89, 42.56 +- 1.65, 41.34 +- 0.20, and 48.58 +- 0.21 micro mol/g of extract, while those measured by FRAP assay were 102.40 +- 0.18, 207.54 +- 7.91, 254.89 +- 4.20, and 233.00 +- 9.07 micro mol Fe2+/g, for I. bicolor and Z. oxyphylla fruit, leaves and stem, respectively. TRAP values were 43.26 +- 1.27, 112.23 +- 0.00, 102.83 +- 1.66, and 117.37 +- 3.70 micro mol/g of extract for I. bicolor and Z. oxyphylla fruit, leaves and stem respectively. The results indicate that these two plants may be a potential source of antioxidants. (author)
Marrubium vulgare L.: A review on phytochemical and pharmacological aspects
Directory of Open Access Journals (Sweden)
Santram Lodhi
2017-12-01
Full Text Available Marrubium vulgare L. (family: Lamiaceae, also known as white horehound, is widely used as herbal remedy for chronic coughs and colds. It is used in various disorders related to skin, liver, gastric, heart and immune system. This review abridges phytochemical, pharmacological studies and medicinal uses of M. vulgare and provides scientific proof for various ethnobotanical claims in order to identify gaps, which will give impulsion for novel research on M. vulgare based herbal medicines. This review summarizes selected scientific evidence on phytochemistry and pharmacological properties of M. vulgare over the past 48 years (1968 to 2016. The work reported on M. vulgare was reviewed from various sources like books, internet source i.e. google search engine, pubmed, sciencedirect and chemical abstract. The exhaustive literature was studied and critical analysis was done according to their phytochemical and pharmacological properties. Phytochemical investigations on different parts of M. vulgare have been reported the presence of flavonoids, steroids, terpenoids, tannins, saponins and volatile oils (0.05%. The aerial parts contain marrubiin, together with ursolic acid and choline. Pharmacological activities like, anti-nociceptive, anti-spasmodic, anti-hypertensive, anti-diabetic, gastroprotective, anti-inflammatory, anti-microbial, anti-cancer, antioxidant, and anti-hepatotoxic activity have been reported. M. vulgare has therapeutic potential in the treatment of inflammatory conditions, liver disorders, pain, cardiovascular, gastric and diabetic conditions. Aerial parts of M. vulgare is a good source of labdane type diterpene especially marrubiin which is present in high concentrations. However, further scientific studies are needed to explore clinical efficacy, toxicity and to explore the therapeutic effect of major secondary metabolites like diterpenes, phenylpropanoid and phenylethanoid glycosides of M. vulgare. [J Complement Med Res 2017; 6
Czech Academy of Sciences Publication Activity Database
Moravec, František; Sheeba, S.; Kumar, A. B.
2013-01-01
Roč. 58, č. 4 (2013), s. 496-503 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Heliconema * Procamallanus * Spirocamallanus * freshwater eel * Anguilla bicolor bicolor * Kerala * India Subject RIV: EA - Cell Biology Impact factor: 0.965, year: 2013
International Nuclear Information System (INIS)
Kurdali, F.; Al-Shamma'a, M.
2006-08-01
A pot experiment was conducted throughout two successive years to determine the impact of adding four rates of nitrogen (0, 60, 120 and 180 kg N/ha) in the form of Leucaena leucocephala (lam.) de Wit green manure as affected by different time (T0, T15 and T30) of application (just before sowing, 15 and 30 days before sowing, respectively) on the performance of sorghum (Sorghum bicolor L.) using the indirect N-15 isotopic dilution technique. Results showed that leucaena leaves, used as a green manure, significantly increased dry matter production and N yield of sorghum. The effect was more pronounced in panicles than shoots. In the first year, N recoveries in sorghum of the total N contained in leucaena green manure ranged between 17-24% in T0, 14-24% in T15 and 15-19% in T30. The highest N recovery value was obtained in lowest rate of n treatment (N 60 ). Moreover, soil incorporated with leucaena green manure one month before planting enhanced both soil and mineral N fertilizer in sorghum plants. In the second year, total N uptake in sorghum (eg., panicles and the entire plant) increased with increasing amounts of N added as a leucaena green manure. N recoveries in sorghum ranged between 26-47% in T0, about 24% in T15 and 23-325 in T30 of the total N contained in leucaena green manure (LGM). As shown in the first year, the highest value of N recovery was obtained in lowest rate of N treatment. The beneficial effects of leucaena green manure on dry matter and N yield in sorghum was attributed not only to the additional N availability to the plant, but also to effects on the enhancement of soil N uptake, particularly when the incorporation was made before a sufficient time from sowing. The beneficial effect of green manuring with leucaena leaves at T15 and T30 was mainly resulted from enhancement of N uptake from this added material, as well as from soil and fertilizer N; whereas, it was only attributed to N uptake from green manure in the T0 treatment. Incorporation
International Nuclear Information System (INIS)
Kurdali, F.; Al-Shamma'a, M.
2007-01-01
A pot experiment was conducted throughout two successive years to determine the impact of adding four rates of nitrogen (0, 60, 120 and 180 kg N/ha) in the form of Leucaena leucocephala (lam.) de Wit green manure as affected by different time (T0, T15 and T30) of application (just before sowing, 15 and 30 days before sowing, respectively) on the performance of sorghum (Sorghum bicolor L.) using the indirect N-15 isotopic dilution technique. Results showed that leucaena leaves, used as a green manure, significantly increased dry matter production and N yield of sorghum. The effect was more pronounced in panicles than shoots. In the first year, N recoveries in sorghum of the total N contained in leucaena green manure ranged between 17-24% in T0, 14-24% in T15 and 15-19% in T30. The highest N recovery value was obtained in lowest rate of n treatment (N60). Moreover, soil incorporated with leucaena green manure one month before planting enhanced both soil and mineral N fertilizer in sorghum plants. In the second year, total N uptake in sorghum (eg., panicles and the entire plant) increased with increasing amounts of N added as a leucaena green manure. N recoveries in sorghum ranged between 26-47% in T0, about 24% in T15 and 23-325 in T30 of the total N contained in leucaena green manure (LGM). As shown in the first year, the highest value of N recovery was obtained in lowest rate of N treatment. The beneficial effects of leucaena green manure on dry matter and N yield in sorghum was attributed not only to the additional N availability to the plant, but also to effects on the enhancement of soil N uptake, particularly when the incorporation was made before a sufficient time from sowing. The beneficial effect of green manuring with leucaena leaves at T15 and T30 was mainly resulted from enhancement of N uptake from this added material, as well as from soil and fertilizer N. Whereas, it was only attributed to N uptake from green manure in the T0 treatment. Incorporation
[A study of Boletus bicolor from different areas using Fourier transform infrared spectrometry].
Zhou, Zai-Jin; Liu, Gang; Ren, Xian-Pei
2010-04-01
It is hard to differentiate the same species of wild growing mushrooms from different areas by macromorphological features. In this paper, Fourier transform infrared (FTIR) spectroscopy combined with principal component analysis was used to identify 58 samples of boletus bicolor from five different areas. Based on the fingerprint infrared spectrum of boletus bicolor samples, principal component analysis was conducted on 58 boletus bicolor spectra in the range of 1 350-750 cm(-1) using the statistical software SPSS 13.0. According to the result, the accumulated contributing ratio of the first three principal components accounts for 88.87%. They included almost all the information of samples. The two-dimensional projection plot using first and second principal component is a satisfactory clustering effect for the classification and discrimination of boletus bicolor. All boletus bicolor samples were divided into five groups with a classification accuracy of 98.3%. The study demonstrated that wild growing boletus bicolor at species level from different areas can be identified by FTIR spectra combined with principal components analysis.
Sorghum allelopathy--from ecosystem to molecule.
Weston, Leslie A; Alsaadawi, Ibrahim S; Baerson, Scott R
2013-02-01
Sorghum allelopathy has been reported in a series of field experiments following sorghum establishment. In recent years, sorghum phytotoxicity and allelopathic interference also have been well-described in greenhouse and laboratory settings. Observations of allelopathy have occurred in diverse locations and with various sorghum plant parts. Phytotoxicity has been reported when sorghum was incorporated into the soil as a green manure, when residues remained on the soil surface in reduced tillage settings, or when sorghum was cultivated as a crop in managed fields. Allelochemicals present in sorghum tissues have varied with plant part, age, and cultivar evaluated. A diverse group of sorghum allelochemicals, including numerous phenolics, a cyanogenic glycoside (dhurrin), and a hydrophobic p-benzoquinone (sorgoleone) have been isolated and identified in recent years from sorghum shoots, roots, and root exudates, as our capacity to analyze and identify complex secondary products in trace quantities in the plant and in the soil rhizosphere has improved. These allelochemicals, particularly sorgoleone, have been widely investigated in terms of their mode(s) of action, specific activity and selectivity, release into the rhizosphere, and uptake and translocation into sensitive indicator species. Both genetics and environment have been shown to influence sorgoleone production and expression of genes involved in sorgoleone biosynthesis. In the soil rhizosphere, sorgoleone is released continuously by living root hairs where it accumulates in significant concentrations around its roots. Further experimentation designed to study the regulation of sorgoleone production by living sorghum root hairs may result in increased capacity to utilize sorghum cover crops more effectively for suppression of germinating weed seedlings, in a manner similar to that of soil-applied preemergent herbicides like trifluralin.
Sorghum [Sorghum bicolor (L.) Moench] has been shown to contain the cyanogenic glycoside dhurrin, which is responsible for the disorder known as prussic acid poisoning in livestock. The current standard method for estimating HCN uses spectrophotometery to measure the aglycone of the dhurrin, p-hydro...
Indian Academy of Sciences (India)
2Present address: Melkassa Agricultural Research Center, P. O. Box 1085, Adama, Ethiopia. 3Department of ... Journal of Genetics, Vol. 92, No. 1, April 2013 ..... Bioscience 30,. 814–818. .... International Ltd., Hernel Hempstead, UK. Wilkinson ...
Sorghums: viable biomass candidates
Energy Technology Data Exchange (ETDEWEB)
McClure, T A; Arthur, M F; Kresovich, S; Scantland, D A
1980-01-01
Agronomic studies conducted at Battelle's Columbus Division to evaluate biomass and sugar yields of sweet sorghum are described and the major findings are summarized. Development opportunities for using sorghum cultivars as a large-scale energy crop are discussed. With presently available cultivars, sweet sorghum should produce 3500 to 4000 liters ethanol per hectare from the fermentable sugars alone. Conversion of the stalk fibers into alcohol could increase production by another 1600 to 1900 liters per hectare with existing cultivars. These yields are approximately 30 to 40% greater per hectare than would be obtained from above average yields of grain and stalk fiber with corn. There is reason to believe, that with hybrid sweet sorghum, these yields could be further increased by as much as 30%. Diminishing land availability for agricultural crops necessitates that maximum yields be obtained. Over the next decade, imaginative technological innovations in sorghum harvesting, processing, and crop preservation, coupled with plant breeding research should help this crop realize its full potential as a renewable resource for energy production.
International Nuclear Information System (INIS)
Kurdali, F.
2007-06-01
A field experiment on dhaincha C 3 (Sesbania aculeata Pers), sunflower C 3 (Helianthus annuus L.) and sorghum C 4 (Sorghum bicolor L.) plants grown in monocropping and intercropping systems was conducted to evaluate seed yield, dry matter production, total N yield, land equivalent ratio (LER), intraspecific competition for soil N uptake, water use efficiency (WUE) and N 2 -fixation using the 15 N natural abundance technique (δ 15 N ). Moreover, carbon isotope discrimination (Δ13 C ) was determined to assess factors responsible for crop performance variability in the different cropping systems. Intercropping of sesbania/sorghum showed greater efficiency over monocropping in producing dry matter, during the entire growth period, as indicated by the LERs (>1); whereas, the efficiency of producing dry matter in the sesbania /sunflower intercropping was similar to that in the monocropping system (LER=1). Moreover, sorghum plants (C 4 ) was more competitive than sesbania (C 3 ) for soil N uptake; whereas, sesbania seemed to be more competitive than its associated sunflower (C 3 ). N uptake in the mixed stand of sesbania/sorghum was improved due to the increase in soil N uptake by the component sorghum and the higher root nodule activity of component sesbania without affecting the amount of N 2 fixed. In both cropping systems, sesbania plants fixed almost the same amount of N 2 (an average of 105 kg N/ha) although the number of rows in the mixed stand was 2/3 of that in the pure stand. This gives an advantage of the intercropping over sole cropping system with regards to N 2 -fixation. 13 C discrimination in plant materials was found to be affected by plant species and the cropping system. Factors affected Δ13 C in plants grown in the mixed stand relative to solely grown crops are discussed.(author)
Directory of Open Access Journals (Sweden)
Nurrul Shaqinah Nasruddin
2014-01-01
Full Text Available This study was conducted to record the histological features of the gastrointestinal tract of wild Indonesian shortfin eel, Anguilla bicolor bicolor (McClelland, 1844, captured in Peninsular Malaysia. The gastrointestinal tract was segmented into the oesophagus, stomach, and intestine. Then, the oesophagus was divided into five (first to fifth, the stomach into two (cardiac and pyloric, and the intestine into four segments (anterior, intermediate, posterior, and rectum for histological examinations. The stomach had significantly taller villi and thicker inner circular muscles compared to the intestine and oesophagus. The lamina propria was thickest in stomach, significantly when compared with oesophagus, but not with the intestine. However, the intestine showed significantly thicker outer longitudinal muscle while gastric glands were observed only in the stomach. The histological features were closely associated with the functions of the different segments of the gastrointestinal tract. In conclusion, the histological features of the gastrointestinal tract of A. b. bicolor are consistent with the feeding habit of a carnivorous fish.
Nasruddin, Nurrul Shaqinah; Azmai, Mohammad Noor Amal; Ismail, Ahmad; Saad, Mohd Zamri; Daud, Hassan Mohd; Zulkifli, Syaizwan Zahmir
2014-01-01
This study was conducted to record the histological features of the gastrointestinal tract of wild Indonesian shortfin eel, Anguilla bicolor bicolor (McClelland, 1844), captured in Peninsular Malaysia. The gastrointestinal tract was segmented into the oesophagus, stomach, and intestine. Then, the oesophagus was divided into five (first to fifth), the stomach into two (cardiac and pyloric), and the intestine into four segments (anterior, intermediate, posterior, and rectum) for histological examinations. The stomach had significantly taller villi and thicker inner circular muscles compared to the intestine and oesophagus. The lamina propria was thickest in stomach, significantly when compared with oesophagus, but not with the intestine. However, the intestine showed significantly thicker outer longitudinal muscle while gastric glands were observed only in the stomach. The histological features were closely associated with the functions of the different segments of the gastrointestinal tract. In conclusion, the histological features of the gastrointestinal tract of A. b. bicolor are consistent with the feeding habit of a carnivorous fish.
Evaluation of yield and forage quality in main and ratoon crops of different sorghum lines
Directory of Open Access Journals (Sweden)
K.S. Vinutha
2017-01-01
Full Text Available Improving the yield and quality of sorghum (Sorghum bicolor forage for livestock feeding is a major breeding objective, because of sorghum’s inherently high biomass accumulation, high productivity per unit water utilized and its ability to produce a ratoon crop after harvesting of the plant crop. Newly bred sorghum lines, including 36 lines falling in 5 different categories, i.e. 12 experimental dual-purpose lines, 6 germplasm accessions from the ICRISAT collection, 11 commercial varieties and hybrids, 6 forage varieties and 1 bmr mutant line, were evaluated in terms of fodder yield, quality and ratooning ability. The main crop produced more dry biomass (P<0.05 at 80 days after planting (mean 22.87 t DM/ha; range 17.32‒33.82 t DM/ha than the ratoon crop (mean 8.47 t DM/ha; range 3.2‒17.42 t DM/ha after a further 80 days of growth. Mean nitrogen concentration in forage did not differ greatly between main and ratoon crops (2.56 vs. 2.40%, respectively but there was wide variation between lines (2.06‒2.89%. The line N 610 recorded highest N percentage of 2.89%, followed by SSG 59 3 (2.86% and SX 17 (2.81%. Highest acid detergent fiber % was recorded by ICSV 12008 (42.1%, closely followed by CO 31 and IS 34638 (40.0%. The least acid detergent lignin % was observed in MLSH-296 Gold (3.59%, ICSV 700 (3.75% and ICSSH 28 (3.83%. Metabolizable energy concentration was highest in N 610, Phule Yashodha and SX 17 (mean 8.34 MJ/kg DM, while in vitro organic matter digestibility ranged from 52.5 to 62.6%. The main crop contained much higher mean concentrations of the cyanogenic glycoside, dhurrin, than the ratoon (639 vs. 233 ppm, respectively with ranges of 38 to 2,298 ppm and 7 to 767 ppm, respectively. There was no significant correlation between dhurrin concentration and dry biomass yield so breeding and selection for low dhurrin concentrations should not jeopardize yields. Hence, breeding for sorghum can target simultaneously both quality and
Row spacing effects on light extinction coefficients of corn, sorghum, soybean, and sunflower
International Nuclear Information System (INIS)
Flénet, F.; Kiniry, J.R.; Board, J.E.; Westgate, M.E.; Reicosky, D.C.
1996-01-01
In many crop models, light intercepted by a canopy (IPAR) is calculated from a Beer's Law equation: IPAR = PAR x [1- exp(-k x LAI)], where k is the extinction coefficient, PAR the photosynthetically active radiation, and LAI the leaf area index. The first objective of this study was to investigate the effect of row spacing on k for corn (Zea mays L.), sorghum [Sorghum bicolor (L.) Moench], soybean [Glycine max (L.) Merr.], and sunflower (Helianthus annuus L.) to provide information for modeling. Data from literature and from an experiment conducted at Temple, TX, were evaluated. The second objective was to investigate effects of time of day and stage of crop development on k for different row spacings. Seeds of all four species were sown in rows 0.35, 0.66, or 1.00 m apart. Measurements of canopy light interception were taken near solar noon on two dates before anthesis. At anthesis, extinction coefficients were determined at 0845, 1015, and 1145 h (solar time). The extinction coefficient showed a linear decrease as row spacing increased. For each crop, the effect of row spacing on k was described by one linear regression for most data. Stage of crop development and stage of development x row spacing interaction did not significantly affect k during the period of measurements. The effect of time of day was significant for all four crops, and the time of day x row spacing interaction was significant for soybean and sunflower. Thus, modeling light interception for different row spacings should account for these effects
Gohole, L.S.; Overholt, W.A.; Khan, Z.R.; Pickett, J.A.; Vet, L.E.M.
2003-01-01
Olfactory responses of the cereal stemborer parasitoid Cotesia sesamiae to volatiles emitted by gramineous host and nonhost plants of the stemborers were studied in a Y-tube olfactometer. The host plants were maize (Zea mays) and sorghum (Sorghum bicolor), while the nonhost plant was molasses grass
Gohole, L.S.; Overholt, W.A.; Khan, Z.U.; Pickett, J.A.; Vet, L.E.M.
2003-01-01
Olfactory responses of the cereal stemborer parasitoid Cotesia sesamiae to volatiles emitted by gramineous host and nonhost plants of the stemborers were studied in a Y-tube olfactometer. The host plants were maize (Zea mays) and sorghum ( Sorghum bicolor), while the nonhost plant was molasses grass
Ouédraogo, E.; Brussaard, L.; Stroosnijder, L.
2007-01-01
A field experiment was conducted at Kaibo in southern Burkina Faso on an Eutric Cambisol during the 2000 rainy season to assess the interaction of organic amendment quality and soil fauna, affecting soil organic carbon and sorghum ( Sorghum bicolor L. Moench) performance. Plots were treated with the
Directory of Open Access Journals (Sweden)
Demóstenes Marcos Pedrosa de Azevedo
1999-03-01
Full Text Available Crop rotation and cover crop can be important means for enhancing crop yield in rainfed areas such as the lower Coastal Bend Region of Texas, USA. A trial was conducted in 1995 as part of a long-term cropping experiment (7 years to investigate the effect of oat (Avena sativa L. cover and rotation on soil water storage and yield of sorghum (Sorghum bicolor L.. The trial design was a RCB in a split-plot arrangement with four replicates. Rotation sequences were the main plots and oat cover crop the subplots. Cover crop reduced sorghum grain yield. This effect was attributed to a reduced concentration of available soil N and less soil water storage under this treatment. By delaying cover termination, the residue with a high C/N acted as an N sink through competition and/or immobilization instead of an N source to sorghum plants. Crop rotation had a significantly positive effect on sorghum yield and this effect was attributed to a significantly larger amount of N concentration under these rotation sequences.Rotação de cultura e cultura de cobertura constituem importantes meios para melhoria do rendimento de culturas em áreas de sequeiro como a região "Coastal Bend" do Estado do Texas. Um ensaio foi conduzido em 1995, como parte de um experimento de longa duração (7 anos, com o objetivo de investigar o efeito da aveia (Avena sativa L. como cultura de cobertura, e da rotação de cultura, no armazenamento da água do solo e no rendimento do sorgo (Sorghum bicolor L.. O delineamento experimental adotado foi o de blocos ao acaso, em parcelas subdivididas, com quatro repetições. As rotações foram alocadas nas parcelas, e a cultura de cobertura, nas subparcelas. A cultura de cobertura reduziu o rendimento do sorgo. Este efeito foi atribuído à reduzida concentração de N disponível do solo. Por atraso no extermínio e incorporação da aveia, seu resíduo, com elevada relação C/N, atuou como dreno, pela imobilização, em lugar de ser fonte
Genetic diversity in barley landraces (Hordeum vulgare L. subsp.
Indian Academy of Sciences (India)
Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...
Finger millet: An alternative crop for the Southern High Plains
In the Southern High Plains, dairies are expanding to take advantage of favorable climatic conditions. Currently, corn (Zea mays L.) and forage sorghum [Sorghum bicolor (L.) Moench] are the two major crops grown in the region to meet silage demands for the expanding dairy industry, but they have rel...
Directory of Open Access Journals (Sweden)
RB Silva
Full Text Available Eriopis connexa (Germar (Coleoptera: Coccinellidae occurs in several countries of South America and its mass rearing is important for biological control programmes. This work evaluated biological aspects of E. connexa larva fed on eggs of Anagasta kuehniella (Zeller (Lepidoptera: Pyralidae and Spodoptera frugiperda (J. E. Smith (Lepidoptera: Noctuidae frozen for one day, fresh eggs of Diatraea saccharalis (Fabricius (Lepidoptera: Pyralidae, S. frugiperda newly-hatched caterpillars, nymphs of Rhopalosiphum maidis (Fitch and Schizaphis graminum (Rondani (Hemiptera: Aphididae. Duration of larva, pupa and larva to adult stages differed among prey offered, whereas the prepupa stage was similar. Larva, pupa, prepupa and larva to adult viabilities were equal or major of 87.5% in all prey, except for larva fed on newly-hatched larvae of S. frugiperda. Eriopis connexa has good adaptation to different prey corroborating its polyphagous feeding habit, which evidences the potential of this natural enemy for controlling corn and sorghum pests.
Review of Sorghum Production Practices: Applications for Bioenergy
Energy Technology Data Exchange (ETDEWEB)
Turhollow Jr, Anthony F [ORNL; Webb, Erin [ORNL; Downing, Mark [ORNL
2010-06-01
Sorghum has great potential as an annual energy crop. While primarily grown for its grain, sorghum can also be grown for animal feed and sugar. Sorghum is morphologically diverse, with grain sorghum being of relatively short stature and grown for grain, while forage and sweet sorghums are tall and grown primarily for their biomass. Under water-limited conditions sorghum is reliably more productive than corn. While a relatively minor crop in the United States (about 2% of planted cropland), sorghum is important in Africa and parts of Asia. While sorghum is a relatively efficient user of water, it biomass potential is limited by available moisture. The following exhaustive literature review of sorghum production practices was developed by researchers at Oak Ridge National Laboratory to document the current state of knowledge regarding sorghum production and, based on this, suggest areas of research needed to develop sorghum as a commercial bioenergy feedstock. This work began as part of the China Biofuels Project sponsored by the DOE Energy Efficiency and Renewable Energy Program to communicate technical information regarding bioenergy feedstocks to government and industry partners in China, but will be utilized in a variety of programs in which evaluation of sorghum for bioenergy is needed. This report can also be used as a basis for data (yield, water use, etc.) for US and international bioenergy feedstock supply modeling efforts.
Directory of Open Access Journals (Sweden)
Hiroyuki Kawahigashi
2016-05-01
Full Text Available Upon wounding or pathogen invasion, leaves of sorghum [Sorghum bicolor (L. Moench] plants with the P gene turn purple, whereas leaves with the recessive allele turn brown or tan. This purple phenotype is determined by the production of two 3-deoxyanthocyanidins, apigeninidin and luteolinidin, which are not produced by the tan-phenotype plants. Using map-based cloning in progeny from a cross between purple Nakei-MS3B (PP and tan Greenleaf (pp cultivars, we isolated this gene, which was located in a 27-kb genomic region around the 58.1 Mb position on chromosome 6. Four candidate genes identified in this region were similar to the maize leucoanthocyanidin reductase gene. None of them was expressed before wounding, and only the Sb06g029550 gene was induced in both cultivars after wounding. The Sb06g029550 protein was detected in Nakei-MS3B, but only slightly in Greenleaf, in which it may be unstable because of a Cys252Tyr substitution. A recombinant Sb06g029550 protein had a specific flavanone 4-reductase activity, and converted flavanones (naringenin or eriodictyol to flavan-4-ols (apiforol or luteoforol in vitro. Our data indicate that the Sb06g029550 gene is involved in the 3-deoxyanthocyanidin synthesis pathway.
Directory of Open Access Journals (Sweden)
Stefano Grego
2011-02-01
Full Text Available The effects of different agricultural systems on soil organic carbon content and CO2 emission are investigated in this work. In a long-term experiment a conventional system, characterized by traditional agricultural practices (as deep tillage and chemical inputs was compared with an organic one, including green manure and organic fertilizers. Both systems have a three-year crop rotation including pea – durum wheat – tomato; the organic system is implemented with the introduction of common vetch (Vicia sativa L. and sorghum (Sorghum vulgare bicolor as cover crops. In the year 2006 (5 years after the experimentation beginning was determined the soil C content and was measured the CO2 emissions from soil. The first results showed a trend of CO2 production higher in organic soils in comparison with conventional one. Among the two compared cropping systems the higher differences of CO2 emission were observed in tomato soil respect to the durum wheat and pea soils, probably due to the vetch green manuring before the tomato transplanting. These results are in agreement with the total organic carbon content and water soluble carbon (WSC, which showed the highest values in organic soil. The first observations suggest a higher biological activity and CO2 emission in organic soil than conventional one, likely due to a higher total carbon soil content.
Transformation of Food Habits through Promotion of Under-Utilized Cereals in High Hills of Nepal
International Nuclear Information System (INIS)
Koirala, Pramod; Bajracharya, Keshari; Chalise, Ananda
2014-01-01
Full text: Malnutrition is a persistent social setback in Nepal. High hills in Nepal is considered as the headquarter of the malnourished people as it holds almost the twice of stunted children than the national average. Food insecurity is the major causes of malnutrition as there is low agriculture production followed by difficult terrain and poor road connectivity. Nevertheless, there are several types of locally produced cereals that are under-utilized because of the traditional food-habit of eating rice. In order to bring a change in local food habit by the high-hill residents, attempts were made in processing of under-utilized cereals. Six different cereals were processed into super flour, porridge, cookies, flakes and traditional sweets for which locally accessible home level processing technology was used. Sorghum (Sorghum bicolor), Foxtail Millet (Setaria italica), Porso Millet (Panicum miliaceum), Buck Wheat (Fagopyrum esculentum), Amaranth (Amaranth caudatus) and Naked Barley (Hordeum vulgare) were processed into diverse products that suit to the local taste. The processing steps were standardized and laboratory analysis was carried out. It was then distributed to local development partners through trainers' training. Now, local people have started processing and consuming these products. It is anticipated that processed products promotion helps in solving food insecurity to some extent, and contributes in reducing malnutrition for the children below two. (author)
Optimization of callus induction and plant regeneration from ...
African Journals Online (AJOL)
An efficient regeneration system was developed using germinating seeds of two cultivars of sweet sorghum, Sorghum bicolor 'Yuantian No.1' and 'M81E', as explants. We tested different media supplements effects on callus induction. The effects of combinations of 2,4-D, KT, sucrose, agar and proline at different ...
Carvalho, Geraldo; Schaffert, Robert Eugene; Malosetti Zunin, Marcos; Eeuwijk, van Fred
2016-01-01
Aluminum (Al) toxicity damages plant roots and limits crop production on acid soils, which comprise up to 50% of the world's arable lands. A major Al tolerance locus on chromosome 3, AltSB, controls aluminum tolerance in sorghum [Sorghum bicolor (L.) Moench] via SbMATE, an Al-activated plasma
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Estimation of in situ mating systems in wild sorghum (Sorghum bicolor (L.) Moench) in .... is one of the novel chromosome regions influencing dough-mixing strength. ... Validation of PPP1R12B as a candidate gene for childhood asthma in Russians ... Genomewide analysis of the chitinase gene family in Populus trichocarpa.
Oliver, A L; Grant, R J; Pedersen, J F; O'Rear, J
2004-03-01
Total mixed rations containing conventional forage sorghum, brown midrib (bmr)-6 forage sorghum, bmr-18 forage sorghum, or corn silage were fed to Holstein dairy cows to determine the effect on lactation, ruminal fermentation, and total tract nutrient digestion. Sixteen multiparous cows (4 ruminally fistulated; 124 d in milk) were assigned to 1 of 4 diets in a replicated Latin square design with 4-wk periods (21-d adaptation and 7 d of collection). Diets consisted of 40% test silage, 10% alfalfa silage, and 50% concentrate mix (dry basis). Acid detergent lignin concentration was reduced by 21 and 13%, respectively, for the bmr-6 and bmr-18 sorghum silages when compared with the conventional sorghum. Dry matter intake was not affected by diet. Production of 4% fat-corrected milk was greatest for cows fed bmr-6 (33.7 kg/d) and corn silage (33.3 kg/d), was least for cows fed the conventional sorghum (29.1 kg/d), and was intermediate for cows fed the bmr-18 sorghum (31.2 kg/d), which did not differ from any other diet. Total tract neutral detergent fiber (NDF) digestibility was greatest for the bmr-6 sorghum (54.4%) and corn silage (54.1%) diets and was lower for the conventional (40.8%) and bmr-18 sorghum (47.9%) diets. In situ extent of NDF digestion was greatest for the bmr-6 sorghum (76.4%) and corn silage (79.0%) diets, least for the conventional sorghum diet (70.4%), and intermediate for the bmr-18 sorghum silage diet (73.1%), which was not different from the other diets. Results of this study indicate that the bmr-6 sorghum hybrid outperformed the conventional sorghum hybrid; the bmr-18 sorghum was intermediate between conventional and bmr-6 in most cases. Additionally, the bmr-6 hybrid resulted in lactational performance equivalent to the corn hybrid used in this study. There are important compositional differences among bmr forage sorghum hybrids that need to be characterized to predict animal response accurately.
Fermentation substrate and forage from south Florida cropping sequences
Energy Technology Data Exchange (ETDEWEB)
Kalmbacher, R.S.; Martin, F.G.; Mislevy, P.
1985-01-01
Zea mays (maize), Sorghum bicolor (sorghum), Ipomoea batatas (Sweet potato), Helianthus tuberosus (Jerusalem artichoke) and Manihot esculenta (cassava) were grown as alcohol biomass crops in various sequences in 1981 and 1982, on a sandy, siliceous, hyperthermic, typic Haplaquod soil. Herbage yield and yield of non-fermentable by-products were measured as potential cattle feed. Grain produced from Z. mays followed by S. bicolor averaged 11.4 Mg/ha and was greater (P less than 0.05) than other graincrop sequences. Highest (P less than 0.05) root yields were from I. batatas (5.1 Mg/ha) in 1981 and M. esculenta (5.3 Mg/ha) in 1982. Total nonstructural carbohydrate was greatest for Z. mays/S. bicolor (6.0 Mg/ha) and Z. mays/I. batatas (6.8 Mg/ha) sequences. Crops of I. batatas and M. esculenta were hindered by high rainfall and poorly drained soil. Cropping sequences including Z. mays and S. bicolor produced more cattle feed, and they can be expected to produce more alcohol biomass with fewer cultural problems, on south-central Florida flatwoods soils. 20 references.
Directory of Open Access Journals (Sweden)
Geraldo Carvalho Jr
2016-02-01
Full Text Available Aluminum (Al toxicity damages plant roots and limits crop production on acid soils, which comprise up to 50% of the world’s arable lands. A major Al tolerance locus on chromosome 3, AltSB, controls aluminum tolerance in sorghum [Sorghum bicolor (L. Moench] via SbMATE, an Al-activated plasma membrane transporter that mediates Al exclusion from sensitive regions in the root apex. As is the case with other known Al tolerance genes, SbMATE was cloned based on studies conducted under controlled environmental conditions, in nutrient solution. Therefore, its impact on grain yield on acid soils remains undetermined. To determine the real world impact of SbMATE, multi-trait quantitative trait loci (QTL mapping in hydroponics, and, in the field, revealed a large-effect QTL colocalized with the Al tolerance locus AltSB, where SbMATE lies, conferring a 0.6 ton ha–1 grain yield increase on acid soils. A second QTL for Al tolerance in hydroponics, where the positive allele was also donated by the Al tolerant parent, SC283, was found on chromosome 9, indicating the presence of distinct Al tolerance genes in the sorghum genome, or genes acting in the SbMATE pathway leading to Al-activated citrate release. There was no yield penalty for AltSB, consistent with the highly localized Al regulated SbMATE expression in the root tip, and Al-dependent transport activity. A female effect of 0.5 ton ha–1 independently demonstrated the effectiveness of AltSB in hybrids. Al tolerance conferred by AltSB is thus an indispensable asset for sorghum production and food security on acid soils, many of which are located in developing countries.
Directory of Open Access Journals (Sweden)
Xu Fuyu
2012-09-01
Full Text Available Abstract Background The potential contribution of upstream sequence variation to the unique features of orthologous genes is just beginning to be unraveled. A core subset of stress-associated bZIP transcription factors from rice (Oryza sativa formed ten clusters of orthologous groups (COG with genes from the monocot sorghum (Sorghum bicolor and dicot Arabidopsis (Arabidopsis thaliana. The total cis-regulatory information content of each stress-associated COG was examined by phylogenetic footprinting to reveal ortholog-specific, lineage-specific and species-specific conservation patterns. Results The most apparent pattern observed was the occurrence of spatially conserved ‘core modules’ among the COGs but not among paralogs. These core modules are comprised of various combinations of two to four putative transcription factor binding site (TFBS classes associated with either developmental or stress-related functions. Outside the core modules are specific stress (ABA, oxidative, abiotic, biotic or organ-associated signals, which may be functioning as ‘regulatory fine-tuners’ and further define lineage-specific and species-specific cis-regulatory signatures. Orthologous monocot and dicot promoters have distinct TFBS classes involved in disease and oxidative-regulated expression, while the orthologous rice and sorghum promoters have distinct combinations of root-specific signals, a pattern that is not particularly conserved in Arabidopsis. Conclusions Patterns of cis-regulatory conservation imply that each ortholog has distinct signatures, further suggesting that they are potentially unique in a regulatory context despite the presumed conservation of broad biological function during speciation. Based on the observed patterns of conservation, we postulate that core modules are likely primary determinants of basal developmental programming, which may be integrated with and further elaborated by additional intrinsic or extrinsic signals in
Fermentation characteristics of different purpose sorghum silage
Directory of Open Access Journals (Sweden)
Arthur Behling Neto
2017-08-01
Full Text Available Sorghum stands out among other plants recommended for ensiling due to its forage composition, its resistance to drought, and its planting range. New cultivars of grain and sweet sorghum that can be used for silage production are available, but there is little information regarding their ensiling characteristics. The aim of this study was to evaluate the fermentation characteristics at the ensiling of different purpose sorghum cultivars, at two crop periods. The trial was carried out at the Plant Production Department of the Federal Institute of Education, Science and Technology of Rondônia, Colorado do Oeste campus, Rondônia, Brazil, and chemical analyses were performed at the Laboratory of Animal Nutrition, at the Federal University of Mato Grosso, Cuiabá campus, Mato Grosso, Brazil. The experimental design used was a randomized block, in split-plot design, with four replicates. The plot treatments consisted of six sorghum cultivars grown for different purposes (grain sorghum: BRS 308 and BRS 310; forage sorghum: BR 655 and BRS 610; sweet sorghum: BRS 506 and CMSXS 647. Split-plot treatments consisted of two cropping seasons (first crop and second crop. The grain sorghum cultivar BRS 310 was the only one that had suitable dry matter content for ensiling; however, it was also the only one that did not show ideal water soluble carbohydrate content for ensiling. Nevertheless, all treatments presented pH below than 4.2 and ammonia nitrogen lower than 12% of total N, which indicates that the fermentation inside the silo had proceeded well. For sweet sorghum cultivars, higher ethanol and butyric acid content were observed for the first crop than for the second crop. All evaluated sorghum cultivars can be used for silage production, but the use of sweet sorghum is recommended at the second crop.
M. T. Tinoco; M. R. Martins; J. Cruz-Morais
2007-01-01
O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva co...
Nutritional value of sorghum silage of different purposes
Directory of Open Access Journals (Sweden)
Arthur Behling Neto
Full Text Available ABSTRACT Sorghum is a crop that stands out as an alternative to corn due to lower soil fertility demand and increased tolerance to drought. Lack of information about the qualitative behaviour of sorghum hinders the recommendation of different purpose sorghum cultivars. The goal was to evaluate the chemical composition and in vitro digestibility of different purpose sorghum cultivar silages, at two cropping seasons. The trial was conducted at the Plant Production Department, Federal Institute of Education, Science and Technology of Rondônia, Colorado do Oeste campus, and chemical analyses and in vitro incubation were performed at the Laboratory of Animal Nutrition, Federal University of Mato Grosso, Cuiabá campus. The experimental design was a randomized block with a split-plot arrangement and four replications. Plot treatments consisted of six different purpose sorghum cultivars (BRS 308 and BRS 310, grain sorghum; BR 655 and BRS 610, forage sorghum; and BRS 506 and CMSXS 647, sweet sorghum. Split-plot treatments consisted of two cropping periods (first crop and second crop. Forage sorghum cultivar BRS 655 demonstrated higher non-fiber carbohydrate content and lower potentially digestible fibre content than the other cultivars did. Sweet sorghum cultivars had higher levels of water soluble carbohydrates and non-protein nitrogen based on protein, lower indigestible neutral detergent fibre content at second crop, and higher in vitro dry matter digestibility than the other cultivars. The silages of sweet sorghum cultivars BRS 506 and CMSXS 647, and forage sorghum cultivar BRS 655 presented higher nutritional values.
Agrobacterium-mediated insertional mutagenesis in the mycorrhizal fungus Laccaria bicolor.
Stephan, B I; Alvarez Crespo, M C; Kemppainen, M J; Pardo, A G
2017-05-01
Agrobacterium-mediated gene transfer (AMT) is extensively employed as a tool in fungal functional genomics and accordingly, in previous studies we used AMT on a dikaryotic strain of the ectomycorrhizal basidiomycete Laccaria bicolor. The interest in this fungus derives from its capacity to establish a symbiosis with tree roots, thereby playing a major role in nutrient cycling of forest ecosystems. The ectomycorrhizal symbiosis is a highly complex interaction involving many genes from both partners. To advance in the functional characterization of fungal genes, AMT was used on a monokaryotic L. bicolor. A collection of over 1200 transgenic strains was produced, of which 200 randomly selected strains were analyzed for their genomic T-DNA insertion patterns. By means of insertional mutagenesis, a number of transgenic strains were obtained displaying differential growth features. Moreover, mating with a compatible strain resulted in dikaryons that retained altered phenotypic features of the transgenic monokaryon. The analysis of the T-DNA integration pattern revealed mostly similar results to those reported in earlier studies, confirming the usefulness of AMT on different genetic backgrounds of L. bicolor. Taken together, our studies display the great versatility and potentiality of AMT as a tool for the genetic characterization of L. bicolor.
Directory of Open Access Journals (Sweden)
Ming-Zhu Ding
Full Text Available The cooperative adaptation of subcultivated Bacillus cereus and Ketogulonicigenium vulgare significantly increased the productivity of 2-keto-L-gulonic acid, the precursor of vitamin C. The mechanism of cooperative adaptation of the serial subcultivated B. cereus and K. vulgare was investigated in this study by culturing the two strains orthogonally on agar plates. It was found that the swarming distance of B. cereus along the trace of K. vulgare on the plate decreased after 150 days' subcultivation. Metabolomic analysis on these co-cultured B. cereus and K. vulgare strains showed that their cooperative adaptation was accomplished by three key events: (i the ability of nutrients (e.g., amino acids and purines searching and intaking, and proteins biosynthesis is increased in the evolved B. cereus; (ii the capability of protein degradation and amino acids transportation is enhanced in evolved K. vulgare; (iii the evolved B. cereus was found to provide more nutrients (mostly amino acids and purines to K. vulgare, thus strengthening the oxidation and energy generation of K. vulgare. Our results provided novel insights into the systems-level understanding of the cooperative adaptation between strains in synergistic consortium.
Santos, Laís da Conceição dos [UNESP
2016-01-01
The objective of this study was to evaluate the effects of the strategy "push-pull" using sorghum plants (Sorghum bicolor L.) and coriander (Coriandrum sativum L.) on pests insect and predators and evaluate the abundance and species richness of Coleoptera, Hemiptera and bees in organic tomato. The experiment consisted of two treatments: a) polyculture; b) tomato monoculture. The polyculture was formed by tomato plants, Solanum lycopersicum L., coriander and sorghum. The evaluations were carri...
Heimann, Louisa; Horst, Ina; Perduns, Renke; Dreesen, Björn; Offermann, Sascha; Peterhansel, Christoph
2013-05-01
C4 photosynthesis evolved more than 60 times independently in different plant lineages. Each time, multiple genes were recruited into C4 metabolism. The corresponding promoters acquired new regulatory features such as high expression, light induction, or cell type-specific expression in mesophyll or bundle sheath cells. We have previously shown that histone modifications contribute to the regulation of the model C4 phosphoenolpyruvate carboxylase (C4-Pepc) promoter in maize (Zea mays). We here tested the light- and cell type-specific responses of three selected histone acetylations and two histone methylations on five additional C4 genes (C4-Ca, C4-Ppdk, C4-Me, C4-Pepck, and C4-RbcS2) in maize. Histone acetylation and nucleosome occupancy assays indicated extended promoter regions with regulatory upstream regions more than 1,000 bp from the transcription initiation site for most of these genes. Despite any detectable homology of the promoters on the primary sequence level, histone modification patterns were highly coregulated. Specifically, H3K9ac was regulated by illumination, whereas H3K4me3 was regulated in a cell type-specific manner. We further compared histone modifications on the C4-Pepc and C4-Me genes from maize and the homologous genes from sorghum (Sorghum bicolor) and Setaria italica. Whereas sorghum and maize share a common C4 origin, C4 metabolism evolved independently in S. italica. The distribution of histone modifications over the promoters differed between the species, but differential regulation of light-induced histone acetylation and cell type-specific histone methylation were evident in all three species. We propose that a preexisting histone code was recruited into C4 promoter control during the evolution of C4 metabolism.
Effects of bacterial inoculants and an enzyme on the fermentation ...
African Journals Online (AJOL)
... the effects of bacterial inoculation and cellulase on the fermentation quality of ensiled whole-crop sweet sorghum (WCSS, Sorghum bicolor L. Moench). The WCSS (323 g dry matter (DM)/kg, 251 g water soluble carbohydrates (WSC)/kg DM, 43 g crude protein (CP)/kg DM and 439 g neutral detergent fibre (NDF)/kg DM) ...
CSIR Research Space (South Africa)
Pelembe, LAM
2004-01-01
Full Text Available .H., Effect of calcium ions in sor- ghum beer mashing. Journal of the Institute of Brewing, 1988, 94, 68?70. VOL. 110, NO. 4, 2004 325 29. Hardie, D.G., Manners, D.J. and Yellowlees, D., The limit dex- trinase from malted sorghum (Sorghum vulgare...
DEFF Research Database (Denmark)
Blomstedt, Cecilia K; O'Donnell, Natalie H; Bjarnholt, Nanna
2016-01-01
Many important food crops produce cyanogenic glucosides as natural defense compounds to protect against herbivory or pathogen attack. It has also been suggested that these nitrogen-based secondary metabolites act as storage reserves of nitrogen. In sorghum, three key genes, CYP79A1, CYP71E1 and U...
Directory of Open Access Journals (Sweden)
Alessandra Fracasso
2017-05-01
Full Text Available Plant growth and productivity are strongly affected by limited water availability in drought prone environments. The current climate change scenario, characterized by long periods without precipitations followed by short but intense rainfall, forces plants to implement different strategies to cope with drought stress. Understanding how plants use water during periods of limited water availability is of primary importance to identify and select the best adapted genotypes to a certain environment. Two sorghum genotypes IS22330 and IS20351, previously characterized as drought tolerant and drought sensitive genotypes, were subjected to progressive drought stress through a dry-down experiment. A whole-canopy multi-chamber system was used to determine the in vivo water use efficiency (WUE. This system records whole-canopy net photosynthetic and transpiration rate of 12 chambers five times per hour allowing the calculation of whole-canopy instantaneous WUE daily trends. Daily net photosynthesis and transpiration rates were coupled with gene expression dynamics of five drought related genes. Under drought stress, the tolerant genotype increased expression level for all the genes analyzed, whilst the opposite trend was highlighted by the drought sensitive genotype. Correlation between gene expression dynamics and gas exchange measurements allowed to identify three genes as valuable candidate to assess drought tolerance in sorghum.
Fracasso, Alessandra; Magnanini, Eugenio; Marocco, Adriano; Amaducci, Stefano
2017-01-01
Plant growth and productivity are strongly affected by limited water availability in drought prone environments. The current climate change scenario, characterized by long periods without precipitations followed by short but intense rainfall, forces plants to implement different strategies to cope with drought stress. Understanding how plants use water during periods of limited water availability is of primary importance to identify and select the best adapted genotypes to a certain environment. Two sorghum genotypes IS22330 and IS20351, previously characterized as drought tolerant and drought sensitive genotypes, were subjected to progressive drought stress through a dry-down experiment. A whole-canopy multi-chamber system was used to determine the in vivo water use efficiency (WUE). This system records whole-canopy net photosynthetic and transpiration rate of 12 chambers five times per hour allowing the calculation of whole-canopy instantaneous WUE daily trends. Daily net photosynthesis and transpiration rates were coupled with gene expression dynamics of five drought related genes. Under drought stress, the tolerant genotype increased expression level for all the genes analyzed, whilst the opposite trend was highlighted by the drought sensitive genotype. Correlation between gene expression dynamics and gas exchange measurements allowed to identify three genes as valuable candidate to assess drought tolerance in sorghum.
Directory of Open Access Journals (Sweden)
Valdenir José Belinelo
2008-01-01
Full Text Available The objectives of this work were identified and characterize the allelopatic activity of extracts obtained from Arctium minus (Hill Bernh (Asteraceae. The fitotoxic activity of organic extracts (1 e 100 mg.L-1 and aqueous extract (5,00 e 0,05% m/v on the germination and radicular growth of the monocotyledon Sorghum bicolor L. (sorghum, and the dicotyledon Cucumis sativus L. (cucumber were evaluated. The results showed the presence of allelopatic activity variable in according to the extract concentration and with the target plant. The intensity of induced inhibitory effect was higher for the ethanolic extract in concentration of 100 mg.L-1 for Sorghum bicolor L. The results also indicates the existence of the potential use of Arctium minus (Hill Bernh ethanolic extract as a natural herbicide and open perspectives for the research of the constituent(s with higher allelopatic activity.
Purnamasari, Lidya; Pramono, Eko; Kamal, M
2015-01-01
The aim of this study is to determine the effect of the number of plants per hole on seed vigor of all sorghum varieties. Experiment is prepared by treatment with randomized block design (RAK) and repeated three times to do to achieve that goal. The first factor is the number of plants per hole that is 1 plant / hole (p1), 2 plants / hole (p2), 3 plants / holes (p3), and 4 plants / hole (p4). The second factor is the variety Numbu (g1), Keller (g2), and Wray (g3). The seed that had been harve...
Directory of Open Access Journals (Sweden)
Eduardo Bezerra de Morães
2009-03-01
Full Text Available
Sorghum is a crop of great importance for double cropping, in the Brazilian Central-West region. Within this region, in the Southwestern Goiás State, a research was conducted to select sorghum (Sorghum bicolor (L. Moench cultivars, in the municipalities of Montividiu, Rio Verde, and Santa Helena de Goiás. A randomized blocks design, with four replications, was used. The grain sorghum cultivars tested were: BR 304, 741, 822, Catuy, and the experimental hybrid V 00069. The cultivars were sown on March 5, 2005. The evaluated characteristics were: yield, weight of thousand grains, plant height, and flowering and maturation dates. The results showed the interaction genotype x environment for all evaluated characteristics. The region of Montividiu presented better potential for sorghum grain production. Early flowering and harvest allowed higher grain yields.
SOME CONSIDERATIONS ON THE PROSPECTS OF SORGHUM CROP
Directory of Open Access Journals (Sweden)
Agatha POPESCU
2014-10-01
Full Text Available The paper purpose was to analyze the sorghum statement at world, EU and Romania level in order to establish the main trends in the future of this crop. Sorghum is an important cereal coming on the 5th position after maize, rice, wheat and barley at world level due to its importance in human nutrition, animal feed, in producing bioethanol and green energy, and due to its good impact on environment. It is cultivated on all the continents, in the tropical, subtropical and temperate areas due to its resistance to drought, production potential, low inputs and production cost. It is an alternative to maize crop being more utilized as substituent in animal diets. The world sorghum production reached 63,811 thousand metric tons in 2014, the main producers being the USA, Mexico, Nigeria, India, Argentina, Ethiopia, Sudan and China. The world consumption of sorghum reached 63,148 thousand metric tons and it is continuously increasing. The sorghum exports accounted for 7,690 thousand metric tons in 2014, of which the USA export represents 4,600 thousand metric tons. Besides the USA, other exporting countries are Argentina, Australia, Ethiopia, India, Nigeria, Uruguay, while the main importing countries are China, Japan, Chile, Colombia, Mexico, the EU, Sudan. In 2014, the EU produced 576 thousand metric tons sorghum, imported 200 thousand metric tons, and consumed 770 thousand metric tons. The main EU producers of sorghum are France, Italy, Romania, Spain and Hungary. In 2012, Romania cultivated 20,000 ha with sorghum crop, 18 times more than in 2077. Also, in 2012, Romania produced 37.5 thousand tons of sorghum grains, by 31 times more than in 2007. The sorghum yield was 1,875 kg/ha by 66% higher in 2012 compared to 2007. Therefore, these figures show the increasing importance of sorghum crop at world level. Because Romania is situated in suitable geographical area for producing sorghum, it could increase production and become a more important supplier
International Nuclear Information System (INIS)
Mahmood, A.; Hussain, A.; Shahzad, A. N.; Honermeier, B.
2015-01-01
Biogas from biomass is a promising renewable energy source whose importance is increasing in European as well as in other countries. A field experiment at one location (Experimental Station Giessen, Justus Liebig University of Giessen, Germany) over two years was designed to study the effect of altering sowing time (ST), planting density and cultivar on the biomass yield and chemical composition of biomass sorghum, and its potential for methane production. Of the two cultivars tested, cv. Goliath (intraspecific hybrid) was more productive with respect to biomass yield than cv. Bovital (S. bicolor x S. sudanense hybrid). ST also influenced biomass yield and most of the quality parameters measured. Delayed sowing was in general advantageous. The choice of cultivar had a marked effect on biogas and methane yield. The highest biogas and methane yields were produced by late sown cv. Bovital. Sub-optimal planting densities limited biomass accumulation of the crop, however neither the chemical composition nor the methane yield was affected by planting density. (author)
Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis
DEFF Research Database (Denmark)
Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke
1984-01-01
The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...
Accumulation in Leaves of Sorghum bicolor (L.) Moench: A Source of Natural Food Pigment," J. Agricultural Deoxygenation of Triglycerides to Hydrocarbons Over Supported Nickel Catalysts," Chemical Engineering
International Nuclear Information System (INIS)
Kurdali, F.
2002-11-01
Pot experiments were conducted to study the effect of manuring with three types of plant residues (roots, shoots or roots plus shoots) of Dhaincha (Sesbania aculeata Pers.) on the yield and N-uptake of Sorghum bicolor grown in saline and non-saline soils. For measuring various sources of N-uptake, two isotopic dilution techniques were utilized by adding to these soils either 15 N-labelled inorganic N-fertilizer (indirect method) or 15 N-labelled sesbania leaves (direct method). For the indirect method, both soils manured with each type of sesbania residue, received four split applications of 15 N-labelled ammonium sulphate. Results indicated that each type of sesbania residue, applied as a green manure, resulted in significant increases in both dry matter yield and N-uptake of sorghum as compared with the un manured control. Moreover, sesbania residues decreased the harmful effect of salinity on plant growth. Percentages of N derived from residues (%Ndfr) in sorghum grown in non saline soil ranged between 3.9 and 33%; whereas, in saline soil, the observed values ranged between 4.9 and 19.8%. N recoveries in sorghum grown in non saline soil were 61, 45 and 37% of the total amount contained in the sesbania root, shoot and root plus shoot; whereas, values in sorghum grown in saline soils were 48, 14,8 and 15.7%, respectively. The beneficial effects of sesbania residues have been attributed not only to the additional N availability to the plants, but also to its effects on the enhancement of soil N uptake. Percentages and amounts of Ndfr calculated using the indirect method were not significantly different from those obtained by the direct method indicating that the indirect method used herein is feasible and simple for measuring N release from organic residues. It is suggested that the use of Sesbania aculeata residues, particularly the shoots, as a green manure, can provide a substantial portion of total N in sorghum. Moreover, the use of sesbania green manure in
Effect of heat moisture treatment (HMT) on product quality of sorghum starch
Haryani, Kristinah; Hadiyanto, Handayani, Noera; Nugraheni, Dwi; Suryanto
2015-12-01
Sorghum is a cereal plant that rich of nutrition contents. The high content of carbohydrate in sorghum make this plant can be processed into one of the processed food i.e vermicelli. To give better quality, it is necessary to use flour substitution from sorghum starch. The aim of this study was to evaluate the treatment of natural sorghum starch substitution, the addition of CMC, and a comparison of the natural starch with starch sorghum forage sorghum against solid losses value, rehydration weight and texture profiles. The variable used in this study: amount of natural sorghum starch subtituion (10%, 20%, 30%, 40%, 50%), the addition of CMC (0.1%; 0.2%; 0.3%; 0.4%; 0.5%) and substituting sorghum starch Natural: HMT sorghum starch (1: 1; 1: 2; 1: 3; 1: 4; 1: 5) and the quality parameters were evaluated. The result indicated that to substitute sorghum starch naturally at a rate of 50% had the best results with a value of solid losses 5.1% (white sorghum) 5.83% (red sorghum) and weighing rehydration 301.82% (white sorghums) 293.16% (red sorghum), the addition of CMC with 0.5% concentration of 3.96% solid losses value (red sorghum) 4:21% (white sorghums) and weight rehydration 252.71% (white sorghums) 244.45% (red sorghums).
Olson, Sara N.; Ritter, Kimberley B.; Herb, Dustin W.; Karlen, Steven D.; Lu, Fachuang; Ralph, John; Rooney, William L.; Mullet, John E.
2018-01-01
This study was conducted to document the extent and basis of compositional variation of shoot biomass of the energy Sorghum bicolor hybrid TX08001 during development under field conditions. TX08001 is capable of accumulating ~40 Mg/ha of dry biomass under good growing conditions and this genotype allocates ~80% of its shoot biomass to stems. After 150 days of growth TX08001 stems had a fresh/dry weight ratio of ~3:1 and soluble biomass accounted for ~30% of stem biomass. A panel of diverse energy sorghum genotypes varied ~6-fold in the ratio of stem structural to soluble biomass after 150 days of growth. Near-infrared spectroscopic analysis (NIRS) showed that TX08001 leaves accumulated higher levels of protein, water extractives and ash compared to stems, which have higher sugar, cellulose, and lignin contents. TX08001 stem sucrose content varied during development, whereas the composition of TX08001 stem cell walls, which consisted of ~45–49% cellulose, ~27–30% xylan, and ~15–18% lignin, remained constant after 90 days post emergence until the end of the growing season (180 days). TX08001 and Della stem syringyl (S)/guaiacyl (G) (0.53–0.58) and ferulic acid (FA)/para-coumaric acid (pCA) ratios were similar whereas ratios of pCA/(S+G) differed between these genotypes. Additionally, an analysis of irrigated versus non-irrigated TX08001 revealed that non-irrigated hybrids exhibited a 50% reduction in total cell wall biomass, an ~2-fold increase in stem sugars, and an ~25% increase in water extractives relative to irrigated hybrids. This study provides a baseline of information to help guide further optimization of energy sorghum composition for various end-uses. PMID:29684037
Directory of Open Access Journals (Sweden)
Paulo Claudeir Gomes da Silva
2009-11-01
Full Text Available O objetivo deste trabalho foi quantificar a produtividade de fitomassa, o teor e acúmulo de nitrogênio (N, e a relação carbono/nitrogênio (C/N de monocultivos de sorgo (Sorghum bicolor e milho (Zea mays e de seus consórcios com guandu-anão (Cajanus cajan, crotalária (Crotalaria juncea, tremoço branco (Lupinus albus, girassol (Helianthus annuus e nabo-forrageiro (Raphanus sativus, manejados em diferentes estádios. O experimento foi conduzido de março a julho de 2008, em Argissolo Vermelho distroférrico de textura média, no sistema plantio direto. O delineamento experimental foi o de blocos completos ao acaso, com quatro repetições, e parcelas subdivididas, constituído pelos tratamentos: monocultivos de sorgo e milho e seus respectivos consórcios com guandu-anão, crotalária, girassol, nabo-forrageiro e tremoço branco, nas parcelas; e épocas de corte, aos 60, 90 e 120 dias após a semeadura nas subparcelas. Consórcios de sorgo e milho com outras espécies superaram expressivamente a produtividade de fitomassa de seus monocultivos que ainda acumularam menos N e apresentaram maiores relações C/N na fitomassa. Para aumentar a produtividade de fitomassa, a melhor época de corte é aos 120 dias após a semeadura das culturas de cobertura. O corte aos 90 dias após a semeadura propicia o maior acúmulo de N e as menores relações C/N.The objective of this work was to quantify the biomass production, the content and accumulation of nitrogen (N and the carbon/nitrogen (C/N relation in monocultures of sorghum (Sorghum bicolor and corn (Zea mays, and intercrops with pigeon pea (Cajanus cajan, sun hemp (Crotalaria juncea, white lupine (Lupinus albus, sunflower (Helianthus annuus and turnip forage (Raphanus sativus, managed in different stages. The experiment was carried out from March to July 2008, in a Haplic Acrisol, medium texture, under no-tillage. A randomized complete block design, with four replicates and split plots with the
Directory of Open Access Journals (Sweden)
Mariana Villarreal-Silva
2015-01-01
Full Text Available Nueve híbridos de sorgo (Sorghum bicolor L. Moench se analizaron para determinar la relación de suscaracterísticas físicas [materia seca (MS, peso de mil granos (PMG, tamaño de partícula (TP, densidad relativa(DR, superficie de área (SA, partículas por gramo (PPG, endospermo duro (END-DU, endospermo blando (ENDBL];y químicas [nitrógeno total (NT, fibra detergente ácido (FDA, fibra detergente neutro (FDN, contenidode almidón (ALM, almidón soluble (AlmS, almidón insoluble (AlmNS. La digestión ruminal esperada (DRUMse estimó con las fracciones de AlmS y AlmNS in vitro. El promedio de PMG, TP, DR, SA, PPG y END-DU fuede 24.61 g, 3.17 mm, 1.30 g/cm3, 17.44 cm2/g, 30.33 y 46.68 %, respectivamente El promedio (% de MS, PC,FDN, FDA, ALM, AlmS y AlmNS fue de 92.47, 8.19, 19.17 y 8.30, 69.58, 6.00 y 47.74 respectivamente. Laconcentración de taninos fue baja (0.05 entre las variables físicas o químicas con el contenido total de almidón en el grano;sin embargo las variables densidad relativa y superficie de área, permiten incrementar el poder de predicciónde la digestibilidad ruminal del almidón (DRUM,%= 74.058 - 0.108END-DU + 0.027SA – 5.887DR, R2= 0.77,P<0.05. De acuerdo a los resultados obtenidos, las variedades estudiadas son de dureza intermedia, libres detaninos y con un potencial de digestibilidad ruminal del almidón del 66 %.
Modification of Sorghum Starch-Cellulose Bioplastic with Sorghum Stalks Filler
Directory of Open Access Journals (Sweden)
Yuli Darni
2017-05-01
Full Text Available This study evaluated the feasibility of bioplastics production by various ratio of sorghum starch and cellulose from red seaweed Eucheuma spinossum, and the use of glycerol as plasticizer and sorghum stalks as filler. Solid-liquid matrix transition should be far over the operating temperature of gelatinization and extracted at 95oC in order to avoid the loss of conductivity. The analyzed variables were starch and cellulose seaweed Eucheuma spinossum and the addition of variation of filler. Sorghum stalk could be expected to affect the mechanical and physical properties of bioplastics. A thin sheet of plastic (plastic film was obtained as a result that have been tested mechanically to obtain the best condition for the formulation of starch-cellulose 8.5:1.5 (g/g. From the result of morphological studies, the fillers in the mixture composites were more randomly in each product and the addition of filler can increase mechanical properties of bioplastics. Chemical modification had a major effect on the mechanical properties. The phenomena of degradation and thermoplasticization were visible at chemical changes that can be observed in FTIR spectrum test results.
Heimann, Louisa; Horst, Ina; Perduns, Renke; Dreesen, Björn; Offermann, Sascha; Peterhansel, Christoph
2013-01-01
C4 photosynthesis evolved more than 60 times independently in different plant lineages. Each time, multiple genes were recruited into C4 metabolism. The corresponding promoters acquired new regulatory features such as high expression, light induction, or cell type-specific expression in mesophyll or bundle sheath cells. We have previously shown that histone modifications contribute to the regulation of the model C4 phosphoenolpyruvate carboxylase (C4-Pepc) promoter in maize (Zea mays). We here tested the light- and cell type-specific responses of three selected histone acetylations and two histone methylations on five additional C4 genes (C4-Ca, C4-Ppdk, C4-Me, C4-Pepck, and C4-RbcS2) in maize. Histone acetylation and nucleosome occupancy assays indicated extended promoter regions with regulatory upstream regions more than 1,000 bp from the transcription initiation site for most of these genes. Despite any detectable homology of the promoters on the primary sequence level, histone modification patterns were highly coregulated. Specifically, H3K9ac was regulated by illumination, whereas H3K4me3 was regulated in a cell type-specific manner. We further compared histone modifications on the C4-Pepc and C4-Me genes from maize and the homologous genes from sorghum (Sorghum bicolor) and Setaria italica. Whereas sorghum and maize share a common C4 origin, C4 metabolism evolved independently in S. italica. The distribution of histone modifications over the promoters differed between the species, but differential regulation of light-induced histone acetylation and cell type-specific histone methylation were evident in all three species. We propose that a preexisting histone code was recruited into C4 promoter control during the evolution of C4 metabolism. PMID:23564230
PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH
Directory of Open Access Journals (Sweden)
Sa'roni Sa'roni
2012-10-01
Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi
Agronomic and morphological performance of sorghum (sorghum ...
African Journals Online (AJOL)
SARAH
2013-03-30
Mar 30, 2013 ... occasional frost limits growth and seed set of un- adapted cultivars (Arkel, 1979) making seed multiplication of un-adapted varieties unsuccessful. Previous studies have shown that sorghum cultivars adapted to high altitude, low rainfall areas. Journal of Applied Biosciences 63: 4720 – 4726. ISSN 1997– ...
Assessment of Genetic Variability in Sorghum Accessions (Sorghum ...
African Journals Online (AJOL)
ADOWIE PERE
The polymorphic information content (PIC) of individual primer ranged from 0.34 to 0.70 with a mean value of 0.54 indicating enough ... Keywords: Sorghum; Simple Sequence Repeat markers; Genetic variation; Polymorphic Information Content;. Coefficient of ... based techniques include Restriction Fragment Length.
Productivity and Competitiveness of Sorghum Production in ...
African Journals Online (AJOL)
showed that sorghum production in the study areas yielded profitable returns ... Keywords: Sorghum, Profitability, Competitiveness, Investment Potential, .... Guinness Ghana Brewery Limited to estimate cost and returns at the marketing sector ...
Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum
Lange, W.
1969-01-01
Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties arose in the cross: seed abortion necessitating
In planta transformation of sorghum (Sorghum bicolor (L.) Moench ...
Indian Academy of Sciences (India)
nisms that plants have evolved for adaptation to water deficit. Osmoprotectants include amino acids, quaternary ammonium and tertiary sulphonium ... loamy soil (red soil : sand : farm yard manure in a ratio of 3 : 1 : 1) after acclimatization as ...
Iron content in forage sorghum (Sorghum bicolor (L.) Moench ...
African Journals Online (AJOL)
Administrator
2011-09-12
. The period of field experiment was from May to November of 1993. The field was newly established on May 26,. 1993. On a ran-domized block design, there were 4 treatments with. 3 replications; Control (without fertilizer or ...
The productive potentials of sweet sorghum ethanol in China
International Nuclear Information System (INIS)
Zhang, Caixia; Xie, Gaodi; Li, Shimei; Ge, Liqiang; He, Tingting
2010-01-01
As one of the important non-grain energy crops, sweet sorghum has attracted the attention of scientific community and decision makers of the world since decades. But insufficient study has been done about the spatial suitability distribution and ethanol potential of sweet sorghum in China. This paper attempts to probe into the spatial distribution and ethanol potential of sweet sorghum in China by ArcGIS methods. Data used for the analysis include the spatial data of climate, soil, topography and land use, and literatures relevant for sweet sorghum studies. The results show that although sweet sorghum can be planted in the majority of lands in China, the suitable unused lands for large-scale planting (unit area not less than 100 hm 2 ) are only as much as 78.6 x 10 4 hm 2 ; and the productive potentials of ethanol from these lands are 157.1 x 10 4 -294.6 x 10 4 t/year, which can only meet 24.8-46.4% of current demand for E10 (gasoline mixed with 10% ethanol) in China (assumption of the energy efficiency of E10 is equivalent to that of pure petroleum). If all the common grain sorghum at present were replaced by sweet sorghum, the average ethanol yield of 244.0 x 10 4 t/year can be added, and thus the productive potentials of sweet sorghum ethanol can satisfy 63.2-84.9% of current demand for E10 of China. In general, Heilongjiang, Jilin, Inner Mongolia and Liaoning rank the highest in productive potentials of sweet sorghum ethanol, followed by Hebei, Shanxi, Sichuan, and some other provinces. It is suggested that these regions should be regarded as the priority development zones for sweet sorghum ethanol in China.
Genetic diversity in sorghum transpiration efficiency
Sorghum is the fifth most important grain crop and is becoming increasingly important as a biofuel feedstock due to its superior tolerance to water deficit stress. Sorghum is commonly grown under rain-fed conditions in the Southern Plains and other semi-arid regions in the world. Thus, its product...
Directory of Open Access Journals (Sweden)
C.F. Azevedo
2012-01-01
Full Text Available A erva-doce, Foeniculum vulgare Mill. (Apiaceae, é uma erva entouceirada, aromática que apresenta propriedades condimentares e medicinais; tem origem Européia e é amplamente cultivada em todo o Brasil. Devido à deficiência de informações relativas à organização estrutural de plântulas de espécies medicinais, o presente estudo teve como objetivo fornecer informações sobre a anatomia e o desenvolvimento de plântulas de F. vulgare. As sementes de erva-doce foram semeadas em areia e mantidas em casa de vegetação por 25 dias, sendo realizadas regas diárias. Foram selecionadas plântulas normais e de padrão uniforme, que tiveram raiz, zona de transição, caule, cotilédones e primeiras folhas seccionados à mão livre. Este material foi corado e montado em lâminas com glicerina para observação em microscópio. Em todos os órgãos da plântula de erva-doce a epiderme é unisseriada, cuticularizada e com estômatos; sendo que as duas últimas estruturas não são encontradas na raiz, porém esta apresenta pêlos unicelulares e cônicos. Os cotilédones e as folhas apresentam funções fotossintéticas e nutricionais, indicadas pela presença de grande quantidade de estômatos, cloroplastos e amido. A caracterização anatômica de plântulas de F. vulgare auxilia na identificação da espécie e no conhecimento da organização celular, fornecendo informações que auxiliam em estudos fisiológicos, taxonômicos e ecológicos.Fennel, Foeniculum vulgare Mill. (Apiaceae, is a forming clumps herb and presents aromatic, medicinal and condimental properties. It has European origin and is widely cultivated and used in Brazil. Due to lack of information concerning the structural organization of seedlings of medicinal species, this study aimed to provide information about the anatomy and development of F. vulgare seedlings. The seeds fennel was sowed in sand and maintained in greenhouse for 25 days, with daily waterings. Were selected
International Nuclear Information System (INIS)
Bedry, K. A. M.; Elamin, A. E. M.
2011-01-01
An experiment was conducted at Merowe Research Station farm, in the Northern State, Sudan, during 2008/2009 and 2009/2010 seasons. The objectives of the experiment were to determine the damage inflicted by a wild sorghum species (Sorghum arundinaceum (Del.) Stapf. ) on the yield of faba bean (Vicia faba L.) and to evaluate the efficacy of the post-emergence herbicide clodinafop-propargyl (Topik) on wild sorghum and its effect on faba bean yield. The wild sorghum reduced faba bean crop stand and straw and seed yields by 53% - 76%, 76% - 79% and 88% - 91%, respectively, compared with the hand-weeded control. Faba bean was tolerant to the herbicide. The herbicide, at all rates, effected complete (100%) and persistent control of the wild sorghum and resulted in faba bean seed yield comparable to the hand-weeded control. The lowest dose (0.075 kg a.i/ha) of the herbicide used was equal to 75% of the dose recommended for the control of wild sorghum in wheat. It is concluded that clodinafop-propargyl at 0.075 kg a.e/ha could be used in controlling wild sorghum in faba bean. At this rate, the marginal rate of return was about 35 which indicating that every monetary unit (SDG 1) invested in the mentioned treatment would be returned back, plus additional amount of 35 SDG.(Author)
Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves
Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan
2014-01-01
– The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)
Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus
Directory of Open Access Journals (Sweden)
P. E. Pensel
2014-01-01
Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.
Directory of Open Access Journals (Sweden)
P. G. Tillman
2012-01-01
Full Text Available The brown stink bug, Euschistus servus (Say, can disperse from source habitats, including corn, Zea mays L., and peanut, Arachis hypogaea L., into cotton, Gossypium hirsutum L. Therefore, a 2-year on-farm experiment was conducted to determine the effectiveness of a sorghum (Sorghum bicolor (L. Moench spp. bicolor trap crop, with or without Euschistus spp. pheromone traps, to suppress dispersal of this pest to cotton. In 2004, density of E. servus was lower in cotton fields with sorghum trap crops (with or without pheromone traps compared to control cotton fields. Similarly, in 2006, density of E. servus was lower in cotton fields with sorghum trap crops and pheromone traps compared to control cotton fields. Thus, the combination of the sorghum trap crop and pheromone traps effectively suppressed dispersal of E. servus into cotton. Inclusion of pheromone traps with trap crops potentially offers additional benefits, including: (1 reducing the density of E. servus adults in a trap crop, especially females, to possibly decrease the local population over time and reduce the overwintering population, (2 reducing dispersal of E. servus adults from the trap crop into cotton, and (3 potentially attracting more dispersing E. servus adults into a trap crop during a period of time when preferred food is not prevalent in the landscape.
7339 BASELINE SURVEY ON FACTORS AFFECTING SORGHUM ...
African Journals Online (AJOL)
muuicathy
2013-01-01
Jan 1, 2013 ... factors affecting sorghum production and the sorghum farming ... The informal seed system includes methods such as retaining seed on-farm from ..... Jaetzold R and H Schmidt Farm Management Handbook of Kenya, Ministry.
DEFF Research Database (Denmark)
Zerbe, Philipp; Chiang, Angela; Dullat, Harpreet
2014-01-01
Marrubium vulgare (Lamiaceae) is a medicinal plant whose major bioactive compounds, marrubiin and other labdane-related furanoid diterpenoids, have potential applications as anti-diabetics, analgesics or vasorelaxants. Metabolite and transcriptome profiling of M. vulgare leaves identified five...... different candidate diterpene synthases (diTPSs) of the TPS-c and TPS-e/f clades. We describe the in vitro and in vivo functional characterization of the M. vulgare diTPS family. In addition to MvEKS ent-kaurene synthase of general metabolism, we identified three diTPSs of specialized metabolism: MvCPS3...
Heterologous expression of Hordeum vulgare cysteine protease in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B
Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w......Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...
International Nuclear Information System (INIS)
Wang, L.; Li, W.; Yang, H.; Wu, W.; Ma, L.; Huang, T.; Wang, X.
2016-01-01
Limonium bicolor (Bag.) Kuntze is a perennial herb belonging to the Plumbaginaceae family. It is a typical recretohalophyte as well as a medicinal plant, distributing at saline soil areas in coastal areas and grasslands. In this paper,physiological mechanisms of L. bicolor to defend salt stress and effects of salinity on medicinal ingredients were investigated. The effects of different NaCl concentrations on the number of salt glands, Na/sup +/ content, dry weight and water content in tissues, gas exchange parameters involving net CO/sub 2/ assimilation rate, stomatal conductance, intercellular CO/sub 2/ concentration and transpiration rate, malondialdehyde content and electrolyte leakage, activities of superoxide dismutase, peroxidase and catalase and accumulations of secondary metabolites such as total phenolic, total flavonoid, gallic acid and myricetrin of leaves were determined. The results show that 100 and 200 mM NaCl induced facilitated effects in L. bicolor reflected in the increase in dry weight, tissue water content, net CO/sub 2/ assimilation rate, the number of salt glands, activity of superoxide dismutase, and content of gallic acid and myricetrin. The 300 mM NaCl treatment resulted in obviously decline in gas exchange parameters, and significant increases in Na/sup +/ levels, malondialdehyde level and electrolyte leakage. It was suggested that increased salt tolerance of L. bicolor was due to the corresponding resistance mechanisms involving an increased number of salt glands, enhanced activities of antioxidant enzymes, and an accelerated accumulation of secondary metabolites. What's more, the results on effects of salinity on medicinal ingredients in L. bicolor under different salt concentrations could provide theoretical basis for the standardization cultivation technique of L. bicolor. (author)
Directory of Open Access Journals (Sweden)
A. Domenico Palumbo
2014-08-01
Full Text Available Conservative agriculture and nitrogen fertilisation have been evaluated for the purpose of assessing their impact on the sustainability of a cropping system based on a two-year rotation with two crops considered for the bio-ethanol supply chain: sugar beet (Beta vulgaris L. subsp. vulgaris and sweet sorghum (Sorghum bicolor L. Moench. The experimental activity started in 2009 in Foggia (Apulia, southern Italy. We discuss the results obtained in the 2010-2011 period. Soil minimum tillage (MT vs no tillage (NT combined with two doses of nitrogen fertilisation (75 and 150 kg ha–1 of mineral nitrogen as ammonium nitrate were compared. The experimental system, which is still operational (soil tillage plus nitrogen fertilisation, was arranged with a split-plot design with three replicates. Treatments were applied on the same plots every year with both crops present at the same time. At the first harvest in 2010, no difference was observed. As to the second year, the comparison between NT vs MT treatments showed that sugar beet had lower total yield (35 vs 42 t ha–1, dry biomass (10 vs 14 t ha–1, and sucrose yield (6.7 vs 8.2 t ha–1. Total soluble solids, on average 19%, were not influenced by the experimental treatments. Nitrogen (N control was less productive than the fertilised treatments (average between N75 and N150 in terms of total fresh root yield (32 vs 42 t ha–1, dry biomass (10 vs 14 t ha–1, and sucrose yield (6.0 vs 8.1 t ha–1. As with sugar beet, during the second year, also sweet sorghum sown in NT vs MT plots had a reduced yield, although the difference was more marked for fresh biomass (–35% than for dry biomass (–20%. No interaction in terms of soil tillage nitrogen fertilisation occurred. In summary, in the first two-year period (2010-2011 of the experimental trial, no tillage soil management showed decreased yields of both crops. Sugar beet displayed a higher sensitivity to the lack of nitrogen supply than sweet
THE INTERCORRELATION OF THE AMINO ACID QUALITY ...
African Journals Online (AJOL)
a
ABSTRACT. Levels of amino acids were determined in the grains of guinea corn, Sorghum bicolor (L.) Moench ... KEY WORDS: Amino acid quality, Raw, Steeped, Germinated, Guinea corn ..... Health Organization: Geneva; 1999; pp. 101-119.
Directory of Open Access Journals (Sweden)
Carmelo Maucieri
2016-12-01
Full Text Available With the aim at enhancing the sustainability of biomass production in the Mediterranean area, this paper analyzes, for the first time, the production of sorghum (Sorghum bicolor (L. Moench biomass for bioenergy production using urban treated wastewaters and bio-fertilization. For this purpose, the effects on biomass production of three different fertilizations (no-nitrogen control, biofertilizer, and mineral ammonium nitrate, four levels of constructed wetland (CW wastewater restitutions (0%, 33%, 66% and 100% of crop evapotranspiration (ETc and three harvesting dates (at full plant maturity, at the initial senescence stage, and at the post-senescence stage were evaluated in a two year trial. For bio-fertilization, a commercial product based on arbuscular mycorrhizal fungi was used. Mineral nitrogen (N fertilization significantly increased dry biomass (+22.8% in the first year and +16.8% in the second year compared to the control (95.9 and 188.2 g·plant−1, respectively. The lowest and highest biomass production, in 2008 and 2009, was found at 0% (67.1 and 118.2 g·plant−1 and 100% (139.2 and 297.4 g·plant−1 ETc restitutions. In both years, the first harvest gave the highest biomass yield (124.3 g·plant−1 in the first year and 321.3 g·plant−1 in the second, followed by the second and the third one. The results showed that in Mediterranean areas, constructed wetlands treated wastewaters, when complying with the European restrictions for their use in agriculture, may represent an important tool to enhance and stabilize the biomass of energy crops by recycling scarce quality water and nutrients otherwise lost in the environment.
Directory of Open Access Journals (Sweden)
Argélia Maria Araújo Dias
2001-12-01
Full Text Available Este trabalho foi conduzido com o objetivo de avaliar o efeito do estádio de maturação do sorgo sobre a composição química da silagem, o consumo, a produção e o teor de gordura do leite em vacas holandesas, em comparação à silagem de milho. O experimento foi realizado na estação experimental da Empresa Pernambucana de Pesquisa Agropecuária - IPA, localizada em São Bento do Una-PE. Foram utilizadas nove vacas holandesas puras, em fase de lactação, distribuídas em três quadrados latinos. Os quadrados foram formados de acordo com a produção de leite e a ordem de lactação e constavam de três vacas e três períodos. Cada período teve duração de 28 dias. Os tratamentos consistiram de: SM - silagem de milho; SSE - silagem de sorgo fase de emborrachamento; SSL - silagem de sorgo grão leitoso. Foram ainda fornecidos 25 Kg de palma forrageira animal/dia e concentrado comercial de acordo com a produção de leite. A silagem de milho propiciou aos animais maior consumo médio de matéria seca da silagem e da dieta total. Não houve efeito significativo do estádio vegetativo do sorgo sobre o consumo de silagem. As produções de leite total e corrigida para 4% de gordura foram maiores nos animais que consumiram silagem de milho em relação aos que receberam silagem de sorgo no estádio de grão leitoso, todavia os que ingeriram silagem de sorgo na fase de emborrachamento não diferiram dos demais. Quanto ao teor de gordura do leite, não houve diferença significativa entre as silagens analisadas.This work aimed to evaluate the effect of the sorghum growth stage on the silage chemical composition, intake milk production and fat compared with corn silage to dairy cows. The experiment was carried out at the "São Bento do Una" research Stattion, from IPA, located in "São Bento do Una", Pernambuco, Brazil. Nine holstein lactating cows were distributed in three Latin squares design. The squares were formed according to milk yield
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.
1986-01-01
Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....
Lifescience Database Archive (English)
Full Text Available C37A2, complete sequence. 38 0.049 3 BZ347525 |BZ347525.1 hm84h07.b1 WGS-SbicolorF (JM107 adapted methyl filter...-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ho57b09 ..._Ba0020C03 5', genomic survey sequence. 42 0.33 2 BZ366117 |BZ366117.1 ic94g05.g1 WGS-SbicolorF (JM107 adapted methyl filter...in ordered pieces. 44 0.88 1 BZ626058 |BZ626058.1 ih42h02.b1 WGS-SbicolorF (DH5a methyl filter...07.g1 WGS-SbicolorF (DH5a methyl filtered) Sorghum bicolor genomic clone ii21a07, DNA sequence. 38 3.0 2 dna
Directory of Open Access Journals (Sweden)
M. Vazirian
2015-12-01
Full Text Available Background and Objectives: Essential oils are very complex mixture of components and their composition may vary in different species or varieties or even within the same variety. Origanum vulgare L. subsp. vulgare is one of the most distributed subspecies within the genus Origanum and has been found to be a poor-oil, categorized in cymyl, bornane or sabinyl chemotypes with higher proportion of sesquiterpenes. In this experiment, the Iranian sample was studied for the chemical composition of the oil and evaluation of its antioxidant activity. Methods: Essential oil was obtained by hydro-distillation and analyzed by GC/MS for determination of components. Antioxidant activity was evaluated by radical scavenging ability (DPPH method and reducing power (FRAP assay. Results: The sample belonged to “thymol” chemotype with the main components as thymol (37.13%, gama-terpinene (9.67%, carvacrol (9.57%, carvacrol methyl ether (6.88, cis-alpha-bisabolene (6.80%, eucalyptol (3.82%, p-cymene (3.58% and elemol (2.04%. The oil of plant showed very strong antioxidant activity (IC50=2.5 µg/mL in DPPH method, which was stronger than the standard antioxidants (Vit E and BHA, p
Directory of Open Access Journals (Sweden)
Lívio Ribeiro Molina
2003-02-01
Full Text Available Para testar o efeito da presença de tanino no grão sobre os parâmetros de degradabilidade potencial da matéria seca e da proteína bruta de seis genótipos de sorgo para silagem, foi conduzido um experimento utilizando a técnica da degradabilidade in situ. Quatro novilhos canulados no rúmen, alimentados individualmente, duas vezes ao dia ad libitum com feno de Tifton 85, foram utilizados para a incubação de silagens de sorgo no estádio de grão leitoso, pertencentes a seis genótipos: BR 303, BR 304, BR 601e AG 2006 (sem tanino no grão; BR 700 e BR 701 (com tanino. Foram incubadas 5 g de amostra nos tempos de incubação: 6, 12, 24, 48, 72 e 96 horas. O tempo zero (t0 foi utilizado para cálculo da fração solúvel. A presença do tanino reduziu a extensão de degradação da matéria seca e da proteína bruta nas silagens de sorgo BR 700 e BR 701. As degradabilidades potenciais destes nutrientes foram influenciada pelo tanino. Não foi observado efeito depressivo do tanino sobre as taxas de degradação para nenhum nutriente, em nenhuma silagem testada.The aim of this experiment was to evaluate the effect of tannin on grain over potential degradability parameters of the dry matter and crude protein of six sorghum silage genotypes by in situ technique. It was used four crossbred steers, canulated in rumen, fed ad libitum twice at day with a diet comprised by Cynodon dactylon hay. Six sorghum silage genotypes, harvested at milk stage, were incubated in the rumen: BR 303, BR 304, BR 601, and AG 2006 (without tannin on grain; BR 700, and BR 701 (with tannin on grain. Five grams of samples were incubated at times: 6, 12, 24, 48, 72, and 96 hours. The time zero (t0 was used to calculate the soluble fraction. Tannin decrease the extent of degradation of dry matter and crude protein of BR 700 and BR 701 sorghum silages. The potential degradabilities of these nutrients were reduced by tannin presence on grain. There was not effect of tannin
Influence of ginger on sensory properties and shelf-life of ogi, a ...
African Journals Online (AJOL)
STORAGESEVER
2010-03-22
Mar 22, 2010 ... corn (Sorghum bicolor) and millet (Pennisetum typho- denum). It serves as supplement for infant's feeding, consumed as breakfast meal by many and is also ... agar. improves the sensory and nutritional qualities, availability.
Optimization of extraction of polyphenols from Sorghum Moench ...
African Journals Online (AJOL)
phenolic acid were assayed using high performance liquid (HPLC). ... quantification of antioxidants and phenolic compounds from Sorghum M, ... Keywords: Response surface methodology, Sorghum moench, Polyphenols, Antioxidants.
Peculiarities in covering the requirements for seed material of sorghum crops
Directory of Open Access Journals (Sweden)
С. І. Мельник
2017-12-01
Full Text Available Purpose. To assess the demand for sorghum seed material and sufficiency of domestic seeds. Results. The analysis of the State register for the period of 2002–2012 showed that there was the tendency not only towards increasing quantity of sorghum crops in general but their substitution by hybrids of foreign breeding. During the period from 2002 to 2017, 72 sorghum varieties were entered on the State register in total, among them only 12 varieties were of domestic breeding, the rest 60 was presented by foreign breeding institutions. Investigation results allowed to determine that the production of base and prebase seeds of sorghum in 2010 amounted to 1,3 t, in 2016 was 43 t. During the same period the production of sugar sorghum increased from 0,2 to 12,0 t, grass sorghum – from 4,0 to 83 t. In 2017, requirements of acreage of such crops as grass sorghum and broomcorn were completely satisfied by the amount of grown seeds. At the same time, the need for seeds of sorghum and sugar sorghum can not be covered completely at the expense of domestic varieties reproduction. In 2017, general demand for sorghum seeds was 400,5 t, among which only 42,0 t was of domestic production. The rest demand for seeds will be met at the expense of import of foreign breeding seeds into the country to be grown and prepared for sowing abroad. Conclusions. In the Register of plant varieties suitable for dissemination in Ukraine, there are 72 sorghum varieties among them only 12 varieties were of domestic breeding, that is 17%, as compared to 83% of recommended great sorghum varieties of foreign breeding. In Ukraine, the area occupied by sorghum cultivation was 22,8 thou ha in 2005, up to 2017 it increased to 89,0 thou ha, and accordingly the demand for seeds run up from 102,6 to 400,5 t. The area occupied by the sugar sorghum in 2005 amounted to only 2,6 thou ha, in 2017 – 20,0 thou ha, that accordingly determined increase of demand for seed material from 13,0 to 99
Coté, Héloïse; Boucher, Marie-Anne; Pichette, André; Legault, Jean
2017-05-25
Background: Tanacetum vulgare L. (Asteraceae) is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean), Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Directory of Open Access Journals (Sweden)
Héloïse Coté
2017-05-01
Full Text Available Background: Tanacetum vulgare L. (Asteraceae is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean, Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Next-generation sequencing technology for genetics and genomics of sorghum
DEFF Research Database (Denmark)
Luo, Hong; Mocoeur, Anne Raymonde Joelle; Jing, Hai-Chun
2014-01-01
and grain sorghum. NGS has also been used to examine the transcriptomes of sorghum under various stress conditions. Besides identifying interesting transcriptonal adpatation to stress conditions, these study show that sugar could potentially act as an osmitic adjusting factor via transcriptional regulation....... Furthermore, miRNAs are found to be important adaptation to both biotic and abiotic stresses in sorghum. We discuss the use of NGS for further genetic improvement and breeding in sorghum....
Origanum vulgare (Lamiaceae OVICIDAL POTENTIAL ON GASTROINTESTINAL NEMATODES OF CATTLE
Directory of Open Access Journals (Sweden)
Luciana Laitano Dias de Castro
2013-12-01
Full Text Available Due to anthelmintic resistance in nematodes, several research studies have been developed seeking control alternatives to these parasites. This study evaluated the in vitro action of Origanum vulgare on gastrointestinal nematode eggs of cattle. In order to evaluate the ability to inhibit egg hatch, different dried leaves extracts of this plant were tested, such as dye, hydroalcoholic and aqueous extracts at concentrations varying from 0.62 to 80 mg/mL. Each assay was accompanied by control containing levamisole hydrochloride (0.2 mg/mL, distilled water and 70 ºGL grain alcohol at the same concentration of the extracts. Test results showed that the different O. vulgare extracts inhibited egg hatch of cattle gastrointestinal nematodes at a percentage that varied from 8.8 to 100%; dye and hydroalcoholic extract were the most promising inhibitors. In view of this ovicidal property, O. vulgare may be an important source of viable antiparasitic compounds for nematodiosis control in ruminants.
Directory of Open Access Journals (Sweden)
A.C. Rodrigues
2012-01-01
Full Text Available O objetivo do presente trabalho foi à verificação do efeito alelopático de Hyptis. suaveolens na germinação de sorgo, alface e rabanete, bem como, a comprovação da existência de compostos com potencial alelopático. Sementes de sorgo, alface e rabanete foram semeadas em substrato constituído de areia, terra e adubo orgânico contendo folhas de H. suaveolens. As análises da germinação foram feitas considerando a protrusão da radícula para o término do evento germinativo. Foi calculado o IVG (índice de velocidade de germinação e %G (porcentagem de germinação. Os resultados mostraram que sorgo e a alface foram mais susceptíveis ao potencial alelopático de H. suaveolens, sendo que para o rabanete foi observado um efeito benéfico. Entre os tratamentos, o substrato esterilizado e não esterilizado mostraram diferenças entre si. A análise cromatográfica do óleo essencial presente nas folhas de H. suaveolens revelou a presença de compostos com potencial alelopático. Portanto, H. suaveolens, pode apresentar efeito alelopático positivo no IVG de sementes de rabanete e a presença de microorganismos pode ser necessária para que esse efeito alelopático aconteça.The aim of this study was to verify the allelopathic effect of H. suaveolens on the germination of sorghum, lettuce and radish, as well as to prove the existence of compounds with allelopathic potential. Seeds of sorghum, lettuce and radish were sown in substrate consisting of sand, soil and organic fertilizer containing leaves of H. suaveolens. The germination tests were performed considering the protrusion of the radicle for the conclusion of the germinative event. GSI (germination speed index and G% (percentage of germination were calculated. The results showed that sorghum and lettuce were more susceptible to the allelopathic potential of H. suaveolens, while for radishes a beneficial effect was observed. Between treatments, the sterilized and unsterilized
Directory of Open Access Journals (Sweden)
Daniela Kajihara
2012-01-01
Full Text Available Transposable elements (TEs account for a large portion of plant genomes, particularly in grasses, in which they correspond to 50%-80% of the genomic content. TEs have recently been shown to be a source of new genes and new regulatory networks. The most striking contribution of TEs is referred as “molecular domestication”, by which the element coding sequence loses its movement capacity and acquires cellular function. Recently, domesticated transposases known as mustang and derived from the Mutator element have been described in sugarcane. In order to improve our understanding of the function of these proteins, we identified mustang genes from Sorghum bicolor and Zea mays and performed a phenetic analysis to assess the diversity and evolutionary history of this gene family. This analysis identified orthologous groups and showed that mustang genes are highly conserved in grass genomes. We also explored the transcriptional activity of sugarcane mustang genes in heterologous and homologous systems. These genes were found to be ubiquitously transcribed, with shoot apical meristem having the highest expression levels, and were downregulated by phytohormones. Together, these findings suggest the possible involvement of mustang proteins in the maintenance of hormonal homeostasis.
Production of fermentables and biomass by six temperate fuelcrops
Energy Technology Data Exchange (ETDEWEB)
Parrish, D.J.; Gammon, T.C.; Graves, B.
1985-12-01
Several potential fuelcrops have been studied individually, but relatively little work has been done to compare the various temperate species in side-by-side trials. The production has been examined of readily fermentable carbohydrates and biomass by six fuelcrop candidates: grain sorghum (Sorghum bicolor), Jerusalem articoke (Helianthus tuberosus), maize (Zea Mays), sugarbeet (Beta vulgaris), sweet potato (Ipomoea batatas) and sweet sorghum (Sorghum bicolor). A randomized complete block design with four replicates was employed at each of three locations that were somewhat diverse in soil type, elevation, growing season length, and 1980 rainfall distribution. Fermentables in the harvestable dry matter were determined colorimetrically following dilute acid plus enzymatic hydrolysis. Overall, sugarbeet was the most prolific producer of fermentables (7.4 Mg/ha); Jerusalem artichoke (5.8 Mg/ha), maize (4.8 Mg/ha) and sweet sorghum stems (5.8 Mg/ha) were statistically equivalent, while sweet potato (4.0 Mg/ha) and grain sorghum (3.8 Mg/ha) were less productive than the other candidates. The crops performed somewhat differently at each location, but the most striking site-specific differences were seen at the site with the coarsest textured soil and driest season. At that location, maize produced the least fermentables (0.6 Mg/ha). Biomass production generally reflected either the amount of time each species was actively growing or limiations to growth associated with drought. No general recommendations are made concerning a preferred temperature fuelcrop. Based on the studies, however, maize may not always be the fuelcrop of choice; others, especially sugarbeet and sweet sorghum (when harvested for grain also), may be superior to maize in productivity of fermentable substrates. 6 tabs., 13 refs.
Directory of Open Access Journals (Sweden)
M. T. Tinoco
2007-01-01
Full Text Available O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva composição química. A extracção dos óleos essenciais foi efectuada por hidrodestilação e a sua análise foi feita por GC-FID e GC-MS. No óleo das folhas foram identificados como componentes maioritários os fenilpropanóides anetol, fenchona e estragol e o monoterpeno a-felandreno, enquanto que o óleo dos frutos apresentou como constituintes predominantes anetol e fenchona. A actividade antimicrobiana dos óleos foi avaliada face às estirpes Staphylococcus aureus, Escherichia coli, Saccharomyces spp., Fusarium oxysporum e Penicillium sp.. Os óleos essenciais apresentaram actividade antimicrobiana contra S. aureus, Saccharomyces spp. e Fusarium oxysporum.Foeniculum vulgare Mill. ssp. vulgare is a spontaneous plant of Mediterranean region that belongs to the Apiaceae family. Its essential oil is used as additives in food, pharmaceutical, cosmetic and perfume industries mainly that one obtained from dried seeds. The main goal of this work were to evaluate the antimicrobial activity of essential oils obtained from fresh leaves and unripe seeds of sweet fennel, collected in Évora-Alentejo, in face of their chemical composition. The extraction of the essentials oils was made by hydrodistillation. Chemical analyses were carried out by GC-FID and GCMS. Phenylpropanoides anethole, fenchone, estragole and the monoterpene aphellandrene were the most abundant compounds of leaves essential oil. Seeds essential oil showed as main components
Energy Technology Data Exchange (ETDEWEB)
Wangai, L.K.; Mbeo, C.O. [Kenya Industrial Research and Development Inst., Nairobi (Kenya); Kamau, C.K. [Kenya Agricurtural Research Inst.(s), Machakos (Kenya)
2012-11-01
There are over 500 sorghum genotypes grown locally in Kenya. This study was an investigation and selection of suitable sorghum genotypes for sustainable bio-ethanol production in Kenya. For the study, 500 genotypes of sorghum were planted and grown using the recommended agricultural practices. Random sampling of 230 genotypes was done and the samples analysed for juice and sugar content. The 26 best yielding genotypes were selected and grown again in duplicate for further detailed study. Data on date of flowering, pest resistance, {sup 0}brix, wet and dry weight, plant population, ratooning, grain yield and juice yield and juice sugar content were recorded and analyzed using GENstat. Sampling was done for each genotype when about 50% of the crop had flowered and there after, every 2 weeks until the grains dried. Crushing was done with a three roller mill crusher [8]. The sugar content was measured using a digital refractometer. Sugar yield obtained ranged between 10.3{sup 0}Brix and 19.3{sup 0}Brix and juice yield between 268 litres/hectare and 11390 litres/hectare. Five indigenous sorghum varieties, GBK-007130, GBK-007076, GBK-007102, GBK-007296, GBK-007098 were found to have the highest sugar and juice yields and were considered the most suitable sweet sorghum genotypes among those studied, for bio-ethanol production in Kenya.
Directory of Open Access Journals (Sweden)
Saeide Saeidi
2014-10-01
Full Text Available Background: Herbal medicines are the major remedy in traditional medical systems and made a great contribution in maintaining human health and in preventing many infectious diseases. The present study was carried out to determine the potential antibacterial effect of ethanol extracts and essential oil of Marrubium vulgare L. against Staphylococcus aureus which is antibiotic resistant. Materials and Methods: All 17 strains of S. aureus isolated from nose and throat sample from 160 healthy subjects, hospital staffs and inpatient in the city of Zabol (Amir Al-Momenin hospital, Zabol, south-eastern Iran were screened during years 2010-2011. In this study, the essential oil of Marrubium vulgare L. obtained by hydrodistillation was analyzed by gas chromatography coupled to mass spectrometry (GC-MS in order to determine their chemical composition. The minimum inhibitory concentrations were investigated to characterize the antimicrobial activities of this essential oil and extract. Results: Thirty-one components in the oil of Marrubium vulgare were identified. The results demonstrated that the major components of the essential oil were γ-Eudesmol (11%, Germacrene (10%, D-Citronelly formate (10%, β-Citronellol (8%, Geranyl tiglate (7.1%, Geranyl formate (6.02%. The least MIC value of extract M. vulgare was 2.5 mg/mL and the highest MIC value of essential oil M. vulgare was 2.5 mg/mL. Conclusion: This investigation showed that the M. vulgare essential oil and extract has a potent antimicrobial activity against S. aureus. The present studies confirm the use of this essential oil and extract as antibacterial agent. Further research is required to evaluate the practical values of therapeutic applications.
Structure and chemistry of the sorghum grain
Sorghum is grown around the world and often under harsh and variable environmental conditions. Combined with the high degree of genetic diversity present in sorghum, this can result in substantial variability in grain composition and grain quality. While similar to other cereal grains such as maize ...
EVALUATION OF TWO VARIETIES OF SORGHUM FOR STARCH EXTRACTION
Directory of Open Access Journals (Sweden)
Leyanis Rodríguez Rodríguez
2015-01-01
Full Text Available In Cuba, the wet milling process for the extraction of starch is made from corn, cereal which is currently imported, that is why it is required to substitute it for another grain of national production as it is the case of sorghum. Given the similarities of the two grains in their starch content and considering the potential of sorghum for the food industry, it is developed in this work an assessment process, taking into account two sorghum varieties: red (CIAPR-132 and white (UDG-110. In this sense, a factorial design of the type 2k-1 is made, where the independent variables of most influence in the laboratory process are considered, such as: (x1 type of sorghum, (x2 soaking time and (x3 solution concentration. It is considered that there is no interaction between them and it is taken as the response variable the starch yield in the extraction process. We conclude that the type of sorghum and soaking time are the most influential variables, obtaining the best results for white sorghum subjected for 48 hours to soak in a solution of SO2 at a concentration of 1800 ppm.
Performance of Sorghum Varieties under Variable Rainfall in Central Tanzania.
Msongaleli, Barnabas M; Tumbo, S D; Kihupi, N I; Rwehumbiza, Filbert B
2017-01-01
Rainfall variability has a significant impact on crop production with manifestations in frequent crop failure in semiarid areas. This study used the parameterized APSIM crop model to investigate how rainfall variability may affect yields of improved sorghum varieties based on long-term historical rainfall and projected climate. Analyses of historical rainfall indicate a mix of nonsignificant and significant trends on the onset, cessation, and length of the growing season. The study confirmed that rainfall variability indeed affects yields of improved sorghum varieties. Further analyses of simulated sorghum yields based on seasonal rainfall distribution indicate the concurrence of lower grain yields with the 10-day dry spells during the cropping season. Simulation results for future sorghum response, however, show that impacts of rainfall variability on sorghum will be overridden by temperature increase. We conclude that, in the event where harms imposed by moisture stress in the study area are not abated, even improved sorghum varieties are likely to perform poorly.
Directory of Open Access Journals (Sweden)
Susana Queiroz Santos Mello
2007-09-01
Full Text Available
O objetivo do trabalho foi avaliar as características agronômicas de quatro cultivares de sorgo forrageiros, submetidas a três doses de nitrogênio, em solo classificado como Latossolo vermelho distrófico argiloso. Utilizou-se o delineamento blocos casualizados, em esquema fatorial 4x3. As cultivares foram os híbridos CMSXS 762, BRS 610, BR 700 e a variedade BR 506, com três doses de nitrogênio: 50 kg.ha-1, 75 kg.ha-1 e 100 kg.ha-1. A produção de matéria natural, com média geral de 59,31 t.ha-1, diferiu entre as cultivares (teste Tukey a 5% de probabilidade, porém, não diferiu em função das doses de nitrogênio. A produção de massa seca, com média de 15,17 t.ha-1, não diferiu entre as cultivares, nem entre as doses de N. Já os teores de matéria seca e as porcentagens de panícula e de colmo na matéria natural diferiram tanto entre as cultivares como em função das doses. A altura das plantas, com média geral de 2,39 m, e o teor de matéria seca do colmo diferiram somente entre as cultivares. As cultivares BR 700 e CMSXS 762 apresentaram uma melhor relação entre panícula/colmo/folha e uma maior porcentagem de panícula. E, à medida que se aumentou a dose de nitrogênio, verificou-se maior participação de panícula, com redução na percentagem de colmo.
PALAVRAS-CHAVE: Sorgo; adubação nitrogenada; avaliação agronômica.
The objective of this study was to evaluate characteristics of four forage sorghum cultivars at three levels of nitrogen fertilizer in an Oxisoil. A randomized complete block design in a 4x3 factorial scheme (CMSXS 762, BRS 610, BR 700 and BR 506 hybrid cultivars combined with 50 kg.ha-1, 75 kg.ha-1 and 100 kg.ha-1 nitrogen levels. A Tukey
In-silico identification and phylogenetic analysis of auxin efflux ...
African Journals Online (AJOL)
The phytohormone auxin is crucial for plant growth and development. ... genome, which are similar in number with that of monocotyledonous plant Oryza sativa. ... are much closer to Sorghum bicolor and O. sativa PIN genes of the grass family.
Understanding the diverse roles of soil organic matter in the cereal - Striga hermontica interaction
Ayongwa, G.C.
2011-01-01
Keywords: Striga hermonthica, Sorghum bicolor, soil fertility, organic matter, N-mineralisation, farmers’ priority, production constraints, intensification.
The problem of the parasitic weed striga (Striga hermonthica (Del.) Benth.) has worsened for African farmers, in conjunction
Directory of Open Access Journals (Sweden)
Ayşe YAZLIK
2015-09-01
Full Text Available Jonsongrass (Sorghum halepense (L. Pers. (SORHA is one of the most troublesome perennial weeds caused important yield reductions in the agricultural and environmental problems in the non-agricultural fields. Using a combination of several control strategies is required because Sorha cannot be effectively controlled by a single control method. One of the methods that can be used for the control of Sorha is the usage of allelopathic chemicals. The efficiency of the plants [oregano (Origanum vulgare L., lavender (Lavandula angustifolia L. and rosemary (Rosmarinus officinalis L.] that have allelochemicals on the SORHA were examined with this study. Using rosemary oil at the high rate (16 μl 38.465 cm2 gave the best results and reduced dry weight at 41.0% when it was applied as pre-emergence. The same essential oil rate obtained from rosemary was the highest adversely effects on the Sorha growth (48.0% when it was used as post-emergence. Post-emergence application of all three volatile oils has provided more influence on the Sorha growth compared to the pre-emergence application.
Bioethanol production from dried sweet sorghum stalk
Energy Technology Data Exchange (ETDEWEB)
Almodares, A.; Etemadifar, Z.; Ghoreishi, F.; Yosefi, F. [Biology Dept. Univ. of Isfahan, Isfahan (Iran, Islamic Republic of)], e-mail: aalmodares@yahoo.com
2012-11-01
Bioethanol as a renewable transportation fuel has a great potential for energy and clean environment. Among crops sweet sorghum is one of the best feedstock for ethanol production under hot and dry climatic conditions. Because it has higher tolerance to salt and drought comparing to sugarcane and corn that are currently used for bio-fuel production in the world. Generally mills are used to extract the juice from sweet sorghum stalks. Three roller mills extract around nearly 50 percent of the juice and more mills is needed to extract higher percentage of the juice. More over under cold weather the stalks become dry and juice is not extracted from the stalk, therefore reduce harvesting period. In this study stalks were harvested, leaves were stripped from the stalks and the stalks were chopped to nearly 4 mm length and sun dried. The dry stalks were grounded to 60 mesh powder by a mill. Fermentation medium consists of 15-35% (w/w) sweet sorghum powder, micronutrients and active yeast inoculum from 0.5-1% (w/w) by submerge fermentation method. The fermentation time and temperature were 48-72 hours and 30 deg, respectively. The results showed the highest amount of ethanol (14.5 % w/w sorghum) was produced with 10% sweet sorghum powder and 1% of yeast inoculum, three day fermentation at 30 deg.
Sorghum stem yield and soluble carbohydrates under different ...
African Journals Online (AJOL)
STORAGESEVER
2008-11-19
Nov 19, 2008 ... Key words: Sweet sorghum, grain sorghum, salinity, stem yield, ... The effect of salinity on the stem yield and sucrose was .... growth and polyamine metabolism in two citrus rootstocks with ... Growth and osmoregulation in two.
Directory of Open Access Journals (Sweden)
Manzoor A. Rather
2016-11-01
Full Text Available Foeniculum vulgare (Apiaceae commonly known as fennel is a well known and important medicinal and aromatic plant widely used as carminative, digestive, lactogogue and diuretic and in treating respiratory and gastrointestinal disorders. Its seeds are used as flavourings in baked goods, meat and fish dishes, ice cream, alcoholic beverages and herb mixtures. Phenols, phenolic glycosides and volatile aroma compounds such as trans-anethole, estragole and fenchone have been reported as the major phytoconstituents of this species. Different pharmacological experiments in a number of in vitro and in vivo models have convincingly demonstrated the ability of F. vulgare to exhibit antifungal, antibacterial, antioxidant, antithrombotic and hepatoprotective activities, lending support to the rationale behind several of its therapeutic uses. Phenolic compounds isolated from F. vulgare are considered to be responsible for its antioxidant activity while the volatile aroma compounds make it an excellent flavouring agent. The present review is an up-to-date and comprehensive analysis of the chemistry, pharmacology, traditional uses and safety of F. vulgare.
Li, Ya; Wang, Qi; Wang, Lu; He, Lin-Yan; Sheng, Xia-Fang
2016-02-01
Endophytic bacterial strain K3-2 was isolated from the roots of Sorghum sudanense (an bioenergy plant) grown in a Cu mine wasteland soils and characterized. Strain K3-2 was identified as Enterobacter sp. based on 16S rRNA gene sequence analysis. Strain K3-2 exhibited Cu resistance and produced 1-aminocyclopropane-1-carboxylate (ACC) deaminase, indole-3-acetic acid (IAA), siderophores, and arginine decarboxylase. Pot experiments showed that strain K3-2 significantly increased the dry weight and root Cu accumulation of Sorghum sudanense grown in the Cu mine wasteland soils. Furthermore, increase in total Cu uptake (ranging from 49% to 95%) of the bacterial inoculated-Sorghum sudanense was observed compared to the control. Notably, most of Cu (83-86%) was accumulated in the roots of Sorghum sudanense. Furthermore, inoculation with strain K3-2 was found to significantly increase Cu bioconcentration factors and the proportions of IAA- and siderophore-producing bacteria in the root interiors and rhizosphere soils of Sorghum sudanense compared with the control. Significant decrease in the available Cu content was also observed in the rhizosphere soils of the bacterial-inoculated Sorghum sudanense. The results suggest that the endophytic bacterial strain K3-2 may be exploited for promoting Sorghum sudanense biomass production and Cu phytostabilization in the Cu mining wasteland soils. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Eloísa de Oliveira Simões Saliba
2005-03-01
Full Text Available O experimento foi conduzido com o objetivo de avaliar a degradabilidade in situ da matéria seca (MS, da fibra em detergente neutro (FDN e da fibra em detergente ácido (FDA do material original de quatro genótipos de sorgo (ATF53*9929036; ATF54*9929036; CMSXS217*9929012 e VOLUMAX. Foram utilizadas 4 vacas Holandesas providas de fistula ruminal alimentadas com silagem de sorgo “ad libitun” e dois quilos de concentrado. O delineamento experimental foi o de blocos inteiramente ao acaso, com quatro repetições (animais, em arranjo de parcelas subdivididas. Os genótipos constituíram as parcelas e os tempos de digestão as sub-parcelas. O genótipo VOLUMAX foi o que apresentou a maior degradabilidade efetiva (DE da MS (56,22; 53,35 e 50,90% em relação aos demais em todas as taxas de passagem (2, 5 e 8%/h respectivamente e os genótipos ATF53*992903 e ATF54*9929036 obtiveram a maior DE da FDN (32,17 e 33,47%, respectivamente e FDA (34,81 e 35,50%, respectivamente para uma taxa de passagem de 2%/hThis experiment was carried out to evaluate “in situ” degradability of dry matter, neutral detergent fiber (NDF and acid detergent fiber (ADF of four sorghum genotypes (ATF53*9929036; ATF54*9929036; 217*9929012 and VOLUMAX. Four Holstein cows with ruminal fistula were fed on sorghum silage “ad libitum”, and 2.0 kg of concentrate. The animals were alloted in a randomized block design, with four replicates, in a split plot arrangement. The genotypes were considered the parcels and the incubation time the sub-parcels. The higher effective dry matter degradability were found in VOLUMAX genotype, (56.22; 53.35 and 50.90% for all passage rates, (2; 5 and 8%/h, respectively. The genotypes ATF53*992903 and ATF54*9929036 showed higher NDF effective degradability, 32.17 and 33.47% respectively, and ADF effective degradability, 34.81 and 35.50%, at 2%/h passage rate
Energy Technology Data Exchange (ETDEWEB)
Labbe, Jessy L [ORNL; Murat, Claude [INRA, Nancy, France; Morin, Emmanuelle [INRA, Nancy, France; Le Tacon, F [UMR, France; Martin, Francis [INRA, Nancy, France
2011-01-01
It is becoming clear that simple sequence repeats (SSRs) play a significant role in fungal genome organization, and they are a large source of genetic markers for population genetics and meiotic maps. We identified SSRs in the Laccaria bicolor genome by in silico survey and analyzed their distribution in the different genomic regions. We also compared the abundance and distribution of SSRs in L. bicolor with those of the following fungal genomes: Phanerochaete chrysosporium, Coprinopsis cinerea, Ustilago maydis, Cryptococcus neoformans, Aspergillus nidulans, Magnaporthe grisea, Neurospora crassa and Saccharomyces cerevisiae. Using the MISA computer program, we detected 277,062 SSRs in the L. bicolor genome representing 8% of the assembled genomic sequence. Among the analyzed basidiomycetes, L. bicolor exhibited the highest SSR density although no correlation between relative abundance and the genome sizes was observed. In most genomes the short motifs (mono- to trinucleotides) were more abundant than the longer repeated SSRs. Generally, in each organism, the occurrence, relative abundance, and relative density of SSRs decreased as the repeat unit increased. Furthermore, each organism had its own common and longest SSRs. In the L. bicolor genome, most of the SSRs were located in intergenic regions (73.3%) and the highest SSR density was observed in transposable elements (TEs; 6,706 SSRs/Mb). However, 81% of the protein-coding genes contained SSRs in their exons, suggesting that SSR polymorphism may alter gene phenotypes. Within a L. bicolor offspring, sequence polymorphism of 78 SSRs was mainly detected in non-TE intergenic regions. Unlike previously developed microsatellite markers, these new ones are spread throughout the genome; these markers could have immediate applications in population genetics.
Ouédraogo, E.; Brussaard, L.; Stroosnijder, L.
2007-01-01
A field experiment was conducted at Kaibo in southern Burkina Faso on an Eutric Cambisol during the 2000 rainy season to assess the interaction of organic amendment quality and soil fauna, affecting soil organic carbon and sorghum ( Sorghum bicolor L. Moench) performance. Plots were treated with the pesticides Dursban and Endosulfan to exclude soil fauna or left untreated. Sub-treatments consisted of surface-placed maize straw ( C/N ratio= 58), Andropogon straw ( C/N ratio= 153), cattle dung ...
Changes in protein and starch digestibility in sorghum flour during heat-moisture treatments.
Vu, Thanh-Hien; Bean, Scott; Hsieh, Chao-Feng; Shi, Yong-Cheng
2017-11-01
Heat-moisture treatment (HMT) has been used to modify properties of sorghum starches. However, information is limited on the effects of HMT on the digestibility of starch and the concurrent changes in protein in sorghum flour. The objectives of this research were to identify heat-moisture conditions to increase the resistant starch (RS) content of sorghum flour and investigate changes in sorghum proteins and starch structure. Sorghum flours with different moisture contents (0, 125, 200, and 300 g kg -1 w.b.) were heated at three temperatures (100, 120 and 140 °C) and times (1, 2 and 4 h). HMT of sorghum flour increased its RS level. The flour treated at 200 g kg -1 moisture and 100 °C for 4 h had a high RS content (221 g kg -1 vs. 56 g kg -1 for the untreated flour). Starch was not gelatinized when sorghum flours heated at moisture content of 200 g kg -1 or below. Sorghum protein digestibility and solubility decreased during HMT. The increase in RS of sorghum flour upon HMT was attributed to enhanced amylose-lipid complexes and heat induced structural changes in its protein fraction. HMT can be used to increase RS content in sorghum flour without gelatinizing its starch, thereby providing sorghum flour with unique food applications. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Sorghum as a renewable feedstock for production of fuels and industrial chemicals
Directory of Open Access Journals (Sweden)
Nhuan P. Nghiem
2016-01-01
Full Text Available Considerable efforts have been made in the USA and other countries to develop renewable feedstocks for production of fuels and chemicals. Among these, sorghum has attracted strong interest because of its many good characteristics such as rapid growth and high sugar accumulation, high biomass production potential, excellent nitrogen usage efficiency, wide adaptability, drought resistance, and water lodging tolerance and salinity resistance. The ability to withstand severe drought conditions and its high water usage efficiency make sorghum a good renewable feedstock suitable for cultivation in arid regions, such as the southern US and many areas in Africa and Asia. Sorghum varieties include grain sorghum, sweet sorghum, and biomass sorghum. Grain sorghum, having starch content equivalent to corn, has been considered as a feedstock for ethanol production. Its tannin content, however, may cause problems during enzyme hydrolysis. Sweet sorghum juice contains sucrose, glucose and fructose, which are readily fermentable by Saccharomyces cerevisiae and hence is a good substrate for ethanol fermentation. The enzyme invertase, however, needs to be added to convert sucrose to glucose and fructose if the juice is used for production of industrial chemicals in fermentation processes that employ microorganisms incapable of metabolizing sucrose. Biomass sorghum requires pretreatment prior to enzymatic hydrolysis to generate fermentable sugars to be used in the subsequent fermentation process. This report reviews the current knowledge on bioconversion of sorghum to fuels and chemicals and identifies areas that deserve further studies.
Environmental adaptibility of tansy ( Tanacetum vulgare L ...
African Journals Online (AJOL)
Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for laboratory research ...
Environmental adaptibility of tansy (Tanacetum vulgare L.)
African Journals Online (AJOL)
STORAGESEVER
2009-11-16
Nov 16, 2009 ... Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for.
DEFF Research Database (Denmark)
Jensen, J.; Linde-Laursen, Ib
1984-01-01
In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...
Evaluation of sorghum genotypes under drought stress conditions ...
African Journals Online (AJOL)
Seven genotypes of sorghum (Sorghum bicolour (L.) Moench) were studied in both drought and normal conditions. In each condition, the genotypes were evaluated using a split plot based randomized complete block design with three replications. Drought tolerance indices including stability tolerance index (STI), mean ...
Performance of Broiler Chicks Fed Irradiated Sorghum Grains
International Nuclear Information System (INIS)
Farag, M.D.D.; Farag, M.F. S. El-D.; Afify, A.S.
2003-01-01
Substitution of yellow corn with raw sorghum grains in chick diets resulted in decreases in live body weight, accumulative feed consumption and efficiency of feed utilization as compared with reference diet. Relative to raw sorghum diet, inclusion of sorghum grains irradiated at 60 and 100 kGy and/or supplemented with PEG in chick diets resulted in increases in accumulative feed consumption an efficiency feed utilization. The study suggested that irradiation treatment up to 100 kGy up grade broiler chicks performance and the combinations between radiation and PEG treatments sustain the effect of each other
Faleiro, Leonor; Miguel, Graça; Gomes, Sónia; Costa, Ludmila; Venâncio, Florencia; Teixeira, Adriano; Figueiredo, A Cristina; Barroso, José G; Pedro, Luis G
2005-10-19
Antilisterial activities of Thymbra capitata and Origanum vulgare essential oils were tested against 41 strains of Listeria monocytogenes. The oil of T. capitata was mainly constituted by one component, carvacrol (79%), whereas for O. vulgare three components constituted 70% of the oil, namely, thymol (33%), gamma-terpinene (26%), and p-cymene (11%). T. capitata essential oil had a significantly higher antilisterial activity in comparison to O. vulgare oil and chloramphenicol. No significant differences in L. monocytogenes susceptibilities to the essential oils tested were registered. The minimum inhibitory concentration values of T. capitata essential oil and of carvacrol were quite similar, ranging between 0.05 and 0.2 microL/mL. Antioxidant activity was also tested, the essential oil of T. capitata showing significantly higher antioxidant activity than that of O. vulgare. Use of T. capitata and O. vulgare essential oils can constitute a powerful tool in the control of L. monocytogenes in food and other industries.
Directory of Open Access Journals (Sweden)
C. J Bécquer
2011-09-01
Full Text Available Se realizó un experimento de campo con el objetivo de medir el efecto de cepas de rizobio en las variables agronómicas del sorgo, en las condiciones ambientales de Sancti Spíritus, Cuba. Se utilizaron 10 cepas de Sinorhizobium meliloti, procedentes de ecosistemas ganaderos de Alberta, Canadá; así como cuatro cepas de referencia pertenecientes a diferentes géneros y especies de rizobio, que procedían de la colección de Agriculture and AgriFood Canada. La confección de los inóculos y la inoculación de las semillas se realizaron por métodos estándar. El diseño experimental fue de bloques al azar, con 16 tratamientos y cuatro réplicas. Se evaluó el peso seco aéreo, la longitud del tallo y la longitud de la panoja; además, se calculó el incremento del peso seco aéreo en los tratamientos inoculados con relación al control absoluto. Los resultados demostraron la capacidad de las cepas estudiadas de influir en las variables agronómicas, ya que los tratamientos seleccionados igualaron sus valores a los del control fertilizado y presentaron un incremento de más del 100% del peso seco aéreo, comparado con el control absoluto.A field trial was conducted with the objective of measuring the effect of rhizobium strains on the agronomic variables of sorghum under the environmental conditions of Sancti Spiritus, Cuba. Ten Sinorhizobium meliloti strains, from livestock production ecosystems of Alberta, Canada, were used; as well as four reference strains belonging to different rhizobium genera and strains, which were from the collection of Agriculture and AgriFood Canada. The inoculi confection and seed inoculation were made by standard methods. The experimental design was randomized blocks, with 16 treatments and four replications. The dry aerial weight, stem length and ear length were evaluated; in addition, the increase of aerial dry weight was calculated in the inoculated treatments as compared to the absolute control. The results
PAV markers in Sorghum bicolour
DEFF Research Database (Denmark)
Shen, Xin; Liu, Zhiquan; Mocoeur, Anne Raymonde Joelle
2015-01-01
Abstract Genic presence/absence variants (PAVs) correlate closely to the phenotypic variation, impacting plant genome sizes and the adaption to the environment. To shed more light on their genome-wide patterns, functions and to test the possibility of using them as molecular markers, we analyzed...... enriched in stress responses and protein modification. We used 325 polymorphic PAVs in two sorghum inbred lines Ji2731 and E-Tian, together with 49 SSR markers, and constructed a genetic map, which consisted of 10 linkage groups corresponding to the 10 chromosomes of sorghum and spanned 1430.3 cM in length...
Factors influencing beta-amylase activity in sorghum malt
CSIR Research Space (South Africa)
Taylor, JRN
1993-09-01
Full Text Available isozyme of pI approximately 4.4-4.5, unlike the many isozymes all of higher pI in barley. However, like barley, sorghum beta-amylase was more temperature-labile than its alpha-amylase. Beta-amylase activity in sorghum malt was increased by germination time...
Estimation of in situ mating systems in wild sorghum (Sorghum ...
Indian Academy of Sciences (India)
The high outcrossing rates of wild/weedy sorghum populations in Ethiopia indicate a high potential for crop genes (including transgenes) to spread within the wild pool. Therefore, effective risk management strategies may be needed if the introgression of transgenes or other crop genes from improved cultivars into wild or ...
Lactic acid fermentation of two sorghum varieties is not affected by ...
African Journals Online (AJOL)
The study was conducted to investigate sorghum grain variety differences in lactic acid fermentation based on their differences in phenolic contents. The study wa s conductedas a 2 x 5 x 4 factorial design with three factors: Factor 1: Sorghum variety (white and red sorghum); Factor 2: Control treatment without lactic acid ...
Energy from biomass: Results of two-years trials on annual and perennial Herba ceous species
International Nuclear Information System (INIS)
Angelini, L.; Ceccarini, L.; Oggiano, N.; Bonari, E.
1994-01-01
In the framework of the PRisCa Project (Alternative Crops Research Project) a number of germ plasm collections were set up at the Department of Agronomy of the University of Pisa in order to identify annual and perennial herbaceous species utilizable for electric energy production. The first results deriving from trials carried out in 1992-93 are reported. The following species were used: 1) Annual: Sorghum bicolor, Hibiscus cannabinus, Pennisetum americanum, Kochia scoparia. 2) Perennial: Cynara cardunculus, Helianthus tuberosus, Miscantus sinensis, Arundo donax. Almost all species tested were represented by several genotypes. The total amount of species and genotype tested was 16. On all species, main phenological, biometric and productive determinations were performed. The hypothesized final use was intended to be electric power production by direct combustion and/or gasification. In addition, specific calorific value was also determined by adiabatic calorimeter as well as chemical composition of dry matter and ash composition. Species showing high yield potential, both from the quantitative and qualitative point of view, were Sorghum bicolor and Kochia scoparia (among annuals), as well as Miscanthus sinensis and Arundo donax (among perennials). Total dry matter yield ranged from about 23 tha -1 in the annual species to about 56 tha -1 in the perennials. The highest total calorific power obtainable from dry epigeic biomass was measured in Sorghum bicolor and Arundo donax - 4023 Kcal Kg -1 and 4166 Kcal Kg -1 respectively. The preliminary results suggest that vegetable biomass is environmentally-friendly and could contribute significantly to the world energy needs. (author)
Incorporating a Sorghum Habitat for Enhancing Lady Beetles (Coleoptera: Coccinellidae in Cotton
Directory of Open Access Journals (Sweden)
P. G. Tillman
2012-01-01
Full Text Available Lady beetles (Coleoptera: Coccinellidae prey on insect pests in cotton. The objective of this 2 yr on-farm study was to document the impact of a grain sorghum trap crop on the density of Coccinellidae on nearby cotton. Scymnus spp., Coccinella septempunctata (L., Hippodamia convergens Guérin-Méneville, Harmonia axyridis (Pallas, Coleomegilla maculata (De Geer, Cycloneda munda (Say, and Olla v-nigrum (Mulsant were found in sorghum over both years. Lady beetle compositions in sorghum and cotton and in yellow pyramidal traps were similar. For both years, density of lady beetles generally was higher on cotton with sorghum than on control cotton. Our results indicate that sorghum was a source of lady beetles in cotton, and thus incorporation of a sorghum habitat in farmscapes with cotton has great potential to enhance biocontrol of insect pests in cotton.
Directory of Open Access Journals (Sweden)
Marcelo Zafalon Peter
2008-08-01
Full Text Available The objective of this work was to study the use of organic acids in storage of sorghum grains, as an efficient alternative for small and medium producers, that lack structures for artificial drying and technical storage. The grains were stored in bulk in wood boxes, for six months, consisting of five treatments: I dried grains (13.15% of moisture, without incorporation of acids; II humid grains (21,54% of moisture without incorporation of acids; II-A; II-P and II-M, the latter three, with incorporation of acetic acid, propionic and the mixture of both, in the proportion of 1:1, respectively, in the dosis of 2 kg of acid per 100 kg of grains. Evaluation of grains was made at 1, 60, 120 and 180 days of storage, analysing humidity, carboydrate, crude protein, ether extract, ash, volumetric weight and incidence of insects. For the storage of 180 days, under the same environment conditions, it is concluded that: 1 the incorporation of acids at the moment of storage of humid sorghum grains allows superior preservative effects when compared to dry grains; 2 the mixture of acids, showed superior quantitative and qualitative preservative effects of the grains, followed by propionic acid, and acetic, respectively; 3 the storage of humid grains, without addition of acids, does not allow adequate grain conservation, not even for a period lesser than 60 days.O objetivo deste trabalho foi estudar a utilização de ácidos orgânicos no armazenamento de grãos de sorgo, como alternativa eficiente para pequenos e médios produtores, que não dispõem de estruturas de secagem artificial e armazenamento tecnificado. Os grãos foram armazenados a granel, em caixas de madeira, por seis meses, consistindo de cinco tratamentos: I grãos secos (13,15% de umidade, sem incorporação de ácidos; II grãos úmidos (21,54% de umidade, sem incorporação de ácidos; II-A; II-P e II-M, sendo os três últimos grãos úmidos (21,54% de umidade, com incorporação de
The application of secondary metabolites in the study of sorghum insect resistance
Chunming, Bai; Yifei, Liu; Xiaochun, Lu
2018-03-01
Insect attack is one of the main factors for limiting the production of rice and sorghum. To improve resistance to pests of rice and sorghum will be of great significance for meliorating their production and quality. However, the source and material of anti-pest was scarce. In this study, we will study on the expression patterns of hydrocyanic acid biosynthesis relative genes in sorghum firstly. And we will also genetically transform them into rice and sorghum by specific and constitutive promoters and verify their pest-resistant ability. Finally, high pest-resistant genetically modified new sorghum cultivars will be bred with favorable comprehensive agronomic traits.
Dos Reis, Evelyze Pinheiro; de Oliveira Campos, Lucio Antonio; Tavares, Mara Garcia
2011-04-01
Stingless bee colonies typically consist of one single-mated mother queen and her worker offspring. The stingless bee Melipona bicolor (Hymenoptera: Apidae) shows facultative polygyny, which makes this species particularly suitable for testing theoretical expectations concerning social behavior. In this study, we investigated the social structure and genetic relatedness among workers from eight natural and six manipulated colonies of M. bicolor over a period of one year. The populations of M. bicolor contained monogynous and polygynous colonies. The estimated genetic relatedness among workers from monogynous and polygynous colonies was 0.75 ± 0.12 and 0.53 ± 0.16 (mean ± SEM), respectively. Although the parental genotypes had significant effects on genetic relatedness in monogynous and polygynous colonies, polygyny markedly decreased the relatedness among nestmate workers. Our findings also demonstrate that polygyny in M. bicolor may arise from the adoption of related or unrelated queens.
Directory of Open Access Journals (Sweden)
Evelyze Pinheiro dos Reis
2011-01-01
Full Text Available Stingless bee colonies typically consist of one single-mated mother queen and her worker offspring. The stingless bee Melipona bicolor (Hymenoptera: Apidae shows facultative polygyny, which makes this species particularly suitable for testing theoretical expectations concerning social behavior. In this study, we investigated the social structure and genetic relatedness among workers from eight natural and six manipulated colonies of M. bicolor over a period of one year. The populations of M. bicolor contained monogynous and polygynous colonies. The estimated genetic relatedness among workers from monogynous and polygynous colonies was 0.75 ± 0.12 and 0.53 ± 0.16 (mean ± SEM, respectively. Although the parental genotypes had significant effects on genetic relatedness in monogynous and polygynous colonies, polygyny markedly decreased the relatedness among nestmate workers. Our findings also demonstrate that polygyny in M. bicolor may arise from the adoption of related or unrelated queens.
PASCAL D. C. AGBANGNAN; CHRISTINE TACHON; HELENE BONIN; ANNA CHROSTOWKA; ERIC FOUQUET; DOMINIQUE C. K. SOHOUNHLOUE
2012-01-01
The full phytochemical screening of red sorghum from Benin (Sorghum caudatum) achieved in this work reveals the presence of leucoanthocyanins, flavonoides, free quinones, combined anthracene derivatives, sterols and terpenes in higher concentration in the leaf sheath and marrow of stem than in the seed. Catechin tannin content is 11.4% in the leaf sheath (slightly higher than that of red wine), 5.8% in the marrow and 2.8% in the seed. Gallic tannins, saponins and the mucilage present in the l...
Grain sorghum is a viable feedstock for ethanol production.
Wang, D; Bean, S; McLaren, J; Seib, P; Madl, R; Tuinstra, M; Shi, Y; Lenz, M; Wu, X; Zhao, R
2008-05-01
Sorghum is a major cereal crop in the USA. However, sorghum has been underutilized as a renewable feedstock for bioenergy. The goal of this research was to improve the bioconversion efficiency for biofuels and biobased products from processed sorghum. The main focus was to understand the relationship among "genetics-structure-function-conversion" and the key factors impacting ethanol production, as well as to develop an energy life cycle analysis model (ELCAM) to quantify and prioritize the saving potential from factors identified in this research. Genetic lines with extremely high and low ethanol fermentation efficiency and some specific attributes that may be manipulated to improve the bioconversion rate of sorghum were identified. In general, ethanol yield increased as starch content increased. However, no linear relationship between starch content and fermentation efficiency was found. Key factors affecting the ethanol fermentation efficiency of sorghum include protein digestibility, level of extractable proteins, protein and starch interaction, mash viscosity, amount of phenolic compounds, ratio of amylose to amylopectin, and formation of amylose-lipid complexes in the mash. A platform ELCAM with a base case showed a positive net energy value (NEV) = 25,500 Btu/gal EtOH. ELCAM cases were used to identify factors that most impact sorghum use. For example, a yield increase of 40 bu/ac resulted in NEV increasing from 7 million to 12 million Btu/ac. An 8% increase in starch provided an incremental 1.2 million Btu/ac.
KLT-type relations for QCD and bicolor amplitudes from color-factor symmetry
Brown, Robert W.; Naculich, Stephen G.
2018-03-01
Color-factor symmetry is used to derive a KLT-type relation for tree-level QCD amplitudes containing gluons and an arbitrary number of massive or massless quark-antiquark pairs, generalizing the expression for Yang-Mills amplitudes originally postulated by Bern, De Freitas, and Wong. An explicit expression is given for all amplitudes with two or fewer quark-antiquark pairs in terms of the (modified) momentum kernel. We also introduce the bicolor scalar theory, the "zeroth copy" of QCD, containing massless biadjoint scalars and massive bifundamental scalars, generalizing the biadjoint scalar theory of Cachazo, He, and Yuan. We derive KLT-type relations for tree-level amplitudes of biadjoint and bicolor theories using the color-factor symmetry possessed by these theories.
Effects of main traits of sweet sorghum irradiated by carbon ions
International Nuclear Information System (INIS)
Li Wenjian; He Jingyu; Liu Qingfang; Yu Lixia; Dong Xicun
2009-01-01
To investigate the influence of carbon ion irradiation on important agronomic characters of sweet sorghum, dry seeds of Sweet Sorghum BJ0601 and BJ0602 were irradiated by 100 MeV/u 12 C +6 ion beam to different doses at Heavy Ion Accelerator National Laboratory in Lanzhou (HIANLL). When matured, the main traits of sweet sorghum were measured. The correlation coefficient of five main agronomic characters, i.e. number of node, plant height, stalk diameter, sugar content and stem weight per plant, were analyzed using the SPSS 13.0 software. The results indicated that the obvious influence of sweet sorghum irradiated by carbon ion beam was observed. In addition, the correlation of main traits was studied. This study may provide rudimental data to select novel variety of sweet sorghum suited for fuel ethanol production. In addition, the average of sugar content of early mutant BJ0601-1 is higher than BJ0601 in M2, and the sugar content of sweet sorghum may be improved by carbon ion beam irradiation. (authors)
Abbas Jamilah
2018-01-01
Objective : In continuation of our antimalarial candidate drug discovery program on Indonesia medicinal plants especially from stem bark of Calophyllum bicolor. Metode : We extracted of bioactive crude extract with hexane, acetone and methanol from stem bark of Calophyllum bicolor and evaluated their antimalarial activity by using parasite Plasmodium falciparum in vitro. Results: Methanol fraction showed most active and potent antimalarial activity dose dependent in in vitro experiments with ...
Directory of Open Access Journals (Sweden)
PASCAL D. C. AGBANGNAN
2012-06-01
Full Text Available The full phytochemical screening of red sorghum from Benin (Sorghum caudatum achieved in this work reveals the presence of leucoanthocyanins, flavonoides, free quinones, combined anthracene derivatives, sterols and terpenes in higher concentration in the leaf sheath and marrow of stem than in the seed. Catechin tannin content is 11.4% in the leaf sheath (slightly higher than that of red wine, 5.8% in the marrow and 2.8% in the seed. Gallic tannins, saponins and the mucilage present in the leaf sheath and marrow, are virtually absent in the seed. Marrow and leaf sheath extracts (1 g/50 mL showed a concentration of anthocyanins (147 mg/L and 213.5 mg/L similar to that of rosy wine and red wine with short maceration. The grain of sorghum is four times, respectively two times less rich in phenolic compounds than the leaf sheath and the marrow of stem.
Flavonoids from the Leaves of Impatiens bicolor
TAHIR, Aurangzeb HASAN and Muhammad Nawaz
2005-01-01
Three new flavanone glycosides, naringenin 4'-O-b-D-glucuronopyranoside, naringenin 4'-O-a-L rham\\-nopyranoside and naringenin 4'-O-b-D-xylopyranoside, were characterized from the leaves of Impatiens bicolor, together with 6 known glycosides: naringenin 4'-O-b-D-glucopyranoside, kaempferol 7-O-b-D-glucuronopyranoside, quercetin 3-O-b-D-glucopyranoside, kaempferol 5-O-b-D-xylopyranoside, kaempferol 3-O-b-D-galactopyranoside and kaempferol 7-O-b-D-xylopyranoside. The...
Flavonoids from the Leaves of Impatiens bicolor
TAHIR, Aurangzeb HASAN and Muhammad Nawaz; HASAN, Aurangzeb
2014-01-01
Three new flavanone glycosides, naringenin 4'-O-b-D-glucuronopyranoside, naringenin 4'-O-a-L rham\\-nopyranoside and naringenin 4'-O-b-D-xylopyranoside, were characterized from the leaves of Impatiens bicolor, together with 6 known glycosides: naringenin 4'-O-b-D-glucopyranoside, kaempferol 7-O-b-D-glucuronopyranoside, quercetin 3-O-b-D-glucopyranoside, kaempferol 5-O-b-D-xylopyranoside, kaempferol 3-O-b-D-galactopyranoside and kaempferol 7-O-b-D-xylo...
Omslaget - hvid okseøje (Leucanthemum vulgare)
DEFF Research Database (Denmark)
Friis, Ib
2010-01-01
Artiklen redergør for den historiske baggrund for den illustration (tavle 994 fra Flora Danica, udgivet i 1790) af hvid okseøje (Leucanthemum vulgare), der er anvendt som illustration på festskriftets omslag. De illustratorer, der blev anvendt af Martin Vahl, udgiver af Flora Danica da tavle 994...
NDVI to Detect Sugarcane Aphid Injury to Grain Sorghum.
Elliott, N C; Backoulou, G F; Brewer, M J; Giles, K L
2015-06-01
Multispectral remote sensing has potential to provide quick and inexpensive information on sugarcane aphid, Melanaphis sacchari (Zehntner), pest status in sorghum fields. We describe a study conducted to determine if injury caused by sugarcane aphid to sorghum plants in fields of grain sorghum could be detected using multispectral remote sensing from a fixed wing aircraft. A study was conducted in commercial grain sorghum fields in the Texas Gulf Coast region in June 2014. Twenty-six commercial grain sorghum fields were selected and rated for the level of injury to sorghum plants in the field caused by sugarcane aphid. Plant growth stage ranged from 5.0 (watery ripe) to 7.0 (hard dough) among fields; and plant injury rating from sugarcane aphid ranged from 1.0 (little or no injury) to 4.0 (>40% of plants displaying injury) among fields. The normalized differenced vegetation index (NDVI) is calculated from light reflectance in the red and near-infrared wavelength bands in multispectral imagery and is a common index of plant stress. High NDVI indicates low levels of stress and low NDVI indicates high stress. NDVI ranged from -0.07 to 0.26 among fields. The correlation between NDVI and plant injury rating was negative and significant, as was the correlation between NDVI and plant growth stage. The negative correlation of NDVI with injury rating indicated that plant stress increased with increasing plant injury. Reduced NDVI with increasing plant growth probably resulted from reduced photosynthetic activity in more mature plants. The correlation between plant injury rating and plant growth stage was positive and significant indicating that plant injury from sugarcane aphid increased as plants matured. The partial correlation of NDVI with plant injury rating was negative and significant indicating that NDVI decreased with increasing plant injury after adjusting for its association with plant growth stage. We demonstrated that remotely sensed imagery acquired from grain
Species of Concern (SOC) on Department of Defense Installations
2002-07-15
ARISTIDA STRICTA; DRY, UPLAND FLAT, FILTERED LIGHT; WITH BAPTISIA CINEREA, VIOLA PEDATA, DALEA PINNATA.* SUBPOP A=PINE/SCRUB OAK SANDHILL; FEW SCATTERED...DIOSPYROS VIRG., GAYLUSSACIA DUMOSA, EPIGAEA REPENS, ANDROPOGON SP., BAPTISIA TINCT., TEPHROSIA VIRG., VACCINIUM CRASS., LESPEDEZA SP., DALEA PINNATA...ADENOCAULON BICOLOR , PHACELIA NEMORALIS, CAREX HENDERSONII. CIRSIUM VULGARE COMMON WHERE DISTURBED.* Cedar-hemlock forest on lower slopes of logged
Electrochemical evaluation of sweet sorghum fermentable sugar bioenergy feedstock
Redox active constituents of sorghum, e.g., anthocyanin, flavonoids, and aconitic acid, putatively contribute to its pest resistance. Electrochemical reactivity of sweet sorghum stem juice was evaluated using cyclic voltammetry (CV) for five male (Atlas, Chinese, Dale, Isidomba, N98) and three fema...
Molecular Cloning and Expression Analysis of Cu/Zn SOD Gene from Gynura bicolor DC.
Directory of Open Access Journals (Sweden)
Xin Xu
2017-01-01
Full Text Available Superoxide dismutase is an important antioxidant enzyme extensively existing in eukaryote, which scavenges reactive oxygen species (ROS and plays an essential role in stress tolerance of higher plants. A full-length cDNA encoding Cu/Zn SOD was cloned from leaves of Gynura bicolor DC. by rapid amplification of cDNA ends (RACE. The full-length cDNA of Cu/Zn SOD is 924 bp and has a 681 bp open reading frame encoding 227 amino acids. Bioinformatics analysis revealed that belonged to the plant SOD super family. Cu/Zn SODs of the Helianthus annuus, Mikania micrantha, and Solidago canadensis var. scabra all have 86% similarity to the G. bicolor Cu/Zn SOD. Analysis of the expression of Cu/Zn SOD under different treatments revealed that Cu/Zn SOD was a stress-responsive gene, especially to 1-MCP. It indicates that the Cu/Zn SOD gene would be an important gene in the resistance to stresses and will be helpful in providing evidence for future research on underlying molecular mechanism and choosing proper postharvest treatments for G. bicolor.
Fungal endophytes of sorghum in Burkina Faso
DEFF Research Database (Denmark)
Zida, E P; Thio, I G; Néya, B J
2014-01-01
A survey was conducted to assess the natural occurrence and distribution of fungal endophytes in sorghum in relation to plant performance in two distinct agro-ecological zones in Burkina Faso. Sorghum farm-saved seeds were sown in 48 farmers’ fields in Sahelian and North Sudanian zones to produce...... sorghum plants. In each field, leaf samples were collected from five well-developed (performing) and five less-developed (non-performing) plants at 3-5 leaf stage, while at plant maturity leaf, stem and root samples were collected from the same plants and fungal endophytes were isolated. A total of 39...... fungal species belonging to 25 genera were isolated. The most represented genera included Fusarium, Leptosphaeria, Curvularia, Nigrospora and Penicillium. The genera Fusarium and Penicillium occurred significantly higher in performing plants as compared to non-performing plants while the genera...
Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Bothmer, R. von; Claesson, L.; Flink, J.
1989-01-01
A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...
Experimental study on bread yeast cultured in sweet sorghum juice
International Nuclear Information System (INIS)
Wang Jufang; Dong Xicun; Li Wenjian; Xiao Guoqing; Ma Liang; Gao Feng
2008-01-01
As a substitute for food supplies, sweet sorghum juice with high grade has demonstrated out- standing advantage in fermentation. To obtain the optimized fermentation conditions, the growth, the bio- mass of bread yeast cultured in sweet sorghum juice and total residual sugar were investigated in the paper. The fermentation was performed and optimized in a 10-100 1 bio-reactor. The results show that the application of sweet sorghum juice in bread yeast production is very potential. (authors)
Sorghum stem yield and soluble carbohydrates under different ...
African Journals Online (AJOL)
STORAGESEVER
2008-11-19
Nov 19, 2008 ... The aim of this study was to select the most suitable cultivar for salty land in this geographical area. Two sweet sorghum cultivars (Keller and Sofra) and one grain sorghum cultivar (Kimia) were grown in greenhouse benches under four salinity levels of 2, 4, 8 and 12 dSm-1 to evaluate the effects of salinity.
Directory of Open Access Journals (Sweden)
Evaline Chepng’etich
2015-01-01
Full Text Available Majority of the rural households in Kenya depend on agriculture as a source of food and livelihood. Agricultural productivity has been declining due to many factors resulting in increased food insecurity in the country. Consequently, there is a renewed interest in promoting drought-tolerant crops such as sorghum which thrives in the arid and semiarid lands of the developing world. However, performance of sorghum production among the smallholder farmers has still remained low. This study was thus carried out to identify factors that influence technical efficiency of sorghum production among smallholder farmers in Machakos and Makindu districts of the lower eastern Kenya. Collected data on farm and farmer characteristics were analysed by use of descriptive statistics and Tobit model. Result highlights show that technical efficiency was influenced positively by formal education level of the household, experience in sorghum farming, membership in farmers associations, use of hired labour, production advice, and use of manure. Surprisingly household size, meant to enhance labour, had a negative influence. To increase technical efficiency, efforts should focus on improving information flows on agronomic practices. Farmers should also be encouraged to form and actively participate in various farmers associations, which enhance learning and pooling of labour resources, hence improving technical efficiency.
Directory of Open Access Journals (Sweden)
Mayra Montiel
2006-06-01
Full Text Available Se estudió la ultraestructura anatómica de la lámina y la vaina de la hoja, así como de la bráctea del culmo, de Guadua angustifolia var. bicolor, por medio del microscopio electrónico de barrido. Se encontraron similitudes con otras guaduas: estomas de alto domo, células largas con paredes sinuosas y células de sílice. Son propios de la var. bicolor el patrón estomático en la zona abaxial de la hoja cerca de la vaina, con la presencia de gran cantidad de tricomas ganchudos y sin papilas; las brácteas de color café dorado que cubren los culmos y tienen tricomas papilares que cubren el haz; y el abundante número de tricomas auriculares, en grupos de 12.The anatomy of several parts of Guadua angustifolia var. bicolor was analyzed and characterized under a scanning electron icroscope. any similarities ere observed with other Guadua species, particularly the presence of high dome stomata, of large cells with sinuous walls and of silica cells. Specific bicolor characteristics include (1 a different stomatal pattern in the adaxial zone of the leaf base (close to the sheath; (2 the abundance of hook-sshaped trichomes without papilla; (3 the distinctive golden brown color of the bract that covers the culm (caused by papillar trichomes that cover the adaxial sheath; and (4 the size of the groups of auricular trichomes (formed by 12 trichomes. Rev. Biol. Trop. 54(Suppl. 2: 13-19. Epub 2006 Dec. 01.
South. Afr.J. Educ.Sci.Technol.2(1) (2007)
African Journals Online (AJOL)
PNR841, Pennisetum purpureum cvv. Napier SDPP 19 and Bana, Chloris gayana ... Bana, Napier, Sorghum bicolor, Chloris gayana and Cynodon inlemfluensis on the sandy, sandy loam and sandy clay loam soils. On the clay soil, the .... of experimental plots, which included seedbed preparation, planting, weeding and ...
Evaluation of some handling and processing parameters for ...
African Journals Online (AJOL)
Biomass materials require reduction and densification for the purpose of handling and space requirements. Guinea corn (Sorghum bi-color) is a major source of biomass material in the tropic regions. The densification process involves some measurable parameters, namely: pressure, particles size and binder ratio. Guinea ...
Energy sorghum--a genetic model for the design of C4 grass bioenergy crops.
Mullet, John; Morishige, Daryl; McCormick, Ryan; Truong, Sandra; Hilley, Josie; McKinley, Brian; Anderson, Robert; Olson, Sara N; Rooney, William
2014-07-01
Sorghum is emerging as an excellent genetic model for the design of C4 grass bioenergy crops. Annual energy Sorghum hybrids also serve as a source of biomass for bioenergy production. Elucidation of Sorghum's flowering time gene regulatory network, and identification of complementary alleles for photoperiod sensitivity, enabled large-scale generation of energy Sorghum hybrids for testing and commercial use. Energy Sorghum hybrids with long vegetative growth phases were found to accumulate more than twice as much biomass as grain Sorghum, owing to extended growing seasons, greater light interception, and higher radiation use efficiency. High biomass yield, efficient nitrogen recycling, and preferential accumulation of stem biomass with low nitrogen content contributed to energy Sorghum's elevated nitrogen use efficiency. Sorghum's integrated genetics-genomics-breeding platform, diverse germplasm, and the opportunity for annual testing of new genetic designs in controlled environments and in multiple field locations is aiding fundamental discovery, and accelerating the improvement of biomass yield and optimization of composition for biofuels production. Recent advances in wide hybridization between Sorghum and other C4 grasses could allow the deployment of improved genetic designs of annual energy Sorghums in the form of wide-hybrid perennial crops. The current trajectory of energy Sorghum genetic improvement indicates that it will be possible to sustainably produce biofuels from C4 grass bioenergy crops that are cost competitive with petroleum-based transportation fuels. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Sorghum - An alternative energy crop for marginal lands and reclamation sites
Lukas, Stefan; Theiß, Markus; Jäkel, Kerstin
2017-04-01
The production of biogas and the associated cultivation of energy crops are still of great importance. Considering increasing restrictions for the cultivation of standard biogas crop maize regarding an environmentally friendly production of biomass, a wider range of energy crops is needed. The cultivation of sorghum can contribute to this. As maize, sorghum is a C4-plant and offers a high biomass yield potential. Originated in the semi-arid tropics, sorghum is well adapted to warm and dry climate and particularly noted for its drought tolerance compared to maize. It also makes few demands on soil quality and shows a good capability of nutrient acquisition. Therefore, particularly on marginal areas and reclamation sites with low soil nutrient and water content sorghum can contribute to secure crop yield and income of farmers. The applied research project aims at and reflects on the establishment of sorghum as a profitable and ecological friendly cropping alternative to maize, especially in the face of probable climate change with increasing risks for agriculture. For this purpose, site differentiated growing and cultivar trials with a standardized planting design as well as several practical on-farm field experiments were conducted. The agronomical and economic results will lead to scientifically based procedures and standards for agricultural practice with respect to cultivation methods (drilling, pest-management, fertilization), cropping sequence and technique, cropping period or position in crop rotation. Even by now there is a promising feedback from the agricultural practice linked with an increasing demand for information. Moreover, the specific cropping area is increasing continuously. Therefore, the leading signs for the establishment of sorghum as profitable alternative to maize biogas production are positive. Sorghum cultures perform best as main crops in the warm D locations in the middle and East German dry areas. Here, the contribution margin
Karakteristik Sensori dan Fisiko-Kimia Beras Analog Sorghum dengan Penambahan Rempah Campuran
Directory of Open Access Journals (Sweden)
Maya Indra Rasyid
2017-02-01
Full Text Available The purpose of this study was to obtain the formula of sorghum rice analogue by mixed spices addition with acceptable sensory and physico-chemical characteristics. The selection of sorghum rice analogue formula was tested by using hedonic test with 70 untrained panelists. The addition of mixed spices powder was as follows: 30 % onion, 20 % garlic, 10 % bay leaves, 20 % ginger and 20 % lemongrass. Those mixed spices powder were added to the sorghum rice analogue at percentage of 0.25 %, 0,5 %, 1 %, 2 %, 3 % and 0 % (control from total dough weight. The sorghum rice analogue was made using extrusion technology (a twin screw extruder. The overall sensory evaluation result showed that the addition of spice mixed had significant effect (p ≤ 0.05 on the characteristics of sorghum rice analogue. The panelists accepted the sorghum rice analogue with 1% mixed spice. The preferred formulation was the addition of 1% mixed spice which contain of 9.56 % moisture, 0.72 % ash, 0.53 % fat, 6.22 % protein, 92.53 % carbohydrate, 26.48 % amyloseand 6,67 % dietary fiber. Sorghum rice analogue enriched by spices is a potential as a rich fiber source. ABSTRAK Tujuan penelitian adalah mendapatkan formula beras analog berbahan dasar sorgum dengan penambahan rempah campuran yang dapat diterima secara sensori. Pemilihan formula dilakukan dengan uji hedonik menggunakan 70 orang panelis tidak terlatih. Rempah yang ditambahkan berupa bubuk rempah campuran yang terdiri atas bawang merah 30%, bawang putih 20 %, daun salam 10 %, jahe 20 % dan sereh 20 %. Penambahan bubuk rempah campuran untuk pembuatan beras analog sorghum berturut-turut 0,25 %, 0,5 %, 1 %, 2 %, 3 % dan kontrol (tanpa rempah dari total berat adonan diluar air. Beras analog sorghum dibuat dengan teknologi ekstrusi menggunakan ekstruder ulir ganda. Hasil uji sensori secara keseluruhan menunjukkan bahwa penambahan rempah campuran berpengaruh nyata (p <0,05 terhadap nasi beras analog yang dihasilkan
Effect of gamma irradiation on chemical composition and nutritive value of sorghum grains
International Nuclear Information System (INIS)
Mekkawy, S.H.
1996-01-01
Sorghum grains were gamma irradiated at 0, 10, 50, 100, 150 and 200 KGy doses using cobalt-60 source. Irradiated and unirradiated sorghum samples were analyzed for crude fiber contents, total nitrogen, fat, ash and tannic acid. Neutral-detergent fiber (NDF), acid-detergent fiber (ADF) and acid detergent lignin (ADL) were also determined. In addition, digestibility coefficient received special attention. The irradiated sorghum grains were incorporated into basal diets and fed to rats during the digestion trials. The results indicated that gamma irradiation had no effects on total nitrogen, fat and ash contents of sorghum grains. Irradiation treatments of sorghum did not cause a pronounced effect on tannic acid content even those received the highest irradiation dose (200 kGy). Moreover, the irradiation treatments decreased the NDF content of sorghum especially those subjected to 100 or 200 kGy. On the other hand, the ADF and ADL values did not show a remarkable change due to irradiation treatments. Hemicellulose content was decreased with the increase of irradiation dose levels. Also, it was noticed that feeding rats on basal diets enriched with irradiated sorghum grains had a beneficial effects on digestibility coefficient. This trend was obvious with animals supplemented with sorghum grains subjected to the relatively high irradiation dose levels. 4 tabs