WorldWideScience

Sample records for volume 1e documentation

  1. The Einstein Observatory catalog of IPC x ray sources. Volume 1E: Documentation

    Science.gov (United States)

    Harris, D. E.; Forman, W.; Gioia, I. M.; Hale, J. A.; Harnden, F. R., Jr.; Jones, C.; Karakashian, T.; Maccacaro, T.; Mcsweeney, J. D.; Primini, F. A.

    1993-01-01

    The Einstein Observatory (HEAO-2, launched November 13, 1978) achieved radically improved sensitivity over previous x-ray missions through the use of focusing optics, which simultaneously afforded greatly reduced background and produced true images. During its 2.5-yr mission, the Einstein X-Ray Telescope was pointed toward some 5,000 celestial targets, most of which were detected, and discovered several thousand additional 'serendipitous' sources in the observed fields. This catalog contains contour diagrams and source data, obtained with the imaging proportional counter in the 0.16 to 3.5 keV energy band, and describes methods for recovering upper limits for any sky position within the observed images. The main catalog consists of six volumes (numbered 2 through 7) of right ascension ordered pages, each containing data for one observation. Along with the primary documentation describing how the catalog was constructed, volume 1 contains a complete source list, results for merged fields, a reference system to published papers, and data useful for calculating upper limits and fluxes.

  2. Sandia Software Guidelines, Volume 2. Documentation

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    This volume is one in a series of Sandia Software Guidelines intended for use in producing quality software within Sandia National Laboratories. In consonance with the IEEE Standards for software documentation, this volume provides guidance in the selection of an adequate document set for a software project and example formats for many types of software documentation. A tutorial on life cycle documentation is also provided. Extended document thematic outlines and working examples of software documents are available on electronic media as an extension of this volume.

  3. DART II documentation. Volume III. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-10-01

    The DART II is a remote, interactive, microprocessor-based data acquistion system suitable for use with air monitors. This volume of DART II documentation contains the following appendixes: adjustment and calibration procedures; mother board signature list; schematic diagrams; device specification sheets; ROM program listing; 6800 microprocessor instruction list, octal listing; and cable lists. (RWR)

  4. DART II documentation. Volume III. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-05-23

    The DART II is a data acquisition system that can be used with air pollution monitoring equipment. This volume contains appendices that deal with the following topics: adjustment and calibration procedures (power supply adjustment procedure, ADC calibration procedure, analog multiplexer calibration procedure); mother board signature list; schematic diagrams; device specification sheets (microprocessor, asynchronous receiver/transmitter, analog-to-digital converter, arithmetic processing unit, 5-volt power supply, +- 15-volt power supply, 24-volt power supply, floppy disk formater/controller, random access static memory); ROM program listing; 6800 microprocessor instruction set, octal listing; and cable lists. (RR)

  5. Guidance and Control Software Project Data - Volume 2: Development Documents

    Science.gov (United States)

    Hayhurst, Kelly J. (Editor)

    2008-01-01

    The Guidance and Control Software (GCS) project was the last in a series of software reliability studies conducted at Langley Research Center between 1977 and 1994. The technical results of the GCS project were recorded after the experiment was completed. Some of the support documentation produced as part of the experiment, however, is serving an unexpected role far beyond its original project context. Some of the software used as part of the GCS project was developed to conform to the RTCA/DO-178B software standard, "Software Considerations in Airborne Systems and Equipment Certification," used in the civil aviation industry. That standard requires extensive documentation throughout the software development life cycle, including plans, software requirements, design and source code, verification cases and results, and configuration management and quality control data. The project documentation that includes this information is open for public scrutiny without the legal or safety implications associated with comparable data from an avionics manufacturer. This public availability has afforded an opportunity to use the GCS project documents for DO-178B training. This report provides a brief overview of the GCS project, describes the 4-volume set of documents and the role they are playing in training, and includes the development documents from the GCS project. Volume 2 contains three appendices: A. Guidance and Control Software Development Specification; B. Design Description for the Pluto Implementation of the Guidance and Control Software; and C. Source Code for the Pluto Implementation of the Guidance and Control Software

  6. Guidance and Control Software Project Data - Volume 1: Planning Documents

    Science.gov (United States)

    Hayhurst, Kelly J. (Editor)

    2008-01-01

    The Guidance and Control Software (GCS) project was the last in a series of software reliability studies conducted at Langley Research Center between 1977 and 1994. The technical results of the GCS project were recorded after the experiment was completed. Some of the support documentation produced as part of the experiment, however, is serving an unexpected role far beyond its original project context. Some of the software used as part of the GCS project was developed to conform to the RTCA/DO-178B software standard, "Software Considerations in Airborne Systems and Equipment Certification," used in the civil aviation industry. That standard requires extensive documentation throughout the software development life cycle, including plans, software requirements, design and source code, verification cases and results, and configuration management and quality control data. The project documentation that includes this information is open for public scrutiny without the legal or safety implications associated with comparable data from an avionics manufacturer. This public availability has afforded an opportunity to use the GCS project documents for DO-178B training. This report provides a brief overview of the GCS project, describes the 4-volume set of documents and the role they are playing in training, and includes the planning documents from the GCS project. Volume 1 contains five appendices: A. Plan for Software Aspects of Certification for the Guidance and Control Software Project; B. Software Development Standards for the Guidance and Control Software Project; C. Software Verification Plan for the Guidance and Control Software Project; D. Software Configuration Management Plan for the Guidance and Control Software Project; and E. Software Quality Assurance Activities.

  7. Guidance and Control Software Project Data - Volume 3: Verification Documents

    Science.gov (United States)

    Hayhurst, Kelly J. (Editor)

    2008-01-01

    The Guidance and Control Software (GCS) project was the last in a series of software reliability studies conducted at Langley Research Center between 1977 and 1994. The technical results of the GCS project were recorded after the experiment was completed. Some of the support documentation produced as part of the experiment, however, is serving an unexpected role far beyond its original project context. Some of the software used as part of the GCS project was developed to conform to the RTCA/DO-178B software standard, "Software Considerations in Airborne Systems and Equipment Certification," used in the civil aviation industry. That standard requires extensive documentation throughout the software development life cycle, including plans, software requirements, design and source code, verification cases and results, and configuration management and quality control data. The project documentation that includes this information is open for public scrutiny without the legal or safety implications associated with comparable data from an avionics manufacturer. This public availability has afforded an opportunity to use the GCS project documents for DO-178B training. This report provides a brief overview of the GCS project, describes the 4-volume set of documents and the role they are playing in training, and includes the verification documents from the GCS project. Volume 3 contains four appendices: A. Software Verification Cases and Procedures for the Guidance and Control Software Project; B. Software Verification Results for the Pluto Implementation of the Guidance and Control Software; C. Review Records for the Pluto Implementation of the Guidance and Control Software; and D. Test Results Logs for the Pluto Implementation of the Guidance and Control Software.

  8. Assurance specification documentation standard and Data Item Descriptions (DID). Volume of the information system life-cycle and documentation standards, volume 4

    Science.gov (United States)

    Callender, E. David; Steinbacher, Jody

    1989-01-01

    This is the fourth of five volumes on Information System Life-Cycle and Documentation Standards. This volume provides a well organized, easily used standard for assurance documentation for information systems and software, hardware, and operational procedures components, and related processes. The specifications are developed in conjunction with the corresponding management plans specifying the assurance activities to be performed.

  9. Product specification documentation standard and Data Item Descriptions (DID). Volume of the information system life-cycle and documentation standards, volume 3

    Science.gov (United States)

    Callender, E. David; Steinbacher, Jody

    1989-01-01

    This is the third of five volumes on Information System Life-Cycle and Documentation Standards which present a well organized, easily used standard for providing technical information needed for developing information systems, components, and related processes. This volume states the Software Management and Assurance Program documentation standard for a product specification document and for data item descriptions. The framework can be applied to any NASA information system, software, hardware, operational procedures components, and related processes.

  10. State energy price system. Volume I: overview and technical documentation

    Energy Technology Data Exchange (ETDEWEB)

    Fang, J.M.; Nieves, L.A.; Sherman, K.L.; Hood, L.J.

    1982-06-01

    This study utilizes existing data sources and previous analyses of state-level energy prices to develop consistent state-level energy prices series by fuel type and by end-use sector. The fuels are electricity, natural gas, coal, distillate fuel oil, motor gasoline, diesel, kerosene, jet fuel, residual fuel, and liquefied petroleum gas. The end-use sectors are residential, commercial, industrial, transportation, and electric utility. Based upon an evaluation of existing data sources, recommendations were formulated on the feasible approaches for developing a consistent state energy price series. The data series were compiled based upon the approaches approved after a formal EIA review. Detailed documentation was provided, including annual updating procedures. Recommendations were formulated for future improvements in the collection of data or in data processing. Generally, the geographical coverage includes the 50 states and the District of Columbia. Information on state-level energy use was generally taken from the State Energy Data System (SEDS). Corresponding average US prices are also developed using volumes reported in SEDS. To the extent possible, the prices developed are quantity weighted average retail prices. Both a Btu price series and a physical unit price series are developed for each fuel. The period covered by the data series is 1970 through 1980 for most fuels, though prices for electricity and natural gas extend back to 1960. (PSB)

  11. Information system life-cycle and documentation standards, volume 1

    Science.gov (United States)

    Callender, E. David; Steinbacher, Jody

    1989-01-01

    The Software Management and Assurance Program (SMAP) Information System Life-Cycle and Documentation Standards Document describes the Version 4 standard information system life-cycle in terms of processes, products, and reviews. The description of the products includes detailed documentation standards. The standards in this document set can be applied to the life-cycle, i.e., to each phase in the system's development, and to the documentation of all NASA information systems. This provides consistency across the agency as well as visibility into the completeness of the information recorded. An information system is software-intensive, but consists of any combination of software, hardware, and operational procedures required to process, store, or transmit data. This document defines a standard life-cycle model and content for associated documentation.

  12. Management control and status reports documentation standard and Data Item Descriptions (DID). Volume of the information system life-cycle and documentation standards, volume 5

    Science.gov (United States)

    Callender, E. David; Steinbacher, Jody

    1989-01-01

    This is the fifth of five volumes on Information System Life-Cycle and Documentation Standards. This volume provides a well organized, easily used standard for management control and status reports used in monitoring and controlling the management, development, and assurance of informations systems and software, hardware, and operational procedures components, and related processes.

  13. Management plan documentation standard and Data Item Descriptions (DID). Volume of the information system life-cycle and documentation standards, volume 2

    Science.gov (United States)

    Callender, E. David; Steinbacher, Jody

    1989-01-01

    This is the second of five volumes of the Information System Life-Cycle and Documentation Standards. This volume provides a well-organized, easily used standard for management plans used in acquiring, assuring, and developing information systems and software, hardware, and operational procedures components, and related processes.

  14. Dynamic Displays for Tactical Planning. Volume 3. Software Documentation

    Science.gov (United States)

    1979-12-01

    7 STAI T=EVTPTR C *~*SHIF! MoF I(- MAKE ThUM 16. MCTIUA BLOCK FCR GREEN ACTIi’ KEL_’f9.J PTRPlP=LF-LPTR+lsLJSLZ-1 ACTPlk=MDF(PTRPTk’) ST ART =ACTPTR 8...IN2 9 ML Z LSP= (’fN2-~iN 0* 12000+ %IL2-rlL I IF(LSP.GT.4C,)G~i TO 300 DO 315 K~lv400 315 C0i𔃾INUE Ii-( lATT (1).E.0L, TO J12 IU-IATT(1).N-.36.CR.IATT(3...0 ?nl IF ( lATT (i).NL.-𔃾) GO TO 30 KEY=ITEM P +34 GO TO 1000 3, It- ( IA TT 1l).Nl:.32) GO TC 40 u&EY=130kJO*IATI (; GL, TO 1000 4,j IF IIATI1.NE.30

  15. MARA (Multimode Airborne Radar Altimeter) system documentation. Volume 1: MARA system requirements document

    Science.gov (United States)

    Parsons, C. L. (Editor)

    1989-01-01

    The Multimode Airborne Radar Altimeter (MARA), a flexible airborne radar remote sensing facility developed by NASA's Goddard Space Flight Center, is discussed. This volume describes the scientific justification for the development of the instrument and the translation of these scientific requirements into instrument design goals. Values for key instrument parameters are derived to accommodate these goals, and simulations and analytical models are used to estimate the developed system's performance.

  16. Underground Test Area Subproject Phase I Data Analysis Task. Volume VII - Tritium Transport Model Documentation Package

    Energy Technology Data Exchange (ETDEWEB)

    None

    1996-12-01

    Volume VII of the documentation for the Phase I Data Analysis Task performed in support of the current Regional Flow Model, Transport Model, and Risk Assessment for the Nevada Test Site Underground Test Area Subproject contains the tritium transport model documentation. Because of the size and complexity of the model area, a considerable quantity of data was collected and analyzed in support of the modeling efforts. The data analysis task was consequently broken into eight subtasks, and descriptions of each subtask's activities are contained in one of the eight volumes that comprise the Phase I Data Analysis Documentation.

  17. Underground Test Area Subproject Phase I Data Analysis Task. Volume VIII - Risk Assessment Documentation Package

    Energy Technology Data Exchange (ETDEWEB)

    None

    1996-12-01

    Volume VIII of the documentation for the Phase I Data Analysis Task performed in support of the current Regional Flow Model, Transport Model, and Risk Assessment for the Nevada Test Site Underground Test Area Subproject contains the risk assessment documentation. Because of the size and complexity of the model area, a considerable quantity of data was collected and analyzed in support of the modeling efforts. The data analysis task was consequently broken into eight subtasks, and descriptions of each subtask's activities are contained in one of the eight volumes that comprise the Phase I Data Analysis Documentation.

  18. International and United States documents on oceans law and policy. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    Moore, J.N. (ed.)

    1986-01-01

    Volume 2 of the five-volume series continues the major international documents of Volume 1 relating to ocean issues. It groups the documents under three major headings: Cooperative agreements for port regulation and development, Living resources, and Environmental protection. The Living resources section is further divided into Coastal fisheries, Anadromous species, Highly migratory species, and Marine Mammals. Subdivisions under the Environmental protection section are General principles, Regional protection, Vessel-source pollution, Ocean dumping, Land-based pollution, Civil liability and compensation, and Endangered species. The title page for each document includes full citations, although some documents have been edited. A separate abstract was prepared for each of the seven sections under Environmental protection.

  19. Integrating model of the Project Independence Evaluation System. Volume IV. Model documentation

    Energy Technology Data Exchange (ETDEWEB)

    Shaw, M L; Allen, B J; Gale, J E; Lutz, M S; O& #x27; Hara, N E; Wood, R K

    1979-02-01

    This volume is the fourth in a series of seven documenting the PIES Integrating Model. It contains detailed descriptions of the basic assumptions behind each of the components of PIES and how they interact with one another. Chapter II of this volume presents the methodology used to integrate supply and demand. It includes a discussion of both the interface between the Demand Model and the equilibrating mechanism and the various supply models via the equilibrating algorithm used by PIES. Chapters III through IX describe each supply submodel in turn: coal, oil, and natural gas supply, utilities, refineries, advanced technologies, and transportation. Code and data documentation are covered elsewhere in this series (Volumes V and VI respectively). PIES is an evolving system. As this document was being prepared, many parts of the model were being modified. This document describes the PIES Integrating Model as of January 1, 1978.

  20. Underground Test Area Subproject Phase I Data Analysis Task. Volume IV - Hydrologic Parameter Data Documentation Package

    Energy Technology Data Exchange (ETDEWEB)

    None

    1996-09-01

    Volume IV of the documentation for the Phase I Data Analysis Task performed in support of the current Regional Flow Model, Transport Model, and Risk Assessment for the Nevada Test Site Underground Test Area Subproject contains the hydrologic parameter data. Because of the size and complexity of the model area, a considerable quantity of data was collected and analyzed in support of the modeling efforts. The data analysis task was consequently broken into eight subtasks, and descriptions of each subtask's activities are contained in one of the eight volumes that comprise the Phase I Data Analysis Documentation.

  1. Underground Test Area Subproject Phase I Data Analysis Task. Volume VI - Groundwater Flow Model Documentation Package

    Energy Technology Data Exchange (ETDEWEB)

    None

    1996-11-01

    Volume VI of the documentation for the Phase I Data Analysis Task performed in support of the current Regional Flow Model, Transport Model, and Risk Assessment for the Nevada Test Site Underground Test Area Subproject contains the groundwater flow model data. Because of the size and complexity of the model area, a considerable quantity of data was collected and analyzed in support of the modeling efforts. The data analysis task was consequently broken into eight subtasks, and descriptions of each subtask's activities are contained in one of the eight volumes that comprise the Phase I Data Analysis Documentation.

  2. Title list of documents made publicly available, April 1-30, 1995. Volume 17, No. 4

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    This document is NUREG-0540, Volume 17, Number 4. The Title List of Documents Made Publicly Available is a monthly publication, It contains descriptions of the information received and generated by the US NRC. This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by the NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which the NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  3. INTEGRATED AIR POLLUTION CONTROL SYSTEM VERSION 5.0 - VOLUME 2: TECHNICAL DOCUMENTATION

    Science.gov (United States)

    The three volume report and two diskettes document the Integrated Air Pollution Control System (IAPCS), developed for the U.S. EPA to estimate costs and performance for emission control systems applied to coal-fired utility boilers. The model can project a material balance, an eq...

  4. Model documentation Natural Gas Transmission and Distribution Model of the National Energy Modeling System. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-26

    The Natural Gas Transmission and Distribution Model (NGTDM) of the National Energy Modeling System is developed and maintained by the Energy Information Administration (EIA), Office of Integrated Analysis and Forecasting. This report documents the archived version of the NGTDM that was used to produce the natural gas forecasts presented in the Annual Energy Outlook 1996, (DOE/EIA-0383(96)). The purpose of this report is to provide a reference document for model analysts, users, and the public that defines the objectives of the model, describes its basic approach, and provides detail on the methodology employed. Previously this report represented Volume I of a two-volume set. Volume II reported on model performance, detailing convergence criteria and properties, results of sensitivity testing, comparison of model outputs with the literature and/or other model results, and major unresolved issues.

  5. Guidance and Control Software Project Data - Volume 4: Configuration Management and Quality Assurance Documents

    Science.gov (United States)

    Hayhurst, Kelly J. (Editor)

    2008-01-01

    The Guidance and Control Software (GCS) project was the last in a series of software reliability studies conducted at Langley Research Center between 1977 and 1994. The technical results of the GCS project were recorded after the experiment was completed. Some of the support documentation produced as part of the experiment, however, is serving an unexpected role far beyond its original project context. Some of the software used as part of the GCS project was developed to conform to the RTCA/DO-178B software standard, "Software Considerations in Airborne Systems and Equipment Certification," used in the civil aviation industry. That standard requires extensive documentation throughout the software development life cycle, including plans, software requirements, design and source code, verification cases and results, and configuration management and quality control data. The project documentation that includes this information is open for public scrutiny without the legal or safety implications associated with comparable data from an avionics manufacturer. This public availability has afforded an opportunity to use the GCS project documents for DO-178B training. This report provides a brief overview of the GCS project, describes the 4-volume set of documents and the role they are playing in training, and includes configuration management and quality assurance documents from the GCS project. Volume 4 contains six appendices: A. Software Accomplishment Summary for the Guidance and Control Software Project; B. Software Configuration Index for the Guidance and Control Software Project; C. Configuration Management Records for the Guidance and Control Software Project; D. Software Quality Assurance Records for the Guidance and Control Software Project; E. Problem Report for the Pluto Implementation of the Guidance and Control Software Project; and F. Support Documentation Change Reports for the Guidance and Control Software Project.

  6. Integrating model of the Project Independence Evaluation System. Volume VI. Data documentation. Part II

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B J

    1979-02-01

    This documentation describes the PIES Integrating Model as it existed on January 1, 1978. This Volume VI of six volumes is data documentation, containing the standard table data used for the Administrator's Report at the beginning of 1978, along with the primary data sources and the office responsible. It also contains a copy of a PIES Integrating Model Report with a description of its content. Following an overview chapter, Chapter II, Supply and Demand Data Tables and Sources for the Mid-range Scenario for Target Years 1985 and 1990, data on demand, price, and elasticity; coal; imports; oil and gas; refineries; synthetics, shale, and solar/geothermal; transportation; and utilities are presented. The following data on alternate scenarios are discussed: low and high demand; low and high oil and gas supply; refinery and oil and gas data assuming a 5% annual increase in real world oil prices. Chapter IV describes the solution output obtained from an execution of PIES.

  7. Development of the NRC`s Human Performance Investigation Process (HPIP). Volume 3, Development documentation

    Energy Technology Data Exchange (ETDEWEB)

    Paradies, M.; Unger, L. [System Improvements, Inc., Knoxville, TN (United States); Haas, P.; Terranova, M. [Concord Associates, Inc., Knoxville, TN (United States)

    1993-10-01

    The three volumes of this report detail a standard investigation process for use by US Nuclear Regulatory Commission (NRC) personnel when investigating human performance related events at nuclear power plants. The process, called the Human Performance Investigation Process (HPIP), was developed to meet the special needs of NRC personnel, especially NRC resident and regional inspectors. HPIP is a systematic investigation process combining current procedures and field practices, expert experience, NRC human performance research, and applicable investigation techniques. The process is easy to learn and helps NRC personnel perform better field investigations of the root causes of human performance problems. The human performance data gathered through such investigations provides a better understanding of the human performance issues that cause events at nuclear power plants. This document, Volume III, is a detailed documentation of the development effort and the pilot training program.

  8. Results of site validation experiments. Volume II. Supporting documents 5 through 14

    Energy Technology Data Exchange (ETDEWEB)

    1983-01-01

    Volume II contains the following supporting documents: Summary of Geologic Mapping of Underground Investigations; Logging of Vertical Coreholes - ''Double Box'' Area and Exploratory Drift; WIPP High Precision Gravity Survey; Basic Data Reports for Drillholes, Brine Content of Facility Internal Strata; Mineralogical Content of Facility Interval Strata; Location and Characterization of Interbedded Materials; Characterization of Aquifers at Shaft Locations; and Permeability of Facility Interval Strate.

  9. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Document (S/RID) is contained in multiple volumes. This document (Volume 2) presents the standards and requirements for the following sections: Quality Assurance, Training and Qualification, Emergency Planning and Preparedness, and Construction.

  10. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 5

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 5) outlines the standards and requirements for the Fire Protection and Packaging and Transportation sections.

  11. High level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 6

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety.

  12. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 4) presents the standards and requirements for the following sections: Radiation Protection and Operations.

  13. Hanford spent nuclear fuel project recommended path forward, volume III: Alternatives and path forward evaluation supporting documentation

    Energy Technology Data Exchange (ETDEWEB)

    Fulton, J.C.

    1994-10-01

    Volume I of the Hanford Spent Nuclear Fuel Project - Recommended Path Forward constitutes an aggressive series of projects to construct and operate systems and facilities to safely retrieve, package, transport, process, and store K Basins fuel and sludge. Volume II provided a comparative evaluation of four Alternatives for the Path Forward and an evaluation for the Recommended Path Forward. Although Volume II contained extensive appendices, six supporting documents have been compiled in Volume III to provide additional background for Volume II.

  14. Final safety analysis report for the Galileo Mission: Volume 1, Reference design document

    Energy Technology Data Exchange (ETDEWEB)

    1988-05-01

    The Galileo mission uses nuclear power sources called Radioisotope Thermoelectric Generators (RTGs) to provide the spacecraft's primary electrical power. Because these generators contain nuclear material, a Safety Analysis Report (SAR) is required. A preliminary SAR and an updated SAR were previously issued that provided an evolving status report on the safety analysis. As a result of the Challenger accident, the launch dates for both Galileo and Ulysses missions were later rescheduled for November 1989 and October 1990, respectively. The decision was made by agreement between the DOE and the NASA to have a revised safety evaluation and report (FSAR) prepared on the basis of these revised vehicle accidents and environments. The results of this latest revised safety evaluation are presented in this document (Galileo FSAR). Volume I, this document, provides the background design information required to understand the analyses presented in Volumes II and III. It contains descriptions of the RTGs, the Galileo spacecraft, the Space Shuttle, the Inertial Upper Stage (IUS), the trajectory and flight characteristics including flight contingency modes, and the launch site. There are two appendices in Volume I which provide detailed material properties for the RTG.

  15. Advisory Committee on human radiation experiments. Final report, Supplemental Volume 2. Sources and documentation

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-01

    This volume and its appendixes supplement the Advisory Committee`s final report by reporting how we went about looking for information concerning human radiation experiments and intentional releases, a description of what we found and where we found it, and a finding aid for the information that we collected. This volume begins with an overview of federal records, including general descriptions of the types of records that have been useful and how the federal government handles these records. This is followed by an agency-by-agency account of the discovery process and descriptions of the records reviewed, together with instructions on how to obtain further information from those agencies. There is also a description of other sources of information that have been important, including institutional records, print resources, and nonprint media and interviews. The third part contains brief accounts of ACHRE`s two major contemporary survey projects (these are described in greater detail in the final report and another supplemental volume) and other research activities. The final section describes how the ACHRE information-nation collections were managed and the records that ACHRE created in the course of its work; this constitutes a general finding aid for the materials deposited with the National Archives. The appendices provide brief references to federal records reviewed, descriptions of the accessions that comprise the ACHRE Research Document Collection, and descriptions of the documents selected for individual treatment. Also included are an account of the documentation available for ACHRE meetings, brief abstracts of the almost 4,000 experiments individually described by ACHRE staff, a full bibliography of secondary sources used, and other information.

  16. Model documentation: Natural Gas Transmission and Distribution Model of the National Energy Modeling System; Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-02-24

    The Natural Gas Transmission and Distribution Model (NGTDM) is a component of the National Energy Modeling System (NEMS) used to represent the domestic natural gas transmission and distribution system. NEMS is the third in a series of computer-based, midterm energy modeling systems used since 1974 by the Energy Information Administration (EIA) and its predecessor, the Federal Energy Administration, to analyze domestic energy-economy markets and develop projections. This report documents the archived version of NGTDM that was used to produce the natural gas forecasts used in support of the Annual Energy Outlook 1994, DOE/EIA-0383(94). The purpose of this report is to provide a reference document for model analysts, users, and the public that defines the objectives of the model, describes its basic design, provides detail on the methodology employed, and describes the model inputs, outputs, and key assumptions. It is intended to fulfill the legal obligation of the EIA to provide adequate documentation in support of its models (Public Law 94-385, Section 57.b.2). This report represents Volume 1 of a two-volume set. (Volume 2 will report on model performance, detailing convergence criteria and properties, results of sensitivity testing, comparison of model outputs with the literature and/or other model results, and major unresolved issues.) Subsequent chapters of this report provide: (1) an overview of the NGTDM (Chapter 2); (2) a description of the interface between the National Energy Modeling System (NEMS) and the NGTDM (Chapter 3); (3) an overview of the solution methodology of the NGTDM (Chapter 4); (4) the solution methodology for the Annual Flow Module (Chapter 5); (5) the solution methodology for the Distributor Tariff Module (Chapter 6); (6) the solution methodology for the Capacity Expansion Module (Chapter 7); (7) the solution methodology for the Pipeline Tariff Module (Chapter 8); and (8) a description of model assumptions, inputs, and outputs (Chapter 9).

  17. Integrating model of the Project Independence Evaluation System. Volume VI. Data documentation. Part I

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B J

    1979-02-01

    This documentation describes the PIES Integrating Model as it existed on January 1, 1978. This volume contains two chapters. In Chapter I, Overview, the following subjects are briefly described: supply data, EIA projection series and scenarios, demand data and assumptions, and supply assumptions - oil and gas availabilities. Chapter II contains supply and demand data tables and sources used by the PIES Integrating Model for the mid-range scenario target years 1985 and 1990. Tabulated information is presented for demand, price, and elasticity data; coal data; imports data; oil and gas data; refineries data; synthetics, shale, and solar/geothermal data; transportation data; and utilities data.

  18. Integrating model of the Project Independence Evaluation System. Volume V. Code documentation

    Energy Technology Data Exchange (ETDEWEB)

    Shaw, M L; Allen, B J; Lutz, M S; Gale, J E; O& #x27; Hara, N E; Wood, R K

    1978-07-01

    This volume is a description of the Project Independence Evaluation System as a computer system. It is intended for readers wanting a basic understanding of the computer implementation of PIES rather than an understanding of the modeling methodology. It can assist those who wish to run PIES on the EIA computer facility or to use PIES on their own facilities, or to analyze the PIES computer processing. The document contains: an overview of the computer implementation; a description of the data and naming conventions used in PIES; a functional description of PIES data processing; PIES hardware and software requirements; and an operational description of the PIES processing flow. This overview defines the scope of PIES in this report and thus governs the computer system descriptions that follow. It also provides an historical view of the development of PIES.

  19. Final safety analysis report for the Galileo Mission: Volume 2, Book 2: Accident model document: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1988-12-15

    This section of the Accident Model Document (AMD) presents the appendices which describe the various analyses that have been conducted for use in the Galileo Final Safety Analysis Report II, Volume II. Included in these appendices are the approaches, techniques, conditions and assumptions used in the development of the analytical models plus the detailed results of the analyses. Also included in these appendices are summaries of the accidents and their associated probabilities and environment models taken from the Shuttle Data Book (NSTS-08116), plus summaries of the several segments of the recent GPHS safety test program. The information presented in these appendices is used in Section 3.0 of the AMD to develop the Failure/Abort Sequence Trees (FASTs) and to determine the fuel releases (source terms) resulting from the potential Space Shuttle/IUS accidents throughout the missions.

  20. Exploring the Unknown: Selected Documents in the History of the US Civil Space Program. Volume 5; Exploring the Cosmos

    Science.gov (United States)

    Logsdon, John M. (Editor); Snyder, Amy Paige (Editor); Launius, Roger D. (Editor); Garber, Stephen J. (Editor); Newport, Regan Anne (Editor)

    2001-01-01

    The documents selected for inclusion in this volume are presented in three major sections, each covering a particular aspect of the origins, evolution, and execution of the US space science program. Chapter 1 deals with the origins, evolution, and organization of the space science program. Chapter 2 deals with the solar system exploration. Chapter 3 deals with NASA's astronomy and astrophysics efforts. Each chapter in the present volume is introduced by an overview essay. In the main, these essays are intended to introduce and complement the documents in the chapter and to place them in a chronological and substantive context. Each essay contains references to the documents in the chapter it introduces, and may also contain references to documents in other chapters of the collection

  1. Underground Test Area Subproject Phase I Data Analysis Task. Volume III - Groundwater Recharge and Discharge Data Documentation Package

    Energy Technology Data Exchange (ETDEWEB)

    None

    1996-10-01

    Volume III of the documentation for the Phase I Data Analysis Task performed in support of the current Regional Flow Model, Transport Model, and Risk Assessment for the Nevada Test Site Underground Test Area Subproject contains the data covering groundwater recharge and discharge. Because of the size and complexity of the model area, a considerable quantity of data was collected and analyzed in support of the modeling efforts. The data analysis task was consequently broken into eight subtasks, and descriptions of each subtask's activities are contained in one of the eight volumes that comprise the Phase I Data Analysis Documentation.

  2. Preconstruction Engineering and Design Phase Reevaluation Report, Olcott Harbor Project, Olcott, New York. Volume 2, Supporting Documentation. Revision.

    Science.gov (United States)

    1992-09-01

    RPEDE3TCIAN 8910&C ABOTNIEA.-l PE3(C Computed by .3 NE -Chocked by i=-L Date FE8 071I Steei IPipe . P’1e.5 2- Tota I bffl;J~e #Xe&C-tfe& eC+IAQs I0 ~~ 3...Formulas for Smooth Slopes, ASCE Journal of Waterway, Port, Coastal, and Ocean Engineering, Volume 3, No. 1. 3. Leerkrecht, D.A., A. Sauwalski, A.R

  3. Impact of an electronic health record operating room management system in ophthalmology on documentation time, surgical volume, and staffing.

    Science.gov (United States)

    Sanders, David S; Read-Brown, Sarah; Tu, Daniel C; Lambert, William E; Choi, Dongseok; Almario, Bella M; Yackel, Thomas R; Brown, Anna S; Chiang, Michael F

    2014-05-01

    Although electronic health record (EHR) systems have potential benefits, such as improved safety and quality of care, most ophthalmology practices in the United States have not adopted these systems. Concerns persist regarding potential negative impacts on clinical workflow. In particular, the impact of EHR operating room (OR) management systems on clinical efficiency in the ophthalmic surgery setting is unknown. To determine the impact of an EHR OR management system on intraoperative nursing documentation time, surgical volume, and staffing requirements. For documentation time and circulating nurses per procedure, a prospective cohort design was used between January 10, 2012, and January 10, 2013. For surgical volume and overall staffing requirements, a case series design was used between January 29, 2011, and January 28, 2013. This study involved ophthalmic OR nurses (n = 13) and surgeons (n = 25) at an academic medical center. Electronic health record OR management system implementation. (1) Documentation time (percentage of operating time documenting [POTD], absolute documentation time in minutes), (2) surgical volume (procedures/time), and (3) staffing requirements (full-time equivalents, circulating nurses/procedure). Outcomes were measured during a baseline period when paper documentation was used and during the early (first 3 months) and late (4-12 months) periods after EHR implementation. There was a worsening in total POTD in the early EHR period (83%) vs paper baseline (41%) (P system implementation was associated with worsening of intraoperative nursing documentation time especially in shorter procedures. However, it is possible to implement an EHR OR management system without serious negative impacts on surgical volume and staffing requirements.

  4. Environmental Sensitivity Index (ESI) Atlas: East Florida, maps in portable document format, Volume 1, Volume 2 (NODC Accession 0004150)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set comprises the Environmental Sensitivity Index (ESI) maps in Portable Document Format (.PDF) for the shoreline of East Florida (to encompass the coastal...

  5. 39 CFR 3050.26 - Documentation of demand elasticities and volume forecasts.

    Science.gov (United States)

    2010-07-01

    ... Postal Service shall provide econometric estimates of demand elasticity for all postal products accompanied by the underlying econometric models and the input data sets used; and a volume forecast for the current fiscal year, and the underlying volume forecasting model....

  6. Endo Atmospheric-Exo Atmospheric Radar Modeling. Volume II. Part I. Computer Program Documentation.

    Science.gov (United States)

    1976-06-01

    dimension of the clutter volume in degrees AZO00 0 F Clutter volume starting azimuth angle. MM 0 1 Number of clutter volume azimuth increments. ELEXT 0 F...DELAZ - AZEXT/MM DELEL Elevation increment between clutter scatterers. DELEL = ELEXT /NN ICFLG This parameter is set to 1 if the clutter model has been

  7. Programa Estrategico do desenvolvimento 1968-70: Area Estrategica IX. Infra-estructura Social. Educacao e Recursos Humanos, 1 e 2 (Strategic Development Program 1968-1970: Strategic Area IX. Education and Human Resources, Volumes 1 & 2).

    Science.gov (United States)

    Brazil.

    This document is an English-language abstract (approximately 1,500 words) of a two volume work dealing with education and human resources as part of the Brazilian Government's Strategic Development Program 1968-70. It offers an integral view of education as an instrument of social transformation and an exposition of the quantitative and…

  8. Programa Estrategico do desenvolvimento 1968-70: Area Estrategica IX. Infra-estructura Social. Educacao e Recursos Humanos, 1 e 2 (Strategic Development Program 1968-1970: Strategic Area IX. Education and Human Resources, Volumes 1 & 2).

    Science.gov (United States)

    Brazil.

    This document is an English-language abstract (approximately 1,500 words) of a two volume work dealing with education and human resources as part of the Brazilian Government's Strategic Development Program 1968-70. It offers an integral view of education as an instrument of social transformation and an exposition of the quantitative and…

  9. Advisory Committee on human radiation experiments. Supplemental Volume 2a, Sources and documentation appendices. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-01

    This large document provides a catalog of the location of large numbers of reports pertaining to the charge of the Presidential Advisory Committee on Human Radiation Research and is arranged as a series of appendices. Titles of the appendices are Appendix A- Records at the Washington National Records Center Reviewed in Whole or Part by DoD Personnel or Advisory Committee Staff; Appendix B- Brief Descriptions of Records Accessions in the Advisory Committee on Human Radiation Experiments (ACHRE) Research Document Collection; Appendix C- Bibliography of Secondary Sources Used by ACHRE; Appendix D- Brief Descriptions of Human Radiation Experiments Identified by ACHRE, and Indexes; Appendix E- Documents Cited in the ACHRE Final Report and other Separately Described Materials from the ACHRE Document Collection; Appendix F- Schedule of Advisory Committee Meetings and Meeting Documentation; and Appendix G- Technology Note.

  10. Proposed Site Treatment Plan (PSTP). Volumes 1 and 2 and Reference Document

    Energy Technology Data Exchange (ETDEWEB)

    Helmich, E.; Noller, D.K.; Wierzbicki, K.S.; Bailey, L.L.

    1994-12-22

    The Compliance Plan Volume provides overall schedules with target dates for achieving compliance with the land disposal restrictions (LDR) and contains procedures to establish milestones to be enforced under the Order. Information regarding the technical evaluation of treatment options for SRS mixed wastes is contained in the Background Volume and is provided for informational purposes only.

  11. Title list of documents made publicly available: February 1--28, 1995. Volume 17, Number 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR).

  12. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 7. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Burt, D.L.

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 7) presents the standards and requirements for the following sections: Occupational Safety and Health, and Environmental Protection.

  13. Environmental resource document for the Idaho National Engineering Laboratory. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    Irving, J.S.

    1993-07-01

    This document contains information related to the environmental characterization of the Idaho National Engineering Laboratory (INEL). The INEL is a major US Department of Energy facility in southeastern Idaho dedicated to nuclear research, waste management, environmental restoration, and other activities related to the development of technology. Environmental information covered in this document includes land, air, water, and ecological resources; socioeconomic characteristics and land use; and cultural, aesthetic, and scenic resources.

  14. Title list of documents made publicly available, September 1--30, 1994. Volume 16, No. 9

    Energy Technology Data Exchange (ETDEWEB)

    1994-11-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  15. Title list of documents made publicly available, December 1--31, 1991. Volume 13, No. 12

    Energy Technology Data Exchange (ETDEWEB)

    None

    1992-02-01

    This document is a monthly containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  16. Title list of documents made publicly available, November 1--30, 1994. Volume 16, No. 11

    Energy Technology Data Exchange (ETDEWEB)

    1995-01-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  17. Title list of documents made publicly available. Volume 17, No. 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal author, corporate source, report number, and cross reference of enclosures to principal documents.

  18. Title list of documents made publicly available: November 1--30, 1997. Volume 19, Number 11

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-01-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  19. Title list of documents made publicly available. Volume 17, No. 10

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  20. Title list of documents made publicly available, January 1--31, 1994. Volume 16, No. 1

    Energy Technology Data Exchange (ETDEWEB)

    None

    1994-03-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulator agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  1. Title list of documents made publicly available, August 1--31, 1993. Volume 15, No. 8

    Energy Technology Data Exchange (ETDEWEB)

    1993-10-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory commission (NRC). This information includes docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  2. Title list of documents made publicly available: December 1--31, 1996. Volume 18, Number 12

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  3. Title list of documents made publicly available: August 1--31, 1997. Volume 19, Number 8

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-10-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  4. Environmental resource document for the Idaho National Engineering Laboratory. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Irving, J.S.

    1993-07-01

    This document contains information related to the environmental characterization of the Idaho National Engineering Laboratory (INEL). The INEL is a major US Department of Energy facility in southeastern Idaho dedicated to nuclear research, waste management, environmental restoration, and other activities related to the development of technology. Environmental information covered in this document includes land, air, water, and ecological resources; socioeconomic characteristics and land use; and cultural, aesthetic, and scenic resources.

  5. Title List of documents made publicly available, September 1--30, 1993. Volume 15, No. 9

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principals Documents.

  6. Title list of documents made publicly available, December 1--31, 1995. Volume 17, No. 12

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  7. Title list of documents made publicly available, March 1--31, 1995: Volume 17, No. 3

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users. See NOTES at the end of the preface for information about reaching the PDR. Microfiche of the docketed information listed in the Title List is available for sale on a subscription basis from the National Technical Information Service (NTIS).

  8. Title list of documents made publicly available: October 1--31, 1994. Volume 16, Number 10

    Energy Technology Data Exchange (ETDEWEB)

    1994-12-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  9. Title list of documents made publicly available: February 1--29, 1996. Volume 18, Number 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  10. Title list of documents made publicly available. Volume 16, Number 5

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The Title List of Documents Made Publicly Available contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  11. Title list of documents made publicly available: May 1--31, 1997. Volume 19, Number 5

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  12. MPS Solidification Model. Volume 2: Operating guide and software documentation for the unsteady model

    Science.gov (United States)

    Maples, A. L.

    1981-01-01

    The operation of solidification Model 2 is described and documentation of the software associated with the model is provided. Model 2 calculates the macrosegregation in a rectangular ingot of a binary alloy as a result of unsteady horizontal axisymmetric bidirectional solidification. The solidification program allows interactive modification of calculation parameters as well as selection of graphical and tabular output. In batch mode, parameter values are input in card image form and output consists of printed tables of solidification functions. The operational aspects of Model 2 that differ substantially from Model 1 are described. The global flow diagrams and data structures of Model 2 are included. The primary program documentation is the code itself.

  13. Title list of documents made publicly available, March 1--31, 1998. Volume 20, Number 3

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-05-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  14. Title list of documents made publicly available, December 1--31, 1993, Volume 15, No. 12

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-02-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  15. Title list of documents made publicly available. Volume 17, No. 5

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-07-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (3) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  16. Title list of documents made publicly available. Volume 17, No. 7

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  17. Title list of documents made publicly available, July 1--31, 1996: Volume 18, No. 7

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-09-01

    This monthly publication describes information received and published by US NRC. This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. Following indexes are included: personal author, corporate source, report number, and cross reference of enclosures to principal documents.

  18. FLIS Procedures Manual. Document Identifier Code Input/Output Formats (Fixed Length). Volume 8.

    Science.gov (United States)

    2007-11-02

    4100.39-M DEFENSE LOGISTICS SERVICES CENTER Volume 8 74 WASHINGTON AVE N BATTLE CREEK MI 49017-3084 DLSC- VPH 1 April 1997 FOREWORD This is one of the...volume 1, chapter 1.6, or administrative comments and inquiries may be directed to DLSC- VPH . Service/Agency distribution is handled through...changes to DLSC- VPH . Content changes appearing on these pages are entered in bold-faced italic type. Comments or questions may be directed to DLSC- VPH . This

  19. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  20. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  1. Sandia National Laboratories/New Mexico Environmental Information Document - Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    BAYLISS, LINDA S.; GUERRERO, JOSEPH V.; JOHNS, WILLIAM H.; KUZIO, KENNETH A.; BAILEY-WHITE, BRENDA E.

    1999-09-01

    This Sandia National Laboratories/New Mexico Environmental Information Document (EID) compiles information on the existing environment, or environmental baseline, for SNUNM. Much of the information is drawn from existing reports and databases supplemented by new research and data. The SNL/NM EID, together with the Sandia National Laboratories/New Mexico Facilities and Safety Information Document, provide a basis for assessing the environment, safety, and health aspects of operating selected facilities at SNL/NM. The environmental baseline provides a record of the existing physical, biological, and socioeconomic environment at SNL/NLM prior to being altered (beneficially or adversely) by proposed programs or projects. More specifically, the EID provides information on the following topics: Geology; Land Use; Hydrology and Water Resources; Air Quality and Meteorology; Ecology; Noise and Vibration; Cultural Resources; Visual Resources; Socioeconomic and Community Services; Transportation; Material Management; Waste Management; and Regulatory Requirements.

  2. Industrial fuel choice analysis model. Volume II. Appendices to model documentation

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-08

    Descriptions, documentation, and other information are included in these appendices dealing with industrial fuel choices: Energy Consumption Data Base; Major Fuel Burning Installation Survey; American Boiler Manufacturers Association Data File; Midrange Energy Forecasting System; Projection Method; Capacity Utilization Rates; Nonboiler Characteristics; Boiler Capital and O and M Cost Data; Nonboiler Capital and O and M Cost Data; Approach to Estimating Energy Impacts of the Coal Conversion Regulatory Program; Index or Acronyms.

  3. Efeito do grau de moagem, do tipo de frasco e do volume vazio sobre a variabilidade analítica do fósforo extraído pelos métodos Mehlich-1 e Mehlich-3

    Directory of Open Access Journals (Sweden)

    Lenio da Silva Santos

    2014-10-01

    Full Text Available Na execução de uma análise química de solo são empregados diversos procedimentos que, mesmo seguindo-se o protocolo preconizado pelo método de análise utilizado, estão sujeitos a variações nos resultados analíticos, causadas por manipulação das amostras ou dos materiais utilizados. Objetivou-se neste estudo avaliar a influência do grau de moagem da amostra, do tipo de frasco e do volume vazio no frasco na execução dos métodos Mehlich-1 e Mehlich-3 para determinar o P no solo. Para tanto, foram conduzidos três experimentos. No primeiro experimento, as amostras de solo foram moídas e tamisadas em peneiras com aberturas de 2,000; 1,700; 0,850; 0,600; e 0,300 mm. No segundo, foram utilizados dois modelos de frasco (erlenmeyer e snap-cap, ambos com volume de 50 mL. Já no terceiro, foi alterado o volume vazio no frasco, mantendo-se a relação solo:solução extratora utilizando-se as quantidades dentro do frasco de 1:10; 1,5:15; 2,5:25; 3:30; e 4:40 cm³ cm-3. O grau de moagem das amostras não influenciou a capacidade de extração do Mehlich-1; entretanto, a capacidade extrativa do Mehlich-3 foi influenciada, principalmente em solos argilosos. Tanto para o Mehlich-1 quanto para o Mehlich-3, os teores de P extraído foram significativamente mais elevados com o uso de frasco tipo snap-cap em relação ao erlenmeyer. O volume vazio no frasco alterou os teores de P extraído para o Mehlich-1 e Mehlich-3 em 100 e 64 % das amostras, respectivamente. Deve-se padronizar a intensidade da moagem das amostras de solo para extração do P pela solução de Mehlich-3. Um modelo único de frasco deve ser adotado pelos laboratórios de rotina para análise do P, independentemente do método de extração, mantendo-se sempre constante no frasco o volume da amostra (cm³ para o volume de solução extratora (cm³.

  4. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  5. Building America Best Practices Series Volume 8: Builders Challenge Quality Criteria Support Document

    Energy Technology Data Exchange (ETDEWEB)

    Baechler, Michael C.; Bartlett, Rosemarie; Gilbride, Theresa L.

    2010-11-01

    The U.S. Department of Energy (DOE) has posed a challenge to the homebuilding industry—to build 220,000 high-performance homes by 2012. Through the Builders Challenge, participating homebuilders will have an easy way to differentiate their best energy-performing homes from other products in the marketplace, and to make the benefits clear to buyers. This document was prepared by Pacific Northwest National Laboratory for DOE to provide guidance to U.S. home builders who want to accept the challenge. To qualify for the Builders Challenge, a home must score 70 or less on the EnergySmart Home Scale (E-Scale). The E-scale is based on the well-established Home Energy Rating System (HERS) index, developed by the Residential Energy Services Network (RESNET). The E-scale allows homebuyers to understand – at a glance – how the energy performance of a particular home compares with the performance of others. To learn more about the index and HERS Raters, visit www.natresnet.org. Homes also must meet the Builders Challenge criteria described in this document. To help builders meet the Challenge, guidance is provided in this report for each of the 29 criteria. Included with guidance for each criteria are resources for more information and references for relevant codes and standards. The Builders Challenge Quality Criteria were originally published in Dec. 2008. They were revised and published as PNNL-18009 Rev 1.2 in Nov. 2009. This is version 1.3, published Nov 2010. Changes from the Nov 2009 version include adding a title page and updating the Energy Star windows critiera to the Version 5.0 criteria approved April 2009 and effective January 4, 2010. This document and other information about the Builders Challenge is available on line at www.buildingamerica.gov/challenge.

  6. Title list of documents made publicly available: September 1--30, 1996. Volume 18, Number 9

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The report describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  7. Title list of documents made publicly available: April 1--30, 1996. Volume 18, Number 4

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-06-01

    This publication describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  8. Title list of documents made publicly available: June 1--30, 1995. Volume 17, Number 6

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  9. In Situ Soil Venting - Full Scale Test, Hill AFB. Volume 3. Guidance Document, Literature Review

    Science.gov (United States)

    1991-08-01

    s ý GCE Form A•pproved REPORT DOCUMENTATION PAGE CMBNO 070401’ihs a EERORT C ,RI Y C•.ASSFCA ,ON ’t .• ESTR !CTiVE MARKINGS .a SECURT’Y CLASSiFICAT...extremely useful, however, for a tesi of the applicability of venting to qucstionahlc situations (--frcrcncc 14) or for providing a site-specific correlation...consideration of the results ot this tesi : (I) the temperatures achieved in this test were shown to have the potential for si-,incant increases in

  10. Title list of documents made publicly available: January 1--31, 1996. Volume 18, Number 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. Some of the topics relate to: low-level radioactive disposal sites, source material, production and utilization facilities, special nuclear material, packaging and transport and spent fuel storage.

  11. Structured assessment approach version 1. License submittal document content and format for material control and accounting assessment. Volume II

    Energy Technology Data Exchange (ETDEWEB)

    Parziale, A.A.; Sacks, I.J.

    1979-10-01

    A methodology, the Structured Assessment Approach, has been developed for the assessment of the effectiveness of material control and accounting (MC and A) safeguards systems at nuclear fuel cycle facilities. This methodology has been refined into a computational tool, the SAA Version 1 computational package, that was used first to analyze a hypothetical fuel cycle facility and used more recently to assess operational nuclear plants. The Version 1 analysis package is designed to analyze safeguards systems that prevent the diversion of special nuclear material (SNM) from nuclear fuel cycle facilities and to provide assurance that diversion has not occurred. This report is the second volume, the License Submittal Document Content and Format for Material Control and Accounting Assessment, of a four-volume document. It presents the content and format of the LSD necessary for Material Control and Accounting (MC and A) assessment with the SAA Version 1. The LSD is designed to provide the necessary data input to perform all four stages of analyses associated with the SAA. A full-size but Hypothetical Fuel Cycle Facility (HFCF) is used as an example to illustrate the required input data content and data format and to illustrate the procedure for generating the LSD. Generation of the LSD is the responsibility of the nuclear facility licensee applicant.

  12. Detailed requirements document for the Interactive Financial Management System (IFMS), volume 1

    Science.gov (United States)

    Dodson, D. B.

    1975-01-01

    The detailed requirements for phase 1 (online fund control, subauthorization accounting, and accounts receivable functional capabilities) of the Interactive Financial Management System (IFMS) are described. This includes information on the following: systems requirements, performance requirements, test requirements, and production implementation. Most of the work is centered on systems requirements, and includes discussions on the following processes: resources authority, allotment, primary work authorization, reimbursable order acceptance, purchase request, obligation, cost accrual, cost distribution, disbursement, subauthorization performance, travel, accounts receivable, payroll, property, edit table maintenance, end-of-year, backup input. Other subjects covered include: external systems interfaces, general inquiries, general report requirements, communication requirements, and miscellaneous. Subjects covered under performance requirements include: response time, processing volumes, system reliability, and accuracy. Under test requirements come test data sources, general test approach, and acceptance criteria. Under production implementation come data base establishment, operational stages, and operational requirements.

  13. Application of probabilistic and decision analysis methods to structural mechanics and materials sciences problems. Volume 2. Resource document

    Energy Technology Data Exchange (ETDEWEB)

    Garrick, B.J.; Tagart, S.W. Jr. (eds.)

    1984-08-01

    This volume presents background resource material on the field of structural reliability assessment and its relationship to the discipline of probabilistic risk analysis and decision analysis. First, general background material is presented on the field of structural reliability assessment. Next, some sample applications of probabilistic and decision analysis methods are presented. A hypothetical example illustrates how a probabilistic approach could be used in structural design, and a brief description is given of how the results of structural reliability analyses can be used as input to a PRA. A case study is described on the use of decision analysis to select strategies for dealing with intergranular stress corrosion cracking. The use of decision analysis to evaluate the merits of different possible research tasks is also discussed. A discussion of decision analysis is then presented. Finally, the document presents a discussion of open issues in the area of structural reliability.

  14. TFaNS Tone Fan Noise Design/Prediction System. Volume 1; System Description, CUP3D Technical Documentation and Manual for Code Developers

    Science.gov (United States)

    Topol, David A.

    1999-01-01

    TFaNS is the Tone Fan Noise Design/Prediction System developed by Pratt & Whitney under contract to NASA Lewis (presently NASA Glenn). The purpose of this system is to predict tone noise emanating from a fan stage including the effects of reflection and transmission by the rotor and stator and by the duct inlet and nozzle. These effects have been added to an existing annular duct/isolated stator noise prediction capability. TFaNS consists of: The codes that compute the acoustic properties (reflection and transmission coefficients) of the various elements and write them to files. Cup3D: Fan Noise Coupling Code that reads these files, solves the coupling problem, and outputs the desired noise predictions. AWAKEN: CFD/Measured Wake Postprocessor which reformats CFD wake predictions and/or measured wake data so it can be used by the system. This volume of the report provides technical background for TFaNS including the organization of the system and CUP3D technical documentation. This document also provides information for code developers who must write Acoustic Property Files in the CUP3D format. This report is divided into three volumes: Volume I: System Description, CUP3D Technical Documentation, and Manual for Code Developers; Volume II: User's Manual, TFaNS Vers. 1.4; Volume III: Evaluation of System Codes.

  15. Style, content and format guide for writing safety analysis documents. Volume 1, Safety analysis reports for DOE nuclear facilities

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    The purpose of Volume 1 of this 4-volume style guide is to furnish guidelines on writing and publishing Safety Analysis Reports (SARs) for DOE nuclear facilities at Sandia National Laboratories. The scope of Volume 1 encompasses not only the general guidelines for writing and publishing, but also the prescribed topics/appendices contents along with examples from typical SARs for DOE nuclear facilities.

  16. Iraqi Perspectives Project. Primary Source Materials for Saddam and Terrorism: Emerging Insights from Captured Iraqi Documents. Volume 4 (Redacted)

    Science.gov (United States)

    2007-11-01

    II series. Volume I examines the relationships between the regime of Saddam Hussein and terrorism in its local, regional, and global context. Volumes 2...be behind this accident because of the number of American casualties. Then, he xpresses his suspects about Israel to be the real criminal, and then...Saddam Hussein and terrorism in its local, regional, and global context. Volumes 2 through 4 contain the English translations and detailed summaries of

  17. A Review of the Availability of Primary Scientific and Technical Documents within the United States, Volume I. Final Report.

    Science.gov (United States)

    Wood, James L.

    Volume I of this three-volume final report contains a summary of the objectives and results of a study conducted by Chemical Abstracts Service (CAS), a Division of the American Chemical Society (ACS), to determine the availability of the scientific and technical primary literature which the user identifies through the use of secondary services…

  18. Preliminary analysis of an integrated logistics system for OSSA payloads. Volume 3: OSSA integrated logistics support planning document

    Science.gov (United States)

    Palguta, T.; Bradley, W.; Stockton, T.

    1988-01-01

    Guidance in preparing and updating an integrated logistics support plan (ILSP) is given. Clear, concise, and detailed instructions are provided on the preparation and content of an ILSP in order to ensure a quality document that reflects total program requirements.

  19. Tokamak Physics EXperiment (TPX): Toroidal field magnet design, development and manufacture. SDRL 32, Coil assembly documentation. Volume 5

    Energy Technology Data Exchange (ETDEWEB)

    Weber, C.M. [Babcock and Wilcox Co., Lynchburg, VA (United States)

    1995-08-18

    This document is intended to address the contract requirement for providing coil assembly documentation, as required in the applicable Statement of Work: `Provide preliminary procedures and preliminary design and supporting analysis of the equipment, fixtures, and hardware required to integrate and align the impregnated coil assemblies with the coil cases and intercoil structure. Each of the three major processes associated with the coil case and intercoil structure (ICS), TF Case Fabrication, Coil Preparation for Case Assembly are examined in detail. The specific requirements, processes, equipment, and technical concerns for each of these assembly processes is presented.

  20. Indexing for ERIC. Volume 2, Lesson 1-Introduction to Indexing; Lesson 2-How to Index a Document.

    Science.gov (United States)

    Langridge, D.W.; And Others

    This volume contains the first two lessons of a course in subject indexing based upon the Educational Resources Information Center (ERIC) Thesaurus, Lesson 1 is an introduction to indexing, containing definitions and concepts related to the theory of indexing and information retrieval as well as an introduction to the ERIC Thesaurus. Lesson 2 is…

  1. Structural Area Inspection Frequency Evaluation (SAIFE). Volume 4. Software Documentation and User’s Manual. Book 1 - Initial Program

    Science.gov (United States)

    1978-04-01

    SM8-AFT-0030 690000 q A.O0OF- I.hni.-3 1L0. 1.371 15.0 1.1)E-5 3 13.31E-9 1476 AAoo .k50 .?0 u6b6 .667 P 14 33 7h liuQ ?O.S YES 20000 10000 11584 11%S84...t pol llt l~ I ill, o Ivimgtt I ~p’kII% It) il th A I 11 r 111 hi t litv A I I It Ii’ viti ! ta llo I A wt i’t 04 at 1y i t I Ityeu a iliy $ttA Itil

  2. Savannah River Site mixed waste Proposed Site Treatment Plan (PSTP). Volumes 1 and 2 and reference document: Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Helmich, E.; Noller, D.K.; Wierzbicki, K.S.; Bailey, L.L.

    1995-07-13

    The DOE is required by the Resource Conservation and Recovery Act to prepare site treatment plans describing the development of treatment capacities and technologies for treating mixed waste. This proposed plan contains Savannah River Site`s preferred options and schedules for constructing new facilities, and otherwise obtaining treatment for mixed wastes. The proposed plan consists of 2 volumes. Volume 1, Compliance Plan, identifies the capacity to be developed and the schedules as required. Volume 2, Background, provides a detailed discussion of the preferred options with technical basis, plus a description of the specific waste streams. Chapters are: Introduction; Methodology; Mixed low level waste streams; Mixed transuranic waste; High level waste; Future generation of mixed waste streams; Storage; Process for evaluation of disposal issues in support of the site treatment plans discussions; Treatment facilities and treatment technologies; Offsite waste streams for which SRS treatment is the Preferred Option (Naval reactor wastes); Summary information; and Acronyms and glossary. This revision does not contain the complete revised report, but only those pages that have been revised.

  3. Class 1E digital systems studies

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, H.; Tai, A.T.; Tso, K.S. [SoHaR, Inc., Beverly Hills, CA (United States)

    1993-10-01

    This document is furnished as part of the effort to develop NRC Class 1E Digital Computer Systems Guidelines which is Task 8 of USAF Rome Laboratories Contract F30602-89-D-0100. The report addresses four major topics, namely, computer programming languages, software design and development, software testing and fault tolerance and fault avoidance. The topics are intended as stepping stones leading to a Draft Regulatory Guide document. As part of this task a small scale survey of software fault avoidance and fault tolerance practices was conducted among vendors of nuclear safety related systems and among agencies that develop software for other applications demanding very high reliability. The findings of the present report are in part based on the survey and in part on review of software literature relating to nuclear and other critical installations, as well as on the authors` experience in these areas.

  4. Source document compilation: Los Alamos investigations related to the environment, engineering, geology, and hydrology, 1961--1990. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Purtymun, W.D. [comp.

    1994-03-01

    This document is a compilation of informal reports, letters, and memorandums regarding geologic and hydrologic studies and investigations such as foundation investigations for structures, drilling or coring for environmental studies, development of water supply, or construction of test or observation wells for monitoring. Also included are replies requested for specific environmental, engineering, geologic, and hydrologic problems. The purpose of this document is to preserve and make the original data available to the environmental studies that are now in progress at Los Alamos and provide a reference for and supplement the LAMS report ``Records of Observation Wells, Test Holes, Test Wells, Supply Wells, Springs, and Surface water stations at Los Alamos: with Reference to the Geology and Hydrology,`` which is in preparation. The informal reports and memorandums are listed chronologically from December 1961 to January 1990. Item 208 is a descriptive history of the US Geological Survey`s activities at Los Alamos from 1946 through 1972. The history includes a list of published and unpublished reports that cover geology, hydrology, water supply, waste disposal, and environmental monitoring in the Los Alamos area.

  5. Source document compilation: Los Alamos investigations related to the environment, engineering, geology, and hydrology, 1961--1990. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    Purtymun, W.D. [comp.

    1994-03-01

    This document is a compilation of informal reports, letters, and memorandums regarding geologic and hydrologic studies and investigations such as foundation investigations for structures, drilling or coring for environmental studies, development of water supply, or construction of test or observation wells for monitoring. Also included are replies requested for specific environmental, engineering, geologic, and hydrologic problems. The purpose of this document is to preserve and make the original data available to the environmental studies that are now in progress at Los Alamos and provide a reference for and supplement the LAMS report ``Records of Observation Wells, Test Holes, Test Wells, Supply Wells, Springs, and Surface water stations at Los Alamos: with Reference to the Geology and Hydrology,`` which is in preparation. The informal reports and memorandums are listed chronologically from December 1961 to January 1990. Item 208 is a descriptive history of the US Geological Survey`s activities at Los Alamos from 1946 through 1972. The history includes a list of published and unpublished reports that cover geology, hydrology, water supply, waste disposal, and environmental monitoring in the Los Alamos area.

  6. Supplement analysis for continued operation of Lawrence Livermore National Laboratory and Sandia National Laboratories, Livermore. Volume 2: Comment response document

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    The US Department of Energy (DOE), prepared a draft Supplement Analysis (SA) for Continued Operation of Lawrence Livermore National Laboratory (LLNL) and Sandia National Laboratories, Livermore (SNL-L), in accordance with DOE`s requirements for implementation of the National Environmental Policy Act of 1969 (NEPA) (10 Code of Federal Regulations [CFR] Part 1021.314). It considers whether the Final Environmental Impact Statement and Environmental Impact Report for Continued Operation of Lawrence Livermore National Laboratory and Sandia National Laboratories, Livermore (1992 EIS/EIR) should be supplement3ed, whether a new environmental impact statement (EIS) should be prepared, or no further NEPA documentation is required. The SA examines the current project and program plans and proposals for LLNL and SNL-L, operations to identify new or modified projects or operations or new information for the period from 1998 to 2002 that was not considered in the 1992 EIS/EIR. When such changes, modifications, and information are identified, they are examined to determine whether they could be considered substantial or significant in reference to the 1992 proposed action and the 1993 Record of Decision (ROD). DOE released the draft SA to the public to obtain stakeholder comments and to consider those comments in the preparation of the final SA. DOE distributed copies of the draft SA to those who were known to have an interest in LLNL or SNL-L activities in addition to those who requested a copy. In response to comments received, DOE prepared this Comment Response Document.

  7. Federal Logistics Information Systems. FLIS Procedures Manual. Document Identifier Code Input/Output Formats (Variable Length). Volume 9.

    Science.gov (United States)

    2007-11-02

    49017-3084 CH I CHANGE NO. 1 DoD 4100.39-M DoD 4100.39-M Volume 9 V DLSC- VPH 1 July 1997 _-’ FEDERAL LOGISTICS INFORMATION SYSTEM (FLIS) PROCEDURES...47 3053 UNIT OF ISSUE CONVERSION FACTOR 0005N H 02 QS 8472 FORMER UNIT OF ISSUE 0002A H 89 0211 OCCURS COUNTER/li/ 0001N H GV 2862 PHRASE CODE...16 0707 MANAGEMENT CONTROL DATA, COAST GUARD 0007X H 16 0443 EXPANSION FIELD 1 0001X H 47 3053 UNIT OF ISSUE CONVERSION FACTOR 0005N H 02 0S 8472

  8. Application of probabilistic and decision analysis methods to structural mechanics and materials sciences problems. Volume 1. Planning document

    Energy Technology Data Exchange (ETDEWEB)

    Garrick, B.J.; Tagart, S.W. Jr. (eds.)

    1984-08-01

    Volume I presents an overview of the EPRI structural reliability research program. First, perspectives on the probabilistic treatment of uncertainty are presented. A brief explanation is given of why decision analysis methods are part of EPRI's structural reliability project, and how the use of such methods to handle uncertainty can improve decision-making in this area. A more detailed discussion of one approach for dealing with uncertainty about event probabilities is also presented. Next, review of probabilistic risk analysis is presented. This review includes a brief history of its development and application, an overview of the methodology involved, the role of structural reliability assessment in providing input to PRAs, and the treatment of uncertainties in that input. A brief discussion of the relationship between PRA and safety goals is also included.

  9. Documentation of the analysis of the benefits and costs of aeronautical research and technology models, volume 1

    Science.gov (United States)

    Bobick, J. C.; Braun, R. L.; Denny, R. E.

    1979-01-01

    The analysis of the benefits and costs of aeronautical research and technology (ABC-ART) models are documented. These models were developed by NASA for use in analyzing the economic feasibility of applying advanced aeronautical technology to future civil aircraft. The methodology is composed of three major modules: fleet accounting module, airframe manufacturing module, and air carrier module. The fleet accounting module is used to estimate the number of new aircraft required as a function of time to meet demand. This estimation is based primarily upon the expected retirement age of existing aircraft and the expected change in revenue passenger miles demanded. Fuel consumption estimates are also generated by this module. The airframe manufacturer module is used to analyze the feasibility of the manufacturing the new aircraft demanded. The module includes logic for production scheduling and estimating manufacturing costs. For a series of aircraft selling prices, a cash flow analysis is performed and a rate of return on investment is calculated. The air carrier module provides a tool for analyzing the financial feasibility of an airline purchasing and operating the new aircraft. This module includes a methodology for computing the air carrier direct and indirect operating costs, performing a cash flow analysis, and estimating the internal rate of return on investment for a set of aircraft purchase prices.

  10. A workshop on developing risk assessment methods for medical use of radioactive material. Volume 2: Supporting documents

    Energy Technology Data Exchange (ETDEWEB)

    Tortorelli, J.P. [ed.] [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States)

    1995-08-01

    A workshop was held at the Idaho National Engineering Laboratory, August 16--18, 1994 on the topic of risk assessment on medical devices that use radioactive isotopes. Its purpose was to review past efforts to develop a risk assessment methodology to evaluate these devices, and to develop a program plan and a scoping document for future methodology development. This report contains presentation material and a transcript of the workshop. Participants included experts in the fields of radiation oncology, medical physics, risk assessment, human-error analysis, and human factors. Staff from the US Nuclear Regulatory Commission (NRC) associated with the regulation of medical uses of radioactive materials and with research into risk-assessment methods participated in the workshop. The workshop participants concurred in NRC`s intended use of risk assessment as an important technology in the development of regulations for the medical use of radioactive material and encouraged the NRC to proceed rapidly with a pilot study. Specific recommendations are included in the executive summary and the body of this report.

  11. Clouds and the Earth's Radiant Energy System (CERES) algorithm theoretical basis document. Volume 1; Overviews (subsystem 0)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator); Barkstrom, Bruce R. (Principal Investigator); Baum, Bryan A.; Cess, Robert D.; Charlock, Thomas P.; Coakley, James A.; Green, Richard N.; Lee, Robert B., III; Minnis, Patrick; Smith, G. Louis

    1995-01-01

    The theoretical bases for the Release 1 algorithms that will be used to process satellite data for investigation of the Clouds and the Earth's Radiant Energy System (CERES) are described. The architecture for software implementation of the methodologies is outlined. Volume 1 provides both summarized and detailed overviews of the CERES Release 1 data analysis system. CERES will produce global top-of-the-atmosphere shortwave and longwave radiative fluxes at the top of the atmosphere, at the surface, and within the atmosphere by using the combination of a large variety of measurements and models. The CERES processing system includes radiance observations from CERES scanning radiometers, cloud properties derived from coincident satellite imaging radiometers, temperature and humidity fields from meteorological analysis models, and high-temporal-resolution geostationary satellite radiances to account for unobserved times. CERES will provide a continuation of the ERBE record and the lowest error climatology of consistent cloud properties and radiation fields. CERES will also substantially improve our knowledge of the Earth's surface radiation budget.

  12. Evaluation of potential severe accidents during low power and shutdown operations at Surry, Unit 1: Analysis of core damage frequency from internal events during mid-loop operations, Appendices E (Sections E.1--E.8). Volume 2, Part 3A

    Energy Technology Data Exchange (ETDEWEB)

    Chu, T.L.; Musicki, Z.; Kohut, P. [Brookhaven National Lab., Upton, NY (United States)] [and others

    1994-06-01

    During 1989, the Nuclear Regulatory Commission (NRC) initiated an extensive program to carefully examine the potential risks during low power and shutdown operations. The program includes two parallel projects being performed by Brookhaven National Laboratory (BNL) and Sandia National Laboratories (SNL). Two plants, Surry (pressurized water reactor) and Grand Gulf (boiling water reactor), were selected as the plants to be studied. The objectives of the program are to assess the risks of severe accidents initiated during plant operational states other than full power operation and to compare the estimated core damage frequencies, important accident sequences and other qualitative and quantitative results with those accidents initiated during full power operation as assessed in NUREG-1150. The objective of this report is to document the approach utilized in the Surry plant and discuss the results obtained. A parallel report for the Grand Gulf plant is prepared by SNL. This study shows that the core-damage frequency during mid-loop operation at the Surry plant is comparable to that of power operation. The authors recognize that there is very large uncertainty in the human error probabilities in this study. This study identified that only a few procedures are available for mitigating accidents that may occur during shutdown. Procedures written specifically for shutdown accidents would be useful.

  13. Guidelines for the verification and validation of expert system software and conventional software: Survey and documentation of expert system verification and validation methodologies. Volume 3

    Energy Technology Data Exchange (ETDEWEB)

    Groundwater, E.H.; Miller, L.A.; Mirsky, S.M. [Science Applications International Corp., McLean, VA (United States)

    1995-03-01

    This report is the third volume in the final report for the Expert System Verification and Validation (V&V) project which was jointly sponsored by the Nuclear Regulatory Commission and the Electric Power Research Institute. The ultimate objective is the formulation of guidelines for the V&V of expert systems for use in nuclear power applications. The purpose of this activity was to survey and document techniques presently in use for expert system V&V. The survey effort included an extensive telephone interviewing program, site visits, and a thorough bibliographic search and compilation. The major finding was that V&V of expert systems is not nearly as established or prevalent as V&V of conventional software systems. When V&V was used for expert systems, it was almost always at the system validation stage after full implementation and integration usually employing the non-systematic dynamic method of {open_quotes}ad hoc testing.{close_quotes} There were few examples of employing V&V in the early phases of development and only weak sporadic mention of the possibilities in the literature. There is, however, a very active research area concerning the development of methods and tools to detect problems with, particularly, rule-based expert systems. Four such static-testing methods were identified which were not discovered in a comprehensive review of conventional V&V methods in an earlier task.

  14. Model documentation natural gas transmission and distribution model (NGTDM) of the national energy modeling system. Volume II: Model developer`s report

    Energy Technology Data Exchange (ETDEWEB)

    1995-01-03

    To partially fulfill the requirements for {open_quotes}Model Acceptance{close_quotes} as stipulated in EIA Standard 91-01-01 (effective February 3, 1991), the Office of Integrated Analysis and Forecasting has conducted tests of the Natural Gas Transmission and Distribution Model (NGTDM) for the specific purpose of validating the forecasting model. This volume of the model documentation presents the results of {open_quotes}one-at-a-time{close_quotes} sensitivity tests conducted in support of this validation effort. The test results are presented in the following forms: (1) Tables of important model outputs for the years 2000 and 2010 are presented with respect to change in each input from the reference case; (2) Tables of percent changes from base case results for the years 2000 and 2010 are presented for important model outputs; (3) Tables of conditional sensitivities (percent change in output/percent change in input) for the years 2000 and 2010 are presented for important model outputs; (4) Finally, graphs presenting the percent change from base case results for each year of the forecast period are presented for selected key outputs. To conduct the sensitivity tests, two main assumptions are made in order to test the performance characteristics of the model itself and facilitate the understanding of the effects of the changes in the key input variables to the model on the selected key output variables: (1) responses to the amount demanded do not occur since there are no feedbacks of inputs from other NEMS models in the stand-alone NGTDM run. (2) All the export and import quantities from and to Canada and Mexico, and liquefied natural gas (LNG) imports and exports are held fixed (i.e., there are no changes in imports and exports between the reference case and the sensitivity cases) throughout the forecast period.

  15. DOE-2, BDL summary. Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch & Associates, Camarillo, CA (United States)

    1993-11-01

    This document contains summary information on all commands and keywords in the DOE-2 Building Description Language (BDL). It also contains supplementary tables and maps. The fundamentals of BDL are discussed in Chapter II of the Reference Manual (2.1A); detailed descriptions of the commands and keywords summarized here can be found in the Reference Manual (2.1A) and in the Supplement (2.1E).

  16. Documenting localities

    CERN Document Server

    Cox, Richard J

    1996-01-01

    Now in paperback! Documenting Localities is the first effort to summarize the past decade of renewed discussion about archival appraisal theory and methodology and to provide a practical guide for the documentation of localities.This book discusses the continuing importance of the locality in American historical research and archival practice, traditional methods archivists have used to document localities, and case studies in documenting localities. These chapters draw on a wide range of writings from archivists, historians, material culture specialists, historic preservationists

  17. Technical report series on global modeling and data assimilation. Volume 1: Documentation of the Goddard Earth Observing System (GEOS) General Circulation Model, version 1

    Science.gov (United States)

    Suarez, Max J. (Editor); Takacs, Lawrence L.; Molod, Andrea; Wang, Tina

    1994-01-01

    This technical report documents Version 1 of the Goddard Earth Observing System (GEOS) General Circulation Model (GCM). The GEOS-1 GCM is being used by NASA's Data Assimilation Office (DAO) to produce multiyear data sets for climate research. This report provides a documentation of the model components used in the GEOS-1 GCM, a complete description of model diagnostics available, and a User's Guide to facilitate GEOS-1 GCM experiments.

  18. Low-level radioactive waste from commercial nuclear reactors. Volume 3. Bibliographic abstracts of significant source documents. Part 1. Open-literature abstracts for low-level radioactive waste

    Energy Technology Data Exchange (ETDEWEB)

    Bowers, M.K.; Rodgers, B.R.; Jolley, R.L.

    1986-05-01

    The overall task of this program was to provide an assessment of currently available technology for treating commercial low-level radioactive waste (LLRW), to initiate development of a methodology for choosing one technology for a given application, and to identify research needed to improve current treatment techniques and decision methodology. The resulting report is issued in four volumes. Volume 3 of this series is a collection of abstracts of most of the reference documents used for this study. Because of the large volume of literature, the abstracts have been printed in two separate parts. Volume 3, part 1 presents abstracts of the open literature relating to LLRW treatment methodologies. Some of these references pertain to treatment processes for hazardous wastes that may also be applicable to LLRW management. All abstracts have been limited to 21 lines (for brevity), but each abstract contains sufficient information to enable the reader to determine the potential usefulness of the source document and to locate each article. The abstracts are arranged alphabetically by author or organization, and indexed by keyword.

  19. Low-level radioactive waste from commercial nuclear reactors. Volume 3. Bibliographic abstracts of significant source documents. Part 1. Open-literature abstracts for low-level radioactive waste

    Energy Technology Data Exchange (ETDEWEB)

    Bowers, M.K.; Rodgers, B.R.; Jolley, R.L.

    1986-05-01

    The overall task of this program was to provide an assessment of currently available technology for treating commercial low-level radioactive waste (LLRW), to initiate development of a methodology for choosing one technology for a given application, and to identify research needed to improve current treatment techniques and decision methodology. The resulting report is issued in four volumes. Volume 3 of this series is a collection of abstracts of most of the reference documents used for this study. Because of the large volume of literature, the abstracts have been printed in two separate parts. Volume 3, part 1 presents abstracts of the open literature relating to LLRW treatment methodologies. Some of these references pertain to treatment processes for hazardous wastes that may also be applicable to LLRW management. All abstracts have been limited to 21 lines (for brevity), but each abstract contains sufficient information to enable the reader to determine the potential usefulness of the source document and to locate each article. The abstracts are arranged alphabetically by author or organization, and indexed by keyword.

  20. Termination Documentation

    Science.gov (United States)

    Duncan, Mike; Hill, Jillian

    2014-01-01

    In this study, we examined 11 workplaces to determine how they handle termination documentation, an empirically unexplored area in technical communication and rhetoric. We found that the use of termination documentation is context dependent while following a basic pattern of infraction, investigation, intervention, and termination. Furthermore,…

  1. Documents on Disarmament.

    Science.gov (United States)

    Arms Control and Disarmament Agency, Washington, DC.

    This publication, latest in a series of volumes issued annually since 1960, contains primary source documents on arms control and disarmament developments during 1969. The main chronological arrangement is supplemented by both chronological and topical lists of contents. Other reference aids include a subject/author index, and lists of…

  2. Maury Documentation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Supporting documentation for the Maury Collection of marine observations. Includes explanations from Maury himself, as well as guides and descriptions by the U.S....

  3. Evaluation of automated decision making methodologies and development of an integrated robotic system simulation. Volume 2, Part 1. Appendix a: software documentation

    Energy Technology Data Exchange (ETDEWEB)

    Lowrie, J.W.; Fermelia, A.J.; Haley, D.C.; Gremban, K.D.; Vanbaalen, J.

    1982-09-01

    Documentation of the preliminary software developed as a framework for a generalized integrated robotic system simulation is presented. The program structure is composed of three major functions controlled by a program executive. The three major functions are: system definition, analysis tools, and post processing. The system definition function handles user input of system parameters and definition of the manipulator configuration. The analysis tools function handles the computational requirements of the program. The post processing function allows for more detailed study of the results of analysis tool function executions. Also documented is the manipulator joint model software to be used as the basis of the manipulator simulation which will be part of the analysis tools capability.

  4. Industrial Sector Technology Use Model (ISTUM): industrial energy use in the United States, 1974-2000. Volume 1: primary model documentation, Book 2, Chapters IV, V, VI, and VII

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, R.E.; Herod, J.S.

    1978-06-19

    The Industrial Sector Technology Use Model provides a single framework for integrating all of the information and analysis into a set of predictions of industrial energy use. Given this volume of information which must be considered, this requires a set of computerized engineering-economic models. The design of these models is the subject of Chapter IV. The environmental factors in ISTUM are developed and presented in Chapter V. Chapter VI discusses the work accomplished by DATA Resources, Inc. in support of the ISTUM. A glossary, briefly defining special terms used in the ISTUM documentation, is given in Chapter VII. (MCW)

  5. Reactor operation environmental information document

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, L.R.; Hayes, D.W.; Hunter, C.H.; Marter, W.L.; Moyer, R.A.

    1989-12-01

    This volume is a reactor operation environmental information document for the Savannah River Plant. Topics include meteorology, surface hydrology, transport, environmental impacts, and radiation effects. 48 figs., 56 tabs. (KD)

  6. Documentation Service; Service de Documentation

    Energy Technology Data Exchange (ETDEWEB)

    Charnay, J.; Chosson, L.; Croize, M.; Ducloux, A.; Flores, S.; Jarroux, D.; Melka, J.; Morgue, D.; Mottin, C. [Inst. de Physique Nucleaire, Lyon-1 Univ., 69 - Villeurbanne (France)

    1998-12-31

    This service assures the treatment and diffusion of the scientific information and the management of the scientific production of the institute as well as the secretariat operation for the groups and services of the institute. The report on documentation-library section mentions: the management of the documentation funds, search in international databases (INIS, Current Contents, Inspects), Pret-Inter service which allows accessing documents through DEMOCRITE network of IN2P3. As realizations also mentioned are: the setup of a video, photo database, the Web home page of the institute`s library, follow-up of digitizing the document funds by integrating the CD-ROMs and diskettes, electronic archiving of the scientific production, etc 1 fig.

  7. Space transfer concepts and analysis for exploration missions. Implementation plan and element description document (draft final). Volume 4: Solar electric propulsion vehicle

    Science.gov (United States)

    1991-03-01

    This document presents the solar electric propulsion (SEP) concept design developed as part of the Space Transfer Concepts and Analysis for Exploration Missions (STCAEM) study. The evolution of the SEP concept is described along with the requirements, guidelines and assumptions for the design. Operating modes and options are defined and a systems description of the vehicle is presented. Artificial gravity configuration options and space and ground support systems are discussed. Finally, an implementation plan is presented which addresses technology needs, schedules, facilities, and costs.

  8. Space transfer concepts and analysis for exploration missions. Implementation plan and element description document (draft final). Volume 3: Nuclear thermal rocket vehicle

    Science.gov (United States)

    1991-01-01

    This document presents the nuclear thermal rocket (NTR) concept design developed in support of the Space Transfer Concepts and Analysis for Exploration Missions (STCAEM) study. The evolution of the NTR concept is described along with the requirements, guidelines and assumptions for the design. Operating modes and options are defined and a systems description of the vehicle is presented. Artificial gravity configuration options and space and ground support systems are discussed. Finally, an implementation plan is presented which addresses technology needs, schedules, facilities and costs.

  9. Industrial Sector Technology Use Model (ISTUM): industrial energy use in the United States, 1974-2000. Volume 1. Primary model documentation. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, Roger E.; Herod, J. Steven; Andrews, Gwen L.; Budzik, Philip M.; Eissenstat, Richard S.; Grossmann, John R.; Reiner, Gary M.; Roschke, Thomas E.; Shulman, Michael J.; Toppen, Timothy R.; Veno, William R.; Violette, Daniel M.; Smolinski, Michael D.; Habel, Deborah; Cook, Alvin E.

    1979-10-01

    ISTUM is designed to predict the commercial market penetration of various energy technologies in the industrial sector out to the year 2000. It is a refinement and further development of Market Oriented Program Planning Study task force in 1977. ISTUM assesses the comparative economic competitiveness of each technology and competes over 100 energy technologies - conventionals, fossil/energy, conservation, cogeneration, solar, and geothermal. A broad overview of the model, the solution of the model, and an in-depth discussion of strength and limitations of the model are provided in Volume I. (MCW)

  10. Performance Documentation.

    Science.gov (United States)

    Foster, Paula

    2002-01-01

    Presents an interview with experts on performance documentation. Suggests that educators should strive to represent performance appraisal writing to students in a way that reflects the way it is perceived and evaluated in the workplace. Concludes that educators can enrich their pedagogy with practice by helping students understand the importance…

  11. DESIGN PACKAGE 1E SYSTEM SAFETY ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    M. Salem

    1995-06-23

    The purpose of this analysis is to systematically identify and evaluate hazards related to the Yucca Mountain Project Exploratory Studies Facility (ESF) Design Package 1E, Surface Facilities, (for a list of design items included in the package 1E system safety analysis see section 3). This process is an integral part of the systems engineering process; whereby safety is considered during planning, design, testing, and construction. A largely qualitative approach was used since a radiological System Safety Analysis is not required. The risk assessment in this analysis characterizes the accident scenarios associated with the Design Package 1E structures/systems/components(S/S/Cs) in terms of relative risk and includes recommendations for mitigating all identified risks. The priority for recommending and implementing mitigation control features is: (1) Incorporate measures to reduce risks and hazards into the structure/system/component design, (2) add safety devices and capabilities to the designs that reduce risk, (3) provide devices that detect and warn personnel of hazardous conditions, and (4) develop procedures and conduct training to increase worker awareness of potential hazards, on methods to reduce exposure to hazards, and on the actions required to avoid accidents or correct hazardous conditions.

  12. Preliminary design study of underground pumped hydro and compressed-air energy storage in hard rock. Volume 13: CAUPH preliminary licensing documentation

    Science.gov (United States)

    1981-04-01

    An implementation plan and schedule was developed for the period from project authorization by the sponsor through receipt of all required regulatory authorizations. The documentation is based upon review of all pertinent regulations on the federal, state and local level of government, review of other publications, acquisition of applicable guides and forms, and discussions with responsible agency representatives. The implementation plan is specific to the requirements within the State of Maryland: the plan is based primarily upon the state's siting procedure which provides coordinated state agency approvals. Notwithstanding the site specific nature of the plan, many of the regulatory requirements, as well as the approach to implementation, should be suitable for general reference in developing licensing plans for CAES or UPH facilities.

  13. Documenting Spreadsheets

    CERN Document Server

    Payette, Raymond

    2008-01-01

    This paper discusses spreadsheets documentation and new means to achieve this end by using Excel's built-in "Comment" function. By structuring comments, they can be used as an essential tool to fully explain spreadsheet. This will greatly facilitate spreadsheet change control, risk management and auditing. It will fill a crucial gap in corporate governance by adding essential information that can be managed in order to satisfy internal controls and accountability standards.

  14. Perceptions of document relevance

    Directory of Open Access Journals (Sweden)

    Peter eBruza

    2014-07-01

    Full Text Available This article presents a study of how humans perceive the relevance of documents.Humans are adept at making reasonably robust and quick decisions about what information is relevant to them, despite the ever increasing complexity and volume of their surrounding information environment. The literature on document relevance has identified various dimensions of relevance (e.g., topicality, novelty, etc., however little is understood about how these dimensions may interact.We performed a crowdsourced study of how human subjects judge two relevance dimensions in relation to document snippets retrieved from an internet search engine.The order of the judgement was controlled.For those judgements exhibiting an order effect, a q-test was performed to determine whether the order effects can be explained by a quantum decision model based on incompatible decision perspectives.Some evidence of incompatibility was found which suggests incompatible decision perspectives is appropriate for explaining interacting dimensions of relevance.

  15. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the iCMS Web site. The following items can be found on: http://cms.cern.ch/iCMS/ Management- CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. Management - CB - MB - FB Agendas and minutes are accessible to CMS members through their AFS account (ZH). However some linked documents are restricted to the Board Members. FB documents are only accessible to FB members. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2007 Annual reviews are posted. CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral students upon completion of their theses. Therefore it is requested that Ph.D students inform the CMS Secretariat about the nature of employment and ...

  16. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the iCMS Web site. The following items can be found on: http://cms.cern.ch/iCMS/ Management- CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. Management - CB - MB - FB Agendas and minutes are accessible to CMS members through their AFS account (ZH). However some linked documents are restricted to the Board Members. FB documents are only accessible to FB members. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2007 Annual reviews are posted. CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral students upon completion of their theses. Therefore it is requested that Ph.D students inform the CMS Secretariat about the nature of em¬pl...

  17. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the iCMS Web site. The following items can be found on: http://cms.cern.ch/iCMS/ General - CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. LHC Symposiums Management - CB - MB - FB - FMC Agendas and minutes are accessible to CMS members through their AFS account (ZH). However some linked documents are restricted to the Board Members. FB documents are only accessible to FB members. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2006 Annual reviews are posted.   CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral students upon completion of their theses. Therefore it is requested that Ph.D students inform the CMS Secretariat a...

  18. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the iCMS Web site. The following items can be found on: http://cms.cern.ch/iCMS/ General - CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. LHC Symposiums Management - CB - MB - FB - FMC Agendas and minutes are accessible to CMS members through their AFS account (ZH). However some linked documents are restricted to the Board Members. FB documents are only accessible to FB members. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2006 Annual reviews are posted. CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral students upon completion of their theses. Therefore it is requested that Ph.D students inform the CMS Secretariat about the natur...

  19. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the iCMS Web site. The following items can be found on: http://cms.cern.ch/iCMS/ General - CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. LHC Symposiums Management - CB - MB - FB - FMC Agendas and minutes are accessible to CMS members through their AFS account (ZH). However some linked documents are restricted to the Board Members. FB documents are only accessible to FB members. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2006 Annual reviews are posted. CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral students upon completion of their theses. Therefore it is requested that Ph.D students inform the CMS Secretariat about the natu...

  20. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the iCMS Web site. The following items can be found on: http://cms.cern.ch/iCMS/ General - CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. LHC Symposiums Management - CB - MB - FB - FMC Agendas and minutes are accessible to CMS members through their AFS account (ZH). However some linked documents are restricted to the Board Members. FB documents are only accessible to FB members. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2006 Annual reviews are posted. CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral students upon completion of their theses. Therefore it is requested that Ph.D students inform the CMS Secretariat about the na...

  1. Technical support document: Energy efficiency standards for consumer products: Room air conditioners, water heaters, direct heating equipment, mobile home furnaces, kitchen ranges and ovens, pool heaters, fluorescent lamp ballasts and television sets. Volume 1, Methodology

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    The Energy Policy and Conservation Act (P.L. 94-163), as amended, establishes energy conservation standards for 12 of the 13 types of consumer products specifically covered by the Act. The legislation requires the Department of Energy (DOE) to consider new or amended standards for these and other types of products at specified times. DOE is currently considering amending standards for seven types of products: water heaters, direct heating equipment, mobile home furnaces, pool heaters, room air conditioners, kitchen ranges and ovens (including microwave ovens), and fluorescent light ballasts and is considering establishing standards for television sets. This Technical Support Document presents the methodology, data, and results from the analysis of the energy and economic impacts of the proposed standards. This volume presents a general description of the analytic approach, including the structure of the major models.

  2. DOE-2 supplement: Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch (James J.) and Associates, Camarillo, CA (United States)

    1993-11-01

    This publication updates the DOE-2 Supplement form version 2.1D to version to 2.1E. It contains detailed discussions and instructions for using the features and enhancements introduced into the 2.1B, 2.1C, 2.1D, and 2.1E versions of the program. The building description section contains information on input functions in loads and systems, hourly report frequencies, saving files of hourly output for post processing, sharing hourly report data among program modules, the metric option, and input macros and general library features. The loads section contains information on sunspaces, sunspace modeling, window management and solar radiation, daylighting, trombe walls, fixed shades, fins and overhangs, shade schedules, self shades, heat distribution from lights, the Sherman-Grimsrud infiltrations method. terrain and height modification to wind speed, floor multipliers and interior wall types, improved exterior infrared radiation loss calculation, improved outside air film conductance calculation, window library, window frames, and switchable glazing. The systems section contains information on energy end use and meters, powered induction units, a packaged variable volume -- variable temperature system, a residential variable volume -- variable temperature system, air source heat pump enhancements, water loop heat pump enhancements, variable speed electric heat pump, gas heat pumps, hot water heaters, evaporative cooling, total gas solid-desiccant systems, add on desiccant cooling, water cooled condensers, evaporative precoolers outside air economizer control, optimum fan start, heat recovery from refrigerated case work, night ventilation, baseboard heating, moisture balance calculations, a residential natural ventilation algorithm, improved cooling coil model, system sizing and independent cooling and heating sizing ratios. The plant section contains information on energy meters, gas fired absorption chillers, engine driven compressor chillers, and ice energy storage.

  3. Summit documents; Documents du sommet

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    This document gathers three declarations about the non-proliferation of massive destruction weapons, made by the G8 organization participants during their last summit held in Evian (France): declaration about the enforcement and respect of the non-proliferation measures implemented by the IAEA and by the conventions for chemical and biological weapons; declaration about the protection of radioactive sources against diversion (regulatory control, inventory, control of sources export etc..); warranty about the security of radioactive sources (G8 approach, sustain of the IAEA action, sustain to the most vulnerable states, control mechanisms, political commitment of states, implementation of the recommendations of the international conference about the security and safety of radiation sources, held in Vienna (Austria) on March 2003. (J.S.)

  4. CMS DOCUMENTATION

    CERN Multimedia

    CMS TALKS AT MAJOR MEETINGS The agenda and talks from major CMS meetings can now be electronically accessed from the ICMS Web site. The following items can be found on: http://cms.cern.ch/iCMS Management – CMS Weeks (Collaboration Meetings), CMS Weeks Agendas The talks presented at the Plenary Sessions. Management – CB – MB – FB Agendas and minutes are accessible to CMS members through Indico. LHCC The talks presented at the ‘CMS Meetings with LHCC Referees’ are available on request from the PM or MB Country Representative. Annual Reviews The talks presented at the 2008 Annual Reviews are posted in Indico. CMS DOCUMENTS It is considered useful to establish information on the first employment of CMS doctoral student upon completion of their theses.  Therefore it is requested that Ph.D students inform the CMS Secretariat about the nature of employment and name of their first employer. The Notes, Conference Reports and Theses published si...

  5. High-risk clinical target volume delineation in CT-guided cervical cancer brachytherapy - Impact of information from FIGO stage with or without systematic inclusion of 3D documentation of clinical gynecological examination

    Energy Technology Data Exchange (ETDEWEB)

    Hegazy, Neamat [Dept. of Radiotherapy, Comprehensive Cancer Centre Vienna, Medical Univ. of Vienna, Vienna (Austria); Dept. of Clinical Oncology, Medical Univ. of Alexandria, Alexandria (Egypt); Poetter Rickard; Kirisits, Christian [Dept. of Radiotherapy, Comprehensive Cancer Centre Vienna, Medical Univ. of Vienna, Vienna (Austria); Christian Doppler Lab. for Medical Radiation Research for Radiation Oncology, Medical Univ. Vienna (Austria); Berger, Daniel; Federico, Mario; Sturdza, Alina; Nesvacil, Nicole [Dept. of Radiotherapy, Comprehensive Cancer Centre Vienna, Medical Univ. of Vienna, Vienna (Austria)], e-mail: nicole.nesvacil@meduniwien.ac.at

    2013-10-15

    Purpose: The aim of the study was to improve computed tomography (CT)-based high-risk clinical target volume (HR CTV) delineation protocols for cervix cancer patients, in settings without any access to magnetic resonance imaging (MRI) at the time of brachytherapy. Therefore the value of a systematic integration of comprehensive three-dimensional (3D) documentation of repetitive gynecological examination for CT-based HR CTV delineation protocols, in addition to information from FIGO staging, was investigated. In addition to a comparison between reference MRI contours and two different CT-based contouring methods (using complementary information from FIGO staging with or without additional 3D clinical drawings), the use of standardized uterine heights was also investigated. Material and methods: Thirty-five cervix cancer patients with CT- and MR-images and 3D clinical drawings at time of diagnosis and brachytherapy were included. HR CTV{sub stage} was based on CT information and FIGO stage. HR CTV{sub stage} {sub +3Dclin} was contoured on CT using FIGO stage and 3D clinical drawing. Standardized HR CTV heights were: 1/1, 2/3 and 1/2 of uterine height. MRI-based HR CTV was delineated independently. Resulting widths, thicknesses, heights, and volumes of HR CTV{sub stage}, HR CTV{sub stage+3Dclin} and MRI-based HR CTV contours were compared. Results: The overall normalized volume ratios (mean{+-}SD of CT/MRI{sub ref} volume) of HR CTV{sub stage} and HR{sub stage+3Dclin} were 2.6 ({+-}0.6) and 2.1 ({+-}0.4) for 1/1 and 2.3 ({+-}0.5) and 1.8 ({+-}0.4), for 2/3, and 1.9 ({+-}0.5) and 1.5 ({+-}0.3), for 1/2 of uterine height. The mean normalized widths were 1.5{+-}0.2 and 1.2{+-}0.2 for HR CTV{sub stage} and HR CTV{sub stage+3Dclin}, respectively (p < 0.05). The mean normalized heights for HR CTV{sub stage} and HR CTV{sub stage+3Dclin} were both 1.7{+-}0.4 for 1/1 (p < 0.05.), 1.3{+-}0.3 for 2/3 (p < 0.05) and 1.1{+-}0.3 for 1/2 of uterine height. Conclusion: CT-based HR

  6. Omega documentation

    Energy Technology Data Exchange (ETDEWEB)

    Howerton, R.J.; Dye, R.E.; Giles, P.C.; Kimlinger, J.R.; Perkins, S.T.; Plechaty, E.F.

    1983-08-01

    OMEGA is a CRAY I computer program that controls nine codes used by LLNL Physical Data Group for: 1) updating the libraries of evaluated data maintained by the group (UPDATE); 2) calculating average values of energy deposited in secondary particles and residual nuclei (ENDEP); 3) checking the libraries for internal consistency, especially for energy conservation (GAMCHK); 4) producing listings, indexes and plots of the library data (UTILITY); 5) producing calculational constants such as group averaged cross sections and transfer matrices for diffusion and Sn transport codes (CLYDE); 6) producing and updating standard files of the calculational constants used by LLNL Sn and diffusion transport codes (NDFL); 7) producing calculational constants for Monte Carlo transport codes that use group-averaged cross sections and continuous energy for particles (CTART); 8) producing and updating standard files used by the LLNL Monte Carlo transport codes (TRTL); and 9) producing standard files used by the LANL pointwise Monte Carlo transport code MCNP (MCPOINT). The first four of these functions and codes deal with the libraries of evaluated data and the last five with various aspects of producing calculational constants for use by transport codes. In 1970 a series, called PD memos, of internal and informal memoranda was begun. These were intended to be circulated among the group for comment and then to provide documentation for later reference whenever questions arose about the subject matter of the memos. They have served this purpose and now will be drawn upon as source material for this more comprehensive report that deals with most of the matters covered in those memos.

  7. Omega documentation

    Energy Technology Data Exchange (ETDEWEB)

    Howerton, R.J.; Dye, R.E.; Giles, P.C.; Kimlinger, J.R.; Perkins, S.T.; Plechaty, E.F.

    1983-08-01

    OMEGA is a CRAY I computer program that controls nine codes used by LLNL Physical Data Group for: 1) updating the libraries of evaluated data maintained by the group (UPDATE); 2) calculating average values of energy deposited in secondary particles and residual nuclei (ENDEP); 3) checking the libraries for internal consistency, especially for energy conservation (GAMCHK); 4) producing listings, indexes and plots of the library data (UTILITY); 5) producing calculational constants such as group averaged cross sections and transfer matrices for diffusion and Sn transport codes (CLYDE); 6) producing and updating standard files of the calculational constants used by LLNL Sn and diffusion transport codes (NDFL); 7) producing calculational constants for Monte Carlo transport codes that use group-averaged cross sections and continuous energy for particles (CTART); 8) producing and updating standard files used by the LLNL Monte Carlo transport codes (TRTL); and 9) producing standard files used by the LANL pointwise Monte Carlo transport code MCNP (MCPOINT). The first four of these functions and codes deal with the libraries of evaluated data and the last five with various aspects of producing calculational constants for use by transport codes. In 1970 a series, called PD memos, of internal and informal memoranda was begun. These were intended to be circulated among the group for comment and then to provide documentation for later reference whenever questions arose about the subject matter of the memos. They have served this purpose and now will be drawn upon as source material for this more comprehensive report that deals with most of the matters covered in those memos.

  8. Disaster documentation for the clinician.

    Science.gov (United States)

    Zoraster, Richard M; Burkle, Christopher M

    2013-08-01

    Documentation of the patient encounter is a traditional component of health care practice, a requirement of various regulatory agencies and hospital oversight committees, and a necessity for reimbursement. A disaster may create unexpected challenges to documentation. If patient volume and acuity overwhelm health care providers, what is the acceptable appropriate documentation? If alterations in scope of practice and environmental or resource limitations occur, to what degree should this be documented? The conflicts arising from allocation of limited resources create unfamiliar situations in which patient competition becomes a component of the medical decision making; should that be documented, and, if so, how? In addition to these challenges, ever-present liability worries are compounded by controversies over the standards to which health care providers will be held. Little guidance is available on how or what to document. We conducted a search of the literature and found no appropriate references for disaster documentation, and no guidelines from professional organizations. We review here the challenges affecting documentation during disasters and provide a rationale for specific patient care documentation that avoids regulatory and legal pitfalls.

  9. Main: 1E4N [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4N トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...EVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4N.jpg ...

  10. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  11. Main: 1E4L [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4L トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...MKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4L.jpg ...

  12. Reactor operation environmental information document

    Energy Technology Data Exchange (ETDEWEB)

    Haselow, J.S.; Price, V.; Stephenson, D.E.; Bledsoe, H.W.; Looney, B.B.

    1989-12-01

    The Savannah River Site (SRS) produces nuclear materials, primarily plutonium and tritium, to meet the requirements of the Department of Defense. These products have been formed in nuclear reactors that were built during 1950--1955 at the SRS. K, L, and P reactors are three of five reactors that have been used in the past to produce the nuclear materials. All three of these reactors discontinued operation in 1988. Currently, intense efforts are being extended to prepare these three reactors for restart in a manner that protects human health and the environment. To document that restarting the reactors will have minimal impacts to human health and the environment, a three-volume Reactor Operations Environmental Impact Document has been prepared. The document focuses on the impacts of restarting the K, L, and P reactors on both the SRS and surrounding areas. This volume discusses the geology, seismology, and subsurface hydrology. 195 refs., 101 figs., 16 tabs.

  13. SANSMIC design document.

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Paula D. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Rudeen, David Keith [GRAM, Inc., Albuquerque, NM (United States)

    2015-07-01

    The United States Strategic Petroleum Reserve (SPR) maintains an underground storage system consisting of caverns that were leached or solution mined in four salt domes located near the Gulf of Mexico in Texas and Louisiana. The SPR comprises more than 60 active caverns containing approximately 700 million barrels of crude oil. Sandia National Labo- ratories (SNL) is the geotechnical advisor to the SPR. As the most pressing need at the inception of the SPR was to create and fill storage volume with oil, the decision was made to leach the caverns and fill them simultaneously (leach-fill). Therefore, A.J. Russo developed SANSMIC in the early 1980s which allows for a transient oil-brine interface (OBI) making it possible to model leach-fill and withdrawal operations. As the majority of caverns are currently filled to storage capacity, the primary uses of SANSMIC at this time are related to the effects of small and large withdrawals, expansion of existing caverns, and projecting future pillar to diameter ratios. SANSMIC was identified by SNL as a priority candidate for qualification. This report continues the quality assurance (QA) process by documenting the "as built" mathematical and numerical models that comprise this document. The pro- gram flow is outlined and the models are discussed in detail. Code features that were added later or were not documented previously have been expounded. No changes in the code's physics have occurred since the original documentation (Russo, 1981, 1983) although recent experiments may yield improvements to the temperature and plume methods in the future.

  14. Technical support document: Energy efficiency standards for consumer products: Room air conditioners, water heaters, direct heating equipment, mobile home furnaces, kitchen ranges and ovens, pool heaters, fluorescent lamp ballasts and television sets. Volume 2, Fluorescent lamp ballasts, television sets, room air conditioners, and kitchen ranges and ovens

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    This document is divided into ``volumes`` B through E, dealing with individual classes of consumer products. Chapters in each present engineering analysis, base case forecasts, projected national impacts of standards, life-cycle costs and payback periods, impacts on manufacturers, impacts of standards on electric utilities, and environmental effects. Supporting appendices are included.

  15. Exploiting Document Level Semantics in Document Clustering

    Directory of Open Access Journals (Sweden)

    Muhammad Rafi

    2016-06-01

    Full Text Available Document clustering is an unsupervised machine learning method that separates a large subject heterogeneous collection (Corpus into smaller, more manageable, subject homogeneous collections (clusters. Traditional method of document clustering works around extracting textual features like: terms, sequences, and phrases from documents. These features are independent of each other and do not cater meaning behind these word in the clustering process. In order to perform semantic viable clustering, we believe that the problem of document clustering has two main components: (1 to represent the document in such a form that it inherently captures semantics of the text. This may also help to reduce dimensionality of the document and (2 to define a similarity measure based on the lexical, syntactic and semantic features such that it assigns higher numerical values to document pairs which have higher syntactic and semantic relationship. In this paper, we propose a representation of document by extracting three different types of features from a given document. These are lexical , syntactic and semantic features. A meta-descriptor for each document is proposed using these three features: first lexical, then syntactic and in the last semantic. A document to document similarity matrix is produced where each entry of this matrix contains a three value vector for each lexical , syntactic and semantic . The main contributions from this research are (i A document level descriptor using three different features for text like: lexical, syntactic and semantics. (ii we propose a similarity function using these three, and (iii we define a new candidate clustering algorithm using three component of similarity measure to guide the clustering process in a direction that produce more semantic rich clusters. We performed an extensive series of experiments on standard text mining data sets with external clustering evaluations like: FMeasure and Purity, and have obtained

  16. Informative document waste plastics

    NARCIS (Netherlands)

    Nagelhout D; Sein AA; Duvoort GL

    1989-01-01

    This "Informative document waste plastics" forms part of a series of "informative documents waste materials". These documents are conducted by RIVM on the indstruction of the Directorate General for the Environment, Waste Materials Directorate, in behalf of the program of

  17. Generic safety documentation model

    Energy Technology Data Exchange (ETDEWEB)

    Mahn, J.A.

    1994-04-01

    This document is intended to be a resource for preparers of safety documentation for Sandia National Laboratories, New Mexico facilities. It provides standardized discussions of some topics that are generic to most, if not all, Sandia/NM facilities safety documents. The material provides a ``core`` upon which to develop facility-specific safety documentation. The use of the information in this document will reduce the cost of safety document preparation and improve consistency of information.

  18. Binarization of Document Image

    Directory of Open Access Journals (Sweden)

    G.silpalatha

    2016-05-01

    Full Text Available Documents Image Binarization is performed in the preprocessing stage for document analysis and it aims to segment the foreground text from the document background. A fast and accurate document image binarization technique is important for the ensuing document image processing tasks such as optical character recognition (OCR. Though document image binarization has been studied for many years, the thresholding of degraded document images is still an unsolved problem due to the high inter/intra variation between the text stroke and the document background across different document images. The handwritten text within the degraded documents often shows a certain amount of variation in terms of the stroke width, stroke brightness, stroke connection, and document background. In addition, historical documents are often degraded by the bleed. Documents are often degraded by different types of imaging artifact. These different types of document degradations tend to induce the document thresholding error and make degraded document image binarization a big challenge to most state-of-the-art techniques. The proposed method is simple, robust and capable of handling different types of degraded document images with minimum parameter tuning. It makes use of the adaptive image contrast that combines the local image contrast and the local image gradient adaptively and therefore is tolerant to the text and background variation caused by different types of document degradations. In particular, the proposed technique addresses the over-normalization problem of the local maximum minimum algorithm. At the same time, the parameters used in the algorithm can be adaptively estimated

  19. Automated document analysis system

    Science.gov (United States)

    Black, Jeffrey D.; Dietzel, Robert; Hartnett, David

    2002-08-01

    A software application has been developed to aid law enforcement and government intelligence gathering organizations in the translation and analysis of foreign language documents with potential intelligence content. The Automated Document Analysis System (ADAS) provides the capability to search (data or text mine) documents in English and the most commonly encountered foreign languages, including Arabic. Hardcopy documents are scanned by a high-speed scanner and are optical character recognized (OCR). Documents obtained in an electronic format bypass the OCR and are copied directly to a working directory. For translation and analysis, the script and the language of the documents are first determined. If the document is not in English, the document is machine translated to English. The documents are searched for keywords and key features in either the native language or translated English. The user can quickly review the document to determine if it has any intelligence content and whether detailed, verbatim human translation is required. The documents and document content are cataloged for potential future analysis. The system allows non-linguists to evaluate foreign language documents and allows for the quick analysis of a large quantity of documents. All document processing can be performed manually or automatically on a single document or a batch of documents.

  20. Cognitive Temporal Document Priors

    NARCIS (Netherlands)

    Peetz, M.H.; de Rijke, M.

    2013-01-01

    Temporal information retrieval exploits temporal features of document collections and queries. Temporal document priors are used to adjust the score of a document based on its publication time. We consider a class of temporal document priors that is inspired by retention functions considered in cogn

  1. Registration document 2005; Document de reference 2005

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This reference document of Gaz de France provides information and data on the Group activities in 2005: financial informations, business, activities, equipments factories and real estate, trade, capital, organization charts, employment, contracts and research programs. (A.L.B.)

  2. 2002 reference document; Document de reference 2002

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This 2002 reference document of the group Areva, provides information on the society. Organized in seven chapters, it presents the persons responsible for the reference document and for auditing the financial statements, information pertaining to the transaction, general information on the company and share capital, information on company operation, changes and future prospects, assets, financial position, financial performance, information on company management and executive board and supervisory board, recent developments and future prospects. (A.L.B.)

  3. Subject (of documents)

    DEFF Research Database (Denmark)

    Hjørland, Birger

    2017-01-01

    This article presents and discuss the concept “subject” or subject matter (of documents) as it has been examined in library and information science (LIS) for more than 100 years. Different theoretical positions are outlined and it is found that the most important distinction is between document......-oriented views versus request-oriented views. The document-oriented view conceive subject as something inherent in documents, whereas the request-oriented view (or the policy based view) understand subject as an attribution made to documents in order to facilitate certain uses of them. Related concepts...... such as concepts, aboutness, topic, isness and ofness are also briefly presented. The conclusion is that the most fruitful way of defining “subject” (of a document) is the documents informative or epistemological potentials, that is, the documents potentials of informing users and advance the development...

  4. Intranet Document Management Systems.

    Science.gov (United States)

    Wen, H. Joseph; Yen, David C.; Lin, Binshan

    1998-01-01

    Explains how intranets facilitate documentation availability within a company at substantial cost savings. Topics include intranet document management systems (IDMS); publication costs for printed materials; hardware and software specifications; performance; and security. (Author/LRW)

  5. Subject (of documents)

    DEFF Research Database (Denmark)

    Hjørland, Birger

    2017-01-01

    This article presents and discuss the concept “subject” or subject matter (of documents) as it has been examined in library and information science (LIS) for more than 100 years. Different theoretical positions are outlined and it is found that the most important distinction is between document...... such as concepts, aboutness, topic, isness and ofness are also briefly presented. The conclusion is that the most fruitful way of defining “subject” (of a document) is the documents informative or epistemological potentials, that is, the documents potentials of informing users and advance the development......-oriented views versus request-oriented views. The document-oriented view conceive subject as something inherent in documents, whereas the request-oriented view (or the policy based view) understand subject as an attribution made to documents in order to facilitate certain uses of them. Related concepts...

  6. Enterprise Document Management

    Data.gov (United States)

    US Agency for International Development — The function of the operation is to provide e-Signature and document management support for Acquisition and Assisitance (A&A) documents including vouchers in...

  7. Informative document waste plastics

    NARCIS (Netherlands)

    Nagelhout D; Sein AA; Duvoort GL

    1989-01-01

    This "Informative document waste plastics" forms part of a series of "informative documents waste materials". These documents are conducted by RIVM on the indstruction of the Directorate General for the Environment, Waste Materials Directorate, in behalf of the program of acti

  8. Documenting Employee Conduct

    Science.gov (United States)

    Dalton, Jason

    2009-01-01

    One of the best ways for a child care program to lose an employment-related lawsuit is failure to document the performance of its employees. Documentation of an employee's performance can provide evidence of an employment-related decision such as discipline, promotion, or discharge. When properly implemented, documentation of employee performance…

  9. Purification and Structural Analysis of Plectin and BPAG1e.

    Science.gov (United States)

    Manso, José A; García Rubio, Inés; Gómez-Hernández, María; Ortega, Esther; Buey, Rubén M; Carballido, Ana M; Carabias, Arturo; Alonso-García, Noelia; de Pereda, José M

    2016-01-01

    Plectin and BPAG1e belong to the plakin family of high-molecular-weight proteins that interconnect the cytoskeletal systems and anchor them to junctional complexes. Plectin and BPAG1e are prototypical plakins with a similar tripartite modular structure. The N- and C-terminal regions are built of multiple discrete structural domains, while the central rod domain mediates dimerization by coiled-coil interactions. Owing to the mosaic organization of plakins, the structure of their constituent individual domains or small multi-domain segments can be analyzed isolated. Yet, understanding the integrated function of large regions, oligomers, and heterocomplexes of plakins is difficult due to the large and segmented structure. Here, we describe methods for the production of plectin and BPAG1e samples suitable for structural and biophysical analysis. In addition, we discuss the combination of hybrid methods that yield information at several resolution levels to study the complex, multi-domain, and flexible structure of plakins.

  10. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels

    Directory of Open Access Journals (Sweden)

    Bernat Elvira

    2015-11-01

    Full Text Available Background/Aims: KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase and OSR1 (oxidative stress-responsive kinase 1, which are under control of WNK (with-no-K[Lys] kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. Methods: cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1. Results: KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. Conclusions: SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity.

  11. Starlink Document Styles

    Science.gov (United States)

    Lawden, M. D.

    This document describes the various styles which are recommended for Starlink documents. It also explains how to use the templates which are provided by Starlink to help authors create documents in a standard style. This paper is concerned mainly with conveying the ``look and feel" of the various styles of Starlink document rather than describing the technical details of how to produce them. Other Starlink papers give recommendations for the detailed aspects of document production, design, layout, and typography. The only style that is likely to be used by most Starlink authors is the Standard style.

  12. Scheme Program Documentation Tools

    DEFF Research Database (Denmark)

    Nørmark, Kurt

    2004-01-01

    This paper describes and discusses two different Scheme documentation tools. The first is SchemeDoc, which is intended for documentation of the interfaces of Scheme libraries (APIs). The second is the Scheme Elucidator, which is for internal documentation of Scheme programs. Although the tools...... are separate and intended for different documentation purposes they are related to each other in several ways. Both tools are based on XML languages for tool setup and for documentation authoring. In addition, both tools rely on the LAML framework which---in a systematic way---makes an XML language available...

  13. Analysis of trapped gas in 1E34 detonators by gas chromatography

    Energy Technology Data Exchange (ETDEWEB)

    Warner, D.K.; Back, P.S.; Barnhart, B.V.

    1980-05-14

    A method was developed to extract and then analyze gas trapped in thermally aged 1E34 detonators. This gas was extracted into an evacuated volume and injected into a gas chromatograph for separation and quantitative analysis. To effect this gas extraction, a device was designed for puncturing the detonator cup and capturing the effused gas. Limited testing of five detonators in this device shows amounts of gas ranging from about 0.5 X 10 {sup -7} to 12 X 10 {sup - 7} moles.

  14. The precessing jets of 1E 1740.7-2942

    CERN Document Server

    Luque-Escamilla, Pedro L; Martinez-Aroza, Josee

    2015-01-01

    Context. 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims. Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of its 'twin' GRS 1758-258. Methods. We carried out an in-depth exploration of the VLA public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results. We cl...

  15. Relation Based Mining Model for Enhancing Web Document Clustering

    Directory of Open Access Journals (Sweden)

    M.Reka

    2014-05-01

    Full Text Available The design of web Information management system becomes more complex one with more time complexity. Information retrieval is a difficult task due to the huge volume of web documents. The way of clustering makes the retrieval easier and less time consuming. Thisalgorithm introducesa web document clustering approach, which use the semantic relation between documents, which reduces the time complexity. It identifies the relations and concepts in a document and also computes the relation score between documents. This algorithm analyses the key concepts from the web documents by preprocessing, stemming, and stop word removal. Identified concepts are used to compute the document relation score and clusterrelation score. The domain ontology is used to compute the document relation score and cluster relation score. Based on the document relation score and cluster relation score, the web document cluster is identified. This algorithm uses 2,00,000 web documents for evaluation and 60 percentas trainingset and 40 percent as testing set.

  16. Public comments on the proposed 10 CFR Part 51 rule for renewal of nuclear power plant operating licenses and supporting documents: Review of concerns and NRC staff response. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    This report documents the Nuclear Regulatory Commission (NRC) staff review of public comments provided in response to the NRC`s proposed amendments to 10 Code of Federal Regulations (CFR) Part 51, which establish new requirements for the environmental review of applications for the renewal of operating licenses of nuclear power plants. The public comments include those submitted in writing, as well as those provided at public meetings that were held with other Federal agencies, State agencies, nuclear industry representatives, public interest groups, and the general public. This report also contains the NRC staff response to the various concerns raised, and highlights the changes made to the final rule and the supporting documents in response to these concerns.

  17. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  18. Calculus Students' Understanding of Volume

    Science.gov (United States)

    Dorko, Allison; Speer, Natasha M.

    2013-01-01

    Researchers have documented difficulties that elementary school students have in understanding volume. Despite its importance in higher mathematics, we know little about college students' understanding of volume. This study investigated calculus students' understanding of volume. Clinical interview transcripts and written responses to volume…

  19. Data of evolutionary structure change: 1E4XH-1JGUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XH-1JGUH 1E4X 1JGU H H QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQ...EE EEE EEE EEEEEEEEEEE EEEEEEE EEEEEE --- 0... 1E4X H 1E4XHPHE CA 185 ARG CA 224 ILE CA 296 1E4X... H 1E4XH IGEILPSNGRT

  20. Data of evolutionary structure change: 1E4XI-1CF8H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1CF8H 1E4X 1CF8 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFT-NYWMHWVK...EEE EEEEEEEEEE EEEEEEE EEEEEE - 0 1E4X... I 1E4XI...A 262 ASP CA 228 THR CA 300 ARG CA 287 1E4X... I 1E4XI

  1. Data of evolutionary structure change: 1E4XI-1LO3H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1LO3H 1E4X 1LO3 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFTNYWMHWVKQ...EEEEEEEEEEHHHH EEEEEEE EEEEE - 0 1E4X... I 1E4XI ...6 LEU CA 230 ILE CA 298 TYR CA 288 1E4X... I 1E4XI GEILPSNGRTN

  2. Tobacco documents research methodology.

    Science.gov (United States)

    Anderson, Stacey J; McCandless, Phyra M; Klausner, Kim; Taketa, Rachel; Yerger, Valerie B

    2011-05-01

    Tobacco documents research has developed into a thriving academic enterprise since its inception in 1995. The technology supporting tobacco documents archiving, searching and retrieval has improved greatly since that time, and consequently tobacco documents researchers have considerably more access to resources than was the case when researchers had to travel to physical archives and/or electronically search poorly and incompletely indexed documents. The authors of the papers presented in this supplement all followed the same basic research methodology. Rather than leave the reader of the supplement to read the same discussion of methods in each individual paper, presented here is an overview of the methods all authors followed. In the individual articles that follow in this supplement, the authors present the additional methodological information specific to their topics. This brief discussion also highlights technological capabilities in the Legacy Tobacco Documents Library and updates methods for organising internal tobacco documents data and findings.

  3. The precessing jets of 1E 1740.7-2942

    Science.gov (United States)

    Luque-Escamilla, Pedro L.; Martí, Josep; Martínez-Aroza, José

    2015-12-01

    Context. The source 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims: Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of the very similar source GRS 1758-258. Methods: We carried out an in-depth exploration of the Very Large Array public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results: We clearly detected structural changes in the arc-minute jets of 1E 1740.7-2942 on timescales of roughly a year, which set a firm distance upper limit of 12 kpc. Moreover, a simple precessing twin-jet model was simultaneously fitted to the five observing epochs available. The observed changes in the jet flow are strongly suggestive of a precession period of ~1.3 yr. Conclusions: The fitting of the precession model to the data yields a distance of ~5 kpc. This value, and the observed changes, rule out any remaining doubts about the 1E 1740.7-2942 Galactic nature. To our knowledge, this microquasar is the second whose jet precession ephemeris become available after SS433. This kind of information is relevant to the physics of compact objects, since the genesis of the precession phenomenon occurs very close to the interplay region between the accretion disk and the compact object in the system. Appendix A and a movie associated to

  4. Technical support document: Energy efficiency standards for consumer products: Room air conditioners, water heaters, direct heating equipment, mobile home furnaces, kitchen ranges and ovens, pool heaters, fluorescent lamp ballasts and television sets. Volume 3, Water heaters, pool heaters, direct heating equipment, and mobile home furnaces

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    This is Volume 3 in a series of documents on energy efficiency of consumer products. This volume discusses energy efficiency of water heaters. Water heaters are defined by NAECA as products that utilize oil, gas, or electricity to heat potable water for use outside the heater upon demand. These are major appliances, which use a large portion (18% on average) of total energy consumed per household (1). They differ from most other appliances in that they are usually installed in obscure locations as part of the plumbing and are ignored until they fail. Residential water heaters are capable of heating water up to 180{degrees}F, although the setpoints are usually set lower.

  5. CAED Document Repository

    Data.gov (United States)

    U.S. Environmental Protection Agency — Compliance Assurance and Enforcement Division Document Repository (CAEDDOCRESP) provides internal and external access of Inspection Records, Enforcement Actions, and...

  6. CFO Payment Document Management

    Data.gov (United States)

    US Agency for International Development — Paperless management will enable the CFO to create, store, and access various financial documents electronically. This capability will reduce time looking for...

  7. Manual of Documentation Practices Applicable to Defence-Aerospace Scientific and Technical Information. Volume 2. Section 4 - Data Recording and Storage. Section 5 - Mechanization Systems and Operations. Section 6 - Announcement Services and Publications

    Science.gov (United States)

    1979-07-01

    of anl ISBN is explined inl British Standard 4S 4762: 197 1. ’fil check digit of an1 ISBN number is used to guardl against errors ts transcription ...travels to the Data Prep Room with the parent document and, to minimise errors of transcription , as much bibliographic information as possible is copied...11p0liations, wvith the dhara"Iers emnbussed at tlie ends of ’petals’ fornied by mecans of radial cuts tit a flat Jib%, about 75 mim in diameter. As the disc

  8. Human Document Project

    NARCIS (Netherlands)

    Vries, de J.; Abelmann, L.; Manz, A.; Elwenspoek, M.C.

    2012-01-01

    “The Human Document Project” is a project which tries to answer all of the questions related to preserving information about the human race for tens of generations of humans to come or maybe even for a future intelligence which can emerge in the coming thousands of years. This document mainly focuss

  9. Scheme Program Documentation Tools

    DEFF Research Database (Denmark)

    Nørmark, Kurt

    2004-01-01

    are separate and intended for different documentation purposes they are related to each other in several ways. Both tools are based on XML languages for tool setup and for documentation authoring. In addition, both tools rely on the LAML framework which---in a systematic way---makes an XML language available...

  10. Enriching software architecture documentation

    NARCIS (Netherlands)

    Jansen, Anton; Avgeriou, Paris; Ven, Jan Salvador van der

    2009-01-01

    The effective documentation of Architectural Knowledge (AK) is one of the key factors in leveraging the paradigm shift toward sharing and reusing AK. However, current documentation approaches have severe shortcomings in capturing the knowledge of large and complex systems and subsequently facilitati

  11. IDC System Specification Document.

    Energy Technology Data Exchange (ETDEWEB)

    Clifford, David J.

    2014-12-01

    This document contains the system specifications derived to satisfy the system requirements found in the IDC System Requirements Document for the IDC Reengineering Phase 2 project. Revisions Version Date Author/Team Revision Description Authorized by V1.0 12/2014 IDC Reengineering Project Team Initial delivery M. Harris

  12. Status and Habitat Requirements of the White Sturgeon Populations in the Columbia River Downstream from McNary Dam Volume II; Supplemental Papers and Data Documentation, 1986-1992 Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Beamesderfer, Raymond C.; Nigro, Anthony A. [Oregon Dept. of Fish and Wildlife, Clackamas, OR (US)

    1995-01-01

    This is the final report for research on white sturgeon Acipenser transmontanus from 1986--92 and conducted by the National Marine Fisheries Service (NMFS), Oregon Department of Fish and Wildlife (ODFW), US Fish and Wildlife Service (USFWS), and Washington Department of Fisheries (WDF). Findings are presented as a series of papers, each detailing objectives, methods, results, and conclusions for a portion of this research. This volume includes supplemental papers which provide background information needed to support results of the primary investigations addressed in Volume 1. This study addresses measure 903(e)(1) of the Northwest Power Planning Council's 1987 Fish and Wildlife Program that calls for ''research to determine the impact of development and operation of the hydropower system on sturgeon in the Columbia River Basin.'' Study objectives correspond to those of the ''White Sturgeon Research Program Implementation Plan'' developed by BPA and approved by the Northwest Power Planning Council in 1985. Work was conducted on the Columbia River from McNary Dam to the estuary.

  13. X-1E Loaded in B-29 Mothership on Ramp

    Science.gov (United States)

    1955-01-01

    The Bell Aircraft Corporation X-1E airplane being loaded under the mothership, Boeing B-29. The X-planes had originally been lowered into a loading pit and the launch aircraft towed over the pit, where the rocket plane was hoisted by belly straps into the bomb bay. By the early 1950s a hydraulic lift had been installed on the ramp at the NACA High-Speed Flight Station to elevate the launch aircraft and then lower it over the rocket plane for mating.

  14. NCDC Archive Documentation Manuals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Climatic Data Center Tape Deck Documentation library is a collection of over 400 manuals describing NCDC's digital holdings (both historic and current)....

  15. Transportation System Requirements Document

    Energy Technology Data Exchange (ETDEWEB)

    1993-09-01

    This Transportation System Requirements Document (Trans-SRD) describes the functions to be performed by and the technical requirements for the Transportation System to transport spent nuclear fuel (SNF) and high-level radioactive waste (HLW) from Purchaser and Producer sites to a Civilian Radioactive Waste Management System (CRWMS) site, and between CRWMS sites. The purpose of this document is to define the system-level requirements for Transportation consistent with the CRWMS Requirement Document (CRD). These requirements include design and operations requirements to the extent they impact on the development of the physical segments of Transportation. The document also presents an overall description of Transportation, its functions, its segments, and the requirements allocated to the segments and the system-level interfaces with Transportation. The interface identification and description are published in the CRWMS Interface Specification.

  16. Software Document Inventory Program

    Science.gov (United States)

    Merwarth, P. D.

    1984-01-01

    Program offers ways to file and locate sources of reference. DOCLIB system consists of two parts to serve needs of two type of users: general user and librarian. DOCLIB systems provides user with interactive, menudriven document inventory capability.

  17. Document Flash Thermography

    OpenAIRE

    Larsen, Cory; Baker, Doran

    2011-01-01

    This paper presents an extension of flash thermography techniques to the analysis of documents. Motivation for this research is to develop the ability to reveal covered writings in archaeological artifacts such as the Codex Selden or Egyptian Cartonnage. An emphasis is placed on evaluating several common existing signal processing techniques for their effectiveness in enhancing subsurface writings found within a set of test documents. These processing techniques include: contrast stretching, ...

  18. Document Flash Thermography

    OpenAIRE

    Larsen, Cory A.

    2011-01-01

    This thesis presents the application of ash thermography techniques to the analysis of documents. The motivation for this research is to develop the ability to non-destructively reveal covered writings in archaeological artifacts such as the Codex Selden or Egyptian car- tonnage. Current common signal processing techniques are evaluated for their effectiveness in enhancing subsurface writings found within a set of test documents. These processing techniques include: false colorization, contra...

  19. Are PDF Documents Accessible?

    Directory of Open Access Journals (Sweden)

    Mireia Ribera Turró

    2008-09-01

    Full Text Available Adobe PDF is one of the most widely used formats in scientific communications and in administrative documents. In its latest versions it has incorporated structural tags and improvements that increase its level of accessibility. This article reviews the concept of accessibility in the reading of digital documents and evaluates the accessibility of PDF according to the most widely established standards.

  20. Aging evaluation of class 1E batteries: Seismic testing

    Energy Technology Data Exchange (ETDEWEB)

    Edson, J.L. (EG and G Idaho, Inc., Idaho Falls, ID (USA))

    1990-08-01

    This report presents the results of a seismic testing program on naturally aged class 1E batteries obtained from a nuclear plant. The testing program is a Phase 2 activity resulting from a Phase 1 aging evaluation of class 1E batteries in safety systems of nuclear power plants, performed previously as a part of the US Nuclear Regulatory Commission's Nuclear Plant Aging Research Program and reported in NUREG/CR-4457. The primary purpose of the program was to evaluate the seismic ruggedness of naturally aged batteries to determine if aged batteries could have adequate electrical capacity, as determined by tests recommended by IEEE Standards, and yet have inadequate seismic ruggedness to provide needed electrical power during and after a safe shutdown earthquake (SSE) event. A secondary purpose of the program was to evaluate selected advanced surveillance methods to determine if they were likely to be more sensitive to the aging degradation that reduces seismic ruggedness. The program used twelve batteries naturally aged to about 14 years of age in a nuclear facility and tested them at four different seismic levels representative of the levels of possible earthquakes specified for nuclear plants in the United States. Seismic testing of the batteries did not cause any loss of electrical capacity. 19 refs., 29 figs., 7 tabs.

  1. Securing XML Documents

    Directory of Open Access Journals (Sweden)

    Charles Shoniregun

    2004-11-01

    Full Text Available XML (extensible markup language is becoming the current standard for establishing interoperability on the Web. XML data are self-descriptive and syntax-extensible; this makes it very suitable for representation and exchange of semi-structured data, and allows users to define new elements for their specific applications. As a result, the number of documents incorporating this standard is continuously increasing over the Web. The processing of XML documents may require a traversal of all document structure and therefore, the cost could be very high. A strong demand for a means of efficient and effective XML processing has posed a new challenge for the database world. This paper discusses a fast and efficient indexing technique for XML documents, and introduces the XML graph numbering scheme. It can be used for indexing and securing graph structure of XML documents. This technique provides an efficient method to speed up XML data processing. Furthermore, the paper explores the classification of existing methods impact of query processing, and indexing.

  2. BEST sensitivity to O(1) eV sterile neutrino

    CERN Document Server

    Barinov, Vladislav; Gorbunov, Dmitry; Ibragimova, Tatiana

    2016-01-01

    Numerous anomalous results in neutrino oscillation experiments can be attributed to interference of ~1 eV sterile neutrino. The specially designed to fully explore the Gallium anomaly Baksan Experiment on Sterile Transitions (BEST) starts next year. We investigate the sensitivity of BEST in searches for sterile neutrino mixed with electron neutrino. Then, performing the combined analysis of all the Gallium experiments (SAGE, GALLEX, BEST) we find the regions in model parameter space (sterile neutrino mass and mixing angle), which will be excluded if BEST agrees with no sterile neutrino hypothesis. For the opposite case, if BEST observes the signal as it follows from the sterile neutrino explanation of the Gallium (SAGE and GALLEX) anomaly, we show how BEST will improve upon the present estimates of the model parameters.

  3. Data of evolutionary structure change: 1E1QA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QA-2HLDT 1E1Q 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bID> T 2HLDT ALKQVAGS

  4. Data of evolutionary structure change: 1E1RC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDT 1E1R 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI... 2HLD T 2HLDT AAFAQ--

  5. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  6. Segmentation of complex document

    Directory of Open Access Journals (Sweden)

    Souad Oudjemia

    2014-06-01

    Full Text Available In this paper we present a method for segmentation of documents image with complex structure. This technique based on GLCM (Grey Level Co-occurrence Matrix used to segment this type of document in three regions namely, 'graphics', 'background' and 'text'. Very briefly, this method is to divide the document image, in block size chosen after a series of tests and then applying the co-occurrence matrix to each block in order to extract five textural parameters which are energy, entropy, the sum entropy, difference entropy and standard deviation. These parameters are then used to classify the image into three regions using the k-means algorithm; the last step of segmentation is obtained by grouping connected pixels. Two performance measurements are performed for both graphics and text zones; we have obtained a classification rate of 98.3% and a Misclassification rate of 1.79%.

  7. Customer Communication Document

    Science.gov (United States)

    2009-01-01

    This procedure communicates to the Customers of the Automation, Robotics and Simulation Division (AR&SD) Dynamics Systems Test Branch (DSTB) how to obtain services of the Six-Degrees-Of-Freedom Dynamic Test System (SDTS). The scope includes the major communication documents between the SDTS and its Customer. It established the initial communication and contact points as well as provides the initial documentation in electronic media for the customer. Contact the SDTS Manager (SM) for the names of numbers of the current contact points.

  8. Document clustering methods, document cluster label disambiguation methods, document clustering apparatuses, and articles of manufacture

    Science.gov (United States)

    Sanfilippo, Antonio [Richland, WA; Calapristi, Augustin J [West Richland, WA; Crow, Vernon L [Richland, WA; Hetzler, Elizabeth G [Kennewick, WA; Turner, Alan E [Kennewick, WA

    2009-12-22

    Document clustering methods, document cluster label disambiguation methods, document clustering apparatuses, and articles of manufacture are described. In one aspect, a document clustering method includes providing a document set comprising a plurality of documents, providing a cluster comprising a subset of the documents of the document set, using a plurality of terms of the documents, providing a cluster label indicative of subject matter content of the documents of the cluster, wherein the cluster label comprises a plurality of word senses, and selecting one of the word senses of the cluster label.

  9. Motivation through Routine Documentation

    Science.gov (United States)

    Koth, Laurie J.

    2016-01-01

    This informed commentary article offers a simple, effective classroom management strategy in which the teacher uses routine documentation to motivate students both to perform academically and to behave in a manner consistent with established classroom rules and procedures. The pragmatic strategy is grounded in literature, free to implement,…

  10. Documenting the Invicible

    DEFF Research Database (Denmark)

    Pedersen, Peter Ole

    2017-01-01

    Documenting the Invisible is a polemical text that examines the potentials of documentary-based art to create useful aesthetic representations of ‘The Anthropocene’. The article is a result of the practice-based collaboration between researcher and curator Peter Ole Pedersen and the artists Chris...

  11. Hypertension Briefing: Technical documentation

    OpenAIRE

    Institute of Public Health in Ireland

    2012-01-01

    Blood pressure is the force exerted on artery walls as the heart pumps blood through the body. Hypertension, or high blood pressure, occurs when blood pressure is constantly higher than the pressure needed to carry blood through the body. This document details how the IPH uses a systematic and consistent method to produce prevalence data for hypertension on the island of Ireland.

  12. Using Primary Source Documents.

    Science.gov (United States)

    Mintz, Steven

    2003-01-01

    Explores the use of primary sources when teaching about U.S. slavery. Includes primary sources from the Gilder Lehrman Documents Collection (New York Historical Society) to teach about the role of slaves in the Revolutionary War, such as a proclamation from Lord Dunmore offering freedom to slaves who joined his army. (CMK)

  13. Biogas document; Dossier Biogaz

    Energy Technology Data Exchange (ETDEWEB)

    Verchin, J.C.; Servais, C. [Club BIOGAZ, 94 - Arcueil (France)

    2002-06-01

    In this document concerning the biogas, the author presents this renewable energy situation in 2001-2002, the concerned actors, the accounting of the industrial methanization installations in France, the three main chains of process for industrial wastes and two examples of methanization implementation in a paper industry and in a dairy. (A.L.B.)

  14. ROOT Reference Documentation

    CERN Document Server

    Fuakye, Eric Gyabeng

    2017-01-01

    A ROOT Reference Documentation has been implemented to generate all the lists of libraries needed for each ROOT class. Doxygen has no option to generate or add the lists of libraries for each ROOT class. Therefore shell scripting and a basic C++ program was employed to import the lists of libraries needed by each ROOT class.

  15. Using Primary Source Documents.

    Science.gov (United States)

    Mintz, Steven

    2003-01-01

    Explores the use of primary sources when teaching about U.S. slavery. Includes primary sources from the Gilder Lehrman Documents Collection (New York Historical Society) to teach about the role of slaves in the Revolutionary War, such as a proclamation from Lord Dunmore offering freedom to slaves who joined his army. (CMK)

  16. Course documentation report

    DEFF Research Database (Denmark)

    Buus, Lillian; Bygholm, Ann; Walther, Tina Dyngby Lyng

    A documentation report on the three pedagogical courses developed during the MVU project period. The report describes the three processes taking departure in the structure and material avaiable at the virtual learning environment. Also the report describes the way the two of the courses developed...

  17. Extremely secure identification documents

    Energy Technology Data Exchange (ETDEWEB)

    Tolk, K.M. [Sandia National Labs., Albuquerque, NM (United States); Bell, M. [Sandia National Labs., Livermore, CA (United States)

    1997-09-01

    The technology developed in this project uses biometric information printed on the document and public key cryptography to ensure that an adversary cannot issue identification documents to unauthorized individuals or alter existing documents to allow their use by unauthorized individuals. This process can be used to produce many types of identification documents with much higher security than any currently in use. The system is demonstrated using a security badge as an example. This project focused on the technologies requiring development in order to make the approach viable with existing badge printing and laminating technologies. By far the most difficult was the image processing required to verify that the picture on the badge had not been altered. Another area that required considerable work was the high density printed data storage required to get sufficient data on the badge for verification of the picture. The image processing process was successfully tested, and recommendations are included to refine the badge system to ensure high reliability. A two dimensional data array suitable for printing the required data on the badge was proposed, but testing of the readability of the array had to be abandoned due to reallocation of the budgeted funds by the LDRD office.

  18. Technical approach document

    Energy Technology Data Exchange (ETDEWEB)

    1989-12-01

    The Uranium Mill Tailings Radiation Control Act (UMTRCA) of 1978, Public Law 95-604 (PL95-604), grants the Secretary of Energy the authority and responsibility to perform such actions as are necessary to minimize radiation health hazards and other environmental hazards caused by inactive uranium mill sites. This Technical Approach Document (TAD) describes the general technical approaches and design criteria adopted by the US Department of Energy (DOE) in order to implement remedial action plans (RAPS) and final designs that comply with EPA standards. It does not address the technical approaches necessary for aquifer restoration at processing sites; a guidance document, currently in preparation, will describe aquifer restoration concerns and technical protocols. This document is a second revision to the original document issued in May 1986; the revision has been made in response to changes to the groundwater standards of 40 CFR 192, Subparts A--C, proposed by EPA as draft standards. New sections were added to define the design approaches and designs necessary to comply with the groundwater standards. These new sections are in addition to changes made throughout the document to reflect current procedures, especially in cover design, water resources protection, and alternate site selection; only minor revisions were made to some of the sections. Sections 3.0 is a new section defining the approach taken in the design of disposal cells; Section 4.0 has been revised to include design of vegetated covers; Section 8.0 discusses design approaches necessary for compliance with the groundwater standards; and Section 9.0 is a new section dealing with nonradiological hazardous constituents. 203 refs., 18 figs., 26 tabs.

  19. Estrogen sulfotransferase/SULT1E1 promotes human adipogenesis.

    Science.gov (United States)

    Ihunnah, Chibueze A; Wada, Taira; Philips, Brian J; Ravuri, Sudheer K; Gibbs, Robert B; Kirisci, Levent; Rubin, J Peter; Marra, Kacey G; Xie, Wen

    2014-05-01

    Estrogen sulfotransferase (EST/SULT1E1) is known to catalyze the sulfoconjugation and deactivation of estrogens. The goal of this study is to determine whether and how EST plays a role in human adipogenesis. By using human primary adipose-derived stem cells (ASCs) and whole-fat tissues from the abdominal subcutaneous fat of obese and nonobese subjects, we showed that the expression of EST was low in preadipocytes but increased upon differentiation. Overexpression and knockdown of EST in ASCs promoted and inhibited differentiation, respectively. The proadipogenic activity of EST in humans was opposite to the antiadipogenic effect of the same enzyme in rodents. Mechanistically, EST promoted adipogenesis by deactivating estrogens. The proadipogenic effect of EST can be recapitulated by using an estrogen receptor (ER) antagonist or ERα knockdown. In contrast, activation of ER in ASCs inhibited adipogenesis by decreasing the recruitment of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ) onto its target gene promoters, whereas ER antagonism increased the recruitment of PPARγ to its target gene promoters. Linear regression analysis revealed a positive correlation between the expression of EST and body mass index (BMI), as well as a negative correlation between ERα expression and BMI. We conclude that EST is a proadipogenic factor which may serve as a druggable target to inhibit the turnover and accumulation of adipocytes in obese patients.

  20. Centrality based Document Ranking

    Science.gov (United States)

    2014-11-01

    summarization. In ECIR ’09: Proceedings of the 31th European Conference on IR Research, Lecture Notes in Computer Science , pages 724–728, Toulouse, France...Proceedings, Part I, volume 8796 of Lecture Notes in Computer Science . Springer, 2014. 16. J. Otterbacher, G. Erkan, and D. R. Radev. Using random walks for

  1. Data of evolutionary structure change: 1E1QC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDA 1E1Q 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...> 0 2HLD A 2HLDA AFAQS--DLDA...ain> 1E1Q C 1E1QC AFAQFGSDLDA

  2. Document analysis with neural net circuits

    Science.gov (United States)

    Graf, Hans Peter

    1994-01-01

    Document analysis is one of the main applications of machine vision today and offers great opportunities for neural net circuits. Despite more and more data processing with computers, the number of paper documents is still increasing rapidly. A fast translation of data from paper into electronic format is needed almost everywhere, and when done manually, this is a time consuming process. Markets range from small scanners for personal use to high-volume document analysis systems, such as address readers for the postal service or check processing systems for banks. A major concern with present systems is the accuracy of the automatic interpretation. Today's algorithms fail miserably when noise is present, when print quality is poor, or when the layout is complex. A common approach to circumvent these problems is to restrict the variations of the documents handled by a system. In our laboratory, we had the best luck with circuits implementing basic functions, such as convolutions, that can be used in many different algorithms. To illustrate the flexibility of this approach, three applications of the NET32K circuit are described in this short viewgraph presentation: locating address blocks, cleaning document images by removing noise, and locating areas of interest in personal checks to improve image compression. Several of the ideas realized in this circuit that were inspired by neural nets, such as analog computation with a low resolution, resulted in a chip that is well suited for real-world document analysis applications and that compares favorably with alternative, 'conventional' circuits.

  3. NASA software documentation standard software engineering program

    Science.gov (United States)

    1991-01-01

    The NASA Software Documentation Standard (hereinafter referred to as Standard) can be applied to the documentation of all NASA software. This Standard is limited to documentation format and content requirements. It does not mandate specific management, engineering, or assurance standards or techniques. This Standard defines the format and content of documentation for software acquisition, development, and sustaining engineering. Format requirements address where information shall be recorded and content requirements address what information shall be recorded. This Standard provides a framework to allow consistency of documentation across NASA and visibility into the completeness of project documentation. This basic framework consists of four major sections (or volumes). The Management Plan contains all planning and business aspects of a software project, including engineering and assurance planning. The Product Specification contains all technical engineering information, including software requirements and design. The Assurance and Test Procedures contains all technical assurance information, including Test, Quality Assurance (QA), and Verification and Validation (V&V). The Management, Engineering, and Assurance Reports is the library and/or listing of all project reports.

  4. DOE-2 basics version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E.; Winkelmann, F.C. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch and Associates, Camarillo, CA (United States)

    1994-05-01

    DOE-2 is an up-to-date, unbiased, well-documented public-domain computer program for building energy analysis. DOE-2 predicts the hourly energy use and energy cost of a building given hourly weather information and a description of the building and its HVAC equipment and utility rate structure. DOE-2 is a portable FORTRAN program that can be used on a large variety of computers, including PC`s. Using DOE-2, designers can determine the choice of building parameters that improve energy efficiency while maintaining thermal comfort. The purpose of DOE-2 is to aid in the analysis of energy usage in buildings; it is not intended to be the sole source of information relied upon for the design of buildings. The judgment and experience of the architect/engineer still remain the most important elements of building design.

  5. [Clinically documented fungal infections].

    Science.gov (United States)

    Kakeya, Hiroshi; Kohno, Shigeru

    2008-12-01

    Proven fungal infections are diagnosed by histological/microbiological evidence of fungi at the site of infection and positive blood culture (fungemia). However, invasive diagnosing examinations are not always applied for all of immunocompromised patients. Clinically documented invasive fungal infections are diagnosed by typical radiological findings such as halo sign on chest CT plus positive serological/molecular evidence of fungi. Serological tests of Aspergillus galactomannan antigen and beta-glucan for aspergillosis and cryptococcal glucuronoxylomannan antigen for cryptococcosis are useful. Hence, none of reliable serological tests for zygomycosis are available so far. In this article, risk factors, sign and symptoms, and diagnostic methods for clinically documented cases of invasive aspergillosis, pulmonary cryptococcosis, and zygomycosis with diabates, are reviewed.

  6. Indexation de Documents Manuscrits

    OpenAIRE

    Vinciarelli, Alessandro

    2006-01-01

    Les systèmes de reconnaissance automatique de l'écriture permettent de transfomer des collections de documents manuscrits en archives de documents numériques. L'avantage n'est pas tellement la réduction de l'espace nécéssaire pour stoquer les données, mais plutôt la possibilité d'appliquer les technologies de gestion du contenu normalement utilisées pour des textes numériques tels que pages web et e-mails. Le problème principal dans une telle démarche est que les transcriptions sont généralem...

  7. Electronic Braille Document Reader

    OpenAIRE

    Arif, Shahab; Holmes, Violeta

    2013-01-01

    This paper presents an investigation into developing a portable Braille device which would allow visually impaired individuals to read electronic documents by actuating Braille text on a finger. Braille books tend to be bulky in size due to the minimum size requirements for each Braille cell. E-books can be read in Braille using refreshable Braille displays connected to a computer. However, the refreshable Braille displays are expensive, bulky and are not portable. These factors restrict blin...

  8. Stamp Detection in Color Document Images

    DEFF Research Database (Denmark)

    Micenkova, Barbora; van Beusekom, Joost

    2011-01-01

    An automatic system for stamp segmentation and further verification is needed especially for environments like insurance companies where a huge volume of documents is processed daily. However, detection of a general stamp is not a trivial task as it can have different shapes and colors and......, moreover, it can be imprinted with a variable quality and rotation. Previous methods were restricted to detection of stamps of particular shapes or colors. The method presented in the paper includes segmentation of the image by color clustering and subsequent classification of candidate solutions...... by geometrical and color-related features. The approach allows for differentiation of stamps from other color objects in the document such as logos or texts. For the purpose of evaluation, a data set of 400 document images has been collected, annotated and made public. With the proposed method, recall of 83...

  9. Hanford analytical services quality assurance requirements documents

    Energy Technology Data Exchange (ETDEWEB)

    Hyatt, J.E.

    1997-09-25

    Hanford Analytical Services Quality Assurance Requirements Document (HASQARD) is issued by the Analytical Services, Program of the Waste Management Division, US Department of Energy (US DOE), Richland Operations Office (DOE-RL). The HASQARD establishes quality requirements in response to DOE Order 5700.6C (DOE 1991b). The HASQARD is designed to meet the needs of DOE-RL for maintaining a consistent level of quality for sampling and field and laboratory analytical services provided by contractor and commercial field and laboratory analytical operations. The HASQARD serves as the quality basis for all sampling and field/laboratory analytical services provided to DOE-RL through the Analytical Services Program of the Waste Management Division in support of Hanford Site environmental cleanup efforts. This includes work performed by contractor and commercial laboratories and covers radiological and nonradiological analyses. The HASQARD applies to field sampling, field analysis, and research and development activities that support work conducted under the Hanford Federal Facility Agreement and Consent Order Tri-Party Agreement and regulatory permit applications and applicable permit requirements described in subsections of this volume. The HASQARD applies to work done to support process chemistry analysis (e.g., ongoing site waste treatment and characterization operations) and research and development projects related to Hanford Site environmental cleanup activities. This ensures a uniform quality umbrella to analytical site activities predicated on the concepts contained in the HASQARD. Using HASQARD will ensure data of known quality and technical defensibility of the methods used to obtain that data. The HASQARD is made up of four volumes: Volume 1, Administrative Requirements; Volume 2, Sampling Technical Requirements; Volume 3, Field Analytical Technical Requirements; and Volume 4, Laboratory Technical Requirements. Volume 1 describes the administrative requirements

  10. Content Documents Management

    Science.gov (United States)

    Muniz, R.; Hochstadt, J.; Boelke J.; Dalton, A.

    2011-01-01

    The Content Documents are created and managed under the System Software group with. Launch Control System (LCS) project. The System Software product group is lead by NASA Engineering Control and Data Systems branch (NEC3) at Kennedy Space Center. The team is working on creating Operating System Images (OSI) for different platforms (i.e. AIX, Linux, Solaris and Windows). Before the OSI can be created, the team must create a Content Document which provides the information of a workstation or server, with the list of all the software that is to be installed on it and also the set where the hardware belongs. This can be for example in the LDS, the ADS or the FR-l. The objective of this project is to create a User Interface Web application that can manage the information of the Content Documents, with all the correct validations and filters for administrator purposes. For this project we used one of the most excellent tools in agile development applications called Ruby on Rails. This tool helps pragmatic programmers develop Web applications with Rails framework and Ruby programming language. It is very amazing to see how a student can learn about OOP features with the Ruby language, manage the user interface with HTML and CSS, create associations and queries with gems, manage databases and run a server with MYSQL, run shell commands with command prompt and create Web frameworks with Rails. All of this in a real world project and in just fifteen weeks!

  11. Volume Entropy

    CERN Document Server

    Astuti, Valerio; Rovelli, Carlo

    2016-01-01

    Building on a technical result by Brunnemann and Rideout on the spectrum of the Volume operator in Loop Quantum Gravity, we show that the dimension of the space of the quadrivalent states --with finite-volume individual nodes-- describing a region with total volume smaller than $V$, has \\emph{finite} dimension, bounded by $V \\log V$. This allows us to introduce the notion of "volume entropy": the von Neumann entropy associated to the measurement of volume.

  12. What Documents Permit

    OpenAIRE

    2012-01-01

    Along with archives, which they are often associated with, documents have a central place in exhibitions, as they do in present-day contemporary art publications. The aim of the books here considered is not to shed light on this huge mnemonic turning-point which seems to have taken hold of art praxis and art discourse since the beginning of this third millennium, even if the contributions of some of their authors pinpoint circumstantial (post 9/11) and technical (the digital age) factors whic...

  13. SSC Safety Review Document

    Energy Technology Data Exchange (ETDEWEB)

    Toohig, T.E. [ed.

    1988-11-01

    The safety strategy of the Superconducting Super Collider (SSC) Central Design Group (CDG) is to mitigate potential hazards to personnel, as far as possible, through appropriate measures in the design and engineering of the facility. The Safety Review Document identifies, on the basis of the Conceptual Design Report (CDR) and related studies, potential hazards inherent in the SSC project independent of its site. Mitigative measures in the design of facilities and in the structuring of laboratory operations are described for each of the hazards identified.

  14. Analysis of Design Documentation

    DEFF Research Database (Denmark)

    Hansen, Claus Thorp

    1998-01-01

    In design practice a process where a satisfactory solution is created within limited resources is required. However, since the design process is not well understood, research into how engineering designers actually solve design problems is needed. As a contribution to that end a research project...... has been established where we seek to identify useful design work patterns by retrospective analyses of documentation created during design projects. This paper describes the analysis method, a tentatively defined metric to evaluate identified work patterns, and presents results from the first...... analysis accomplished....

  15. Document management for small business

    OpenAIRE

    Valkonen, Juho

    2015-01-01

    The objective of the thesis was to find out the most important things about document management which are needed for selecting a proper document management system for a small business. The thesis explores several document management systems and the differences between them. The goal of the development project was to find the most suitable system for the client and to define document management processes for the company. The theory part of the thesis focuses on different document manageme...

  16. Software Design Document PVD CSCI (3). Volume 2, Appendices

    Science.gov (United States)

    1991-06-01

    save- laser -info in lase.c, (null) check-lasing-duration in lase.c, (null) C-68 BBN Systems and Technologies Plan View Display CSCl FUNCTION: fstat(fd... huesO calledBy: init_catc in catc.c, (null) FUNCTION: createtiangle() called.By: init_catc in catc.c, (null) zoom-icon in icon.c, (null) FUNCTION...drawjlaserolaserpacket) calledBy: lase in lase.c, (null) FUNCTION: savejaserjinfo(laserx, laser -y, muzzle-x, muzzle-y) calledBy: draw- laser in lase.c, (null

  17. International Forum on Information and Documentation. Volume 1, Number 1.

    Science.gov (United States)

    Mikhailov, A. I., Ed.

    Intended as an international medium for the exchange of ideas and experience in scientific and technical information, this journal publishes scholarly papers from various countries. The first issue contains: (1) articles on communication in science, (2) a book review, (3) a column intended to clarify concepts and terminology in the field of…

  18. Probabilistic risk assessment course documentation. Volume 1: PRA fundamentals

    Energy Technology Data Exchange (ETDEWEB)

    Breeding, R J; Leahy, T J; Young, J

    1985-08-01

    The full range of PRA topics is presented, with a special emphasis on systems analysis and PRA applications. Systems analysis topics include system modeling such as fault tree and event tree construction, failure rate data, and human Reliability. The discussion of PRA applications is centered on past and present PRA based programs, such as WASH-1400 and the Interim Reliability Evaluation Program, as well as on some of the potential future applications of PRA. The relationship of PRA to generic safety issues such as station blackout and Anticipated Transient Without Scram (ATWS) is also discussed. In addition to system modeling, the major PRA tasks of accident process analysis, and consequence analysis are presented. An explanation of the results of these activities, and the techniques by which these results are derived, forms the basis for a discussion of these topics. An additional topic which is presented in this course is the topic of PRA management, organization, and evaluation. 84 figs., 41 tabs.

  19. Revised OPTSA Model. Volume 2. Computer Program Documentation

    Science.gov (United States)

    1975-06-01

    Definition BS(2,3) RS(2,3) TY,MS BANF (2,3) TY,MS RANF(2,3) TY,MS Blue sorties, by aircraft type and mission. Red sorties, by aircraft type and...CAMVAH/ vhuBSiVHUBNSiVHKoS.VHKEisS INTESE" TY,rvBtlYrt DIMENSION bANF li,J),RANF(2,3) Fl« (Ul ■ Ai-Al«ML0li(A*)«A’»»«a.A5»AL0G(_«6)»A6o»u F24 CJl» -Aj...BiKAA(TY.MS)/SWb RAK^AA(TYiMb)«HiiKAA(TViMS)/SHH BAlTYiMSl«BAlIYiMS)- BANF (TY.MSI-bAF8(TYfMSI-BAKAA(TYtHSl HA(TYlMS»»HAlTYiMS)-MANF(tY»MS»-KAFBlTY|HSi

  20. Durability Methods Development. Volume 7. Phase 2. Documentation

    Science.gov (United States)

    1984-01-01

    pull-through When the MS-90?53 rivet is^n^ talUd 1;"’? ’°’’ ^^"" ^^^ >’ fit bolt because the Sa::^ o^the ri;et dOe’s nSrfill’th’ b’?^"^?"."" a

  1. China Macroeconomic: Documentation Data Banks. Volume 3. Foreign Trade.

    Science.gov (United States)

    1984-11-15

    TIm S from YUAN to DWuA .c TEsI N 7N oTUN TEMN 7EC" Eo~Uq 4 5N TM" N TEO7LN EOB2q TEc09L 1949 N/A N/A N/A N/A N/A N/A N/A N/A N/A N/A N/A 1950 N/A N/A N...various sources: 1. State Statistical Bureau 1981 Yearbook, p.35 7 ( English version), 1981, 1982 FROM SSBYB83, P. 405. 2. Official Ministry of Foreign

  2. Preliminary safety information document for the standard MHTGR. Volume 4

    Energy Technology Data Exchange (ETDEWEB)

    None

    1986-01-01

    This report contains information concerning: operational radionuclide control; occupational radiation protection, conduct of operations; initial test program; safety analysis; technical specifications; and quality assurance. (JDB)

  3. Software Design Document Vehicle Simulation CSCI (5). Volume 4, Appendices

    Science.gov (United States)

    1991-06-01

    findlocation in libimage.c, (null) kinematicscalcvelocity in calc-v.c, (null) kinematics-update-p in update-p.c, (null) E-55 BBN Systems and TechnoIlogies ...cig-stop in Ocig-stop.c, (null) E-255 BBN Systems and Technoilogies Vehicles CSCI cig-preparejic’.op in cig-no-op.c, (null) cig-reconfig-s=a in cig-j...network-set-commo-kill(kill-status) FUNCTION: network-set- mobility kill(kill-status) FUNCTION: network-set-firepower-kill(kilLstatus) FILE: dust

  4. Intrasystem Electromagnetic Compatibility Analysis Program. Volume III. Computer Program Documentation

    Science.gov (United States)

    1974-12-01

    S(4) IN COMMON BLOCK SPIRO BWC S(5) IN COMMON BLOCK SPIRO ADJLIM S(1) IN COMMON BLOCK SPIRO F5 S(3) IN COMMON BLOCK SPIRO FL S(2) IN COMMON BLOCK...NRZ 102 CO3QD 118 S or C 3 ot 4 BPP 103 GAUSS 1.19 EED 5 PPM 104 CHIRP 120 CASE 6 TEL 105 FSK 106 SIG CODE PAM 107 VO 115 RADAR 200 CV 116 AM 301 NO 117...code (source/receptor type code) MOPSIG CDoE SR CODE PDM 101. RE 1 NRZ 102 PO 2 BPP 103 S/C 3/4 PPM 104 EED 5 TEL 105 CASE 6 PAM 107 , ESPIKE 108 Units

  5. Regulatory guidance document

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-05-01

    The Office of Civilian Radioactive Waste Management (OCRWM) Program Management System Manual requires preparation of the OCRWM Regulatory Guidance Document (RGD) that addresses licensing, environmental compliance, and safety and health compliance. The document provides: regulatory compliance policy; guidance to OCRWM organizational elements to ensure a consistent approach when complying with regulatory requirements; strategies to achieve policy objectives; organizational responsibilities for regulatory compliance; guidance with regard to Program compliance oversight; and guidance on the contents of a project-level Regulatory Compliance Plan. The scope of the RGD includes site suitability evaluation, licensing, environmental compliance, and safety and health compliance, in accordance with the direction provided by Section 4.6.3 of the PMS Manual. Site suitability evaluation and regulatory compliance during site characterization are significant activities, particularly with regard to the YW MSA. OCRWM`s evaluation of whether the Yucca Mountain site is suitable for repository development must precede its submittal of a license application to the Nuclear Regulatory Commission (NRC). Accordingly, site suitability evaluation is discussed in Chapter 4, and the general statements of policy regarding site suitability evaluation are discussed in Section 2.1. Although much of the data and analyses may initially be similar, the licensing process is discussed separately in Chapter 5. Environmental compliance is discussed in Chapter 6. Safety and Health compliance is discussed in Chapter 7.

  6. ExactPack Documentation

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Israel, Daniel M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Doebling, Scott William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Woods, Charles Nathan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kaul, Ann [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Walter, Jr., John William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rogers, Michael Lloyd [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-05-09

    For code verification, one compares the code output against known exact solutions. There are many standard test problems used in this capacity, such as the Noh and Sedov problems. ExactPack is a utility that integrates many of these exact solution codes into a common API (application program interface), and can be used as a stand-alone code or as a python package. ExactPack consists of python driver scripts that access a library of exact solutions written in Fortran or Python. The spatial profiles of the relevant physical quantities, such as the density, fluid velocity, sound speed, or internal energy, are returned at a time specified by the user. The solution profiles can be viewed and examined by a command line interface or a graphical user interface, and a number of analysis tools and unit tests are also provided. We have documented the physics of each problem in the solution library, and provided complete documentation on how to extend the library to include additional exact solutions. ExactPack’s code architecture makes it easy to extend the solution-code library to include additional exact solutions in a robust, reliable, and maintainable manner.

  7. Universal Documentation System Handbook. Volume 2: Program Requirements and Operations Requirements Documents

    Science.gov (United States)

    1979-11-01

    purpose to which the forecasts will be put. Be specific (to calculate drag, to predict drift on recovery of nose cone, etc.). Enter any other...the location entry is identical. BOX 1-5 Follow, instructions for page 1010. 80X 10 TRIP CREQ /QTR: Enter the number of trips

  8. Revitalizing a documentation system.

    Science.gov (United States)

    DiBlasi, M; Savage, J

    1992-01-01

    The nursing department of a 154-bed acute rehabilitation facility, cognizant of the changing trends in health care and responding to feedback from staff, developed and implemented a comprehensive documentation system. The previous system had been fragmented, inconsistent, and inefficient. The development of the new system focused on the complex needs of the rehabilitation client and the equally complex standards required by the Joint Commission on Accreditation of Healthcare Organizations (JCAHO), the Commission on Accreditation of Rehabilitation Facilities (CARF), and insurance carriers. The final product, which was based on the nursing process and functional health patterns, encompassed the following areas from admission to discharge: providing feedback on clients' functional abilities and progress toward goals, satisfying requirements of the 1990 JCAHO standards, and, finally, using a flow sheet that saves nursing time and increases objectivity. This article describes the system from conceptualization to successful implementation.

  9. Multilingual documentation and classification.

    Science.gov (United States)

    Donnelly, Kevin

    2008-01-01

    Health care providers around the world have used classification systems for decades as a basis for documentation, communications, statistical reporting, reimbursement and research. In more recent years machine-readable medical terminologies have taken on greater importance with the adoption of electronic health records and the need for greater granularity of data in clinical systems. Use of a clinical terminology harmonised with classifications, implemented within a clinical information system, will enable the delivery of many patient health benefits including electronic clinical decision support, disease screening and enhanced patient safety. In order to be usable these systems must be translated into the language of use, without losing meaning. It is evident that today one system cannot meet all requirements which call for collaboration and harmonisation in order to achieve true interoperability on a multilingual basis.

  10. Recueil de documents

    OpenAIRE

    Dedieu, Jean-Pierre

    2013-01-01

    Document I. Philippe II en Jules César La campagne de Saint-Quentin vue par un historiographe du roi (1557) Le polygraphe Ginés de Sepúlveda (1490-1573) est célèbre par sa controverse avec Las Casas sur la légitimité de la conquête des Indes. Il est moins connu comme auteur d’une chronique latine du règne de Charles V, à laquelle il donna pour suite une chronique des six premières années du règne de Philippe II, sous le titre de De rebus gestis Philippi II. Son manuscrit resta inédit jusqu’à ...

  11. STORMWATER BEST MANAGEMENT PRACTICES DESIGN GUIDE VOLUME 2 - VEGETATIVE BIOFILTERS

    Science.gov (United States)

    This document is Volume 2 of a three volume document that provides guidance on the selection and design of stormwater management Best Management Practices (BMPs). This second volume provides specific design guidance for a group of onsite BMP control practices that are referred t...

  12. STORMWATER BEST MANAGEMENT PRACTICES DESIGN GUIDE VOLUME 2 - VEGETATIVE BIOFILTERS

    Science.gov (United States)

    This document is Volume 2 of a three volume document that provides guidance on the selection and design of stormwater management Best Management Practices (BMPs). This second volume provides specific design guidance for a group of onsite BMP control practices that are referred t...

  13. Data of evolutionary structure change: 1E0UC-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E0UC-3G2GD 1E0U 3G2G C D ----------------------------MKKTKIVCTIG...PKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKT------GKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVI--GNSEMVAVTYE...GFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIIS...KIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVAN...TAHQLVLSKGVVPQLV--KEITSTDDFYR----LGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL- QTQQLHAAMADTFLEHMCRLD

  14. Data of evolutionary structure change: 1ANTI-1E04L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-1E04L 1ANT 1E04 I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE... 1ANT I 1ANTI AASTA--...4> 1ANT I 1ANTI ...line>VAL CA 395 1ANT I 1ANTI

  15. Data of evolutionary structure change: 1E1QC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDT 1E1Q 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI...yChain> 2HLD T 2HLDT VAAFA---QDLD

  16. Data of evolutionary structure change: 1E1QB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QB-2HLDT 1E1Q 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...dbChain> 2HLDT ALKQVAGSLKLFL 2HLD T 2HLDT VAAFAQDLDAST

  17. Data of evolutionary structure change: 1E1RB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RB-2HLDT 1E1R 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...T 2HLDT ALKQVAGSLKLFL2HLD T 2HLDT VAAFAQDLDAST

  18. Data of evolutionary structure change: 1E1RC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDA 1E1R 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...fEVID> 0 2HLD A 2HLDA AFAQS--DLDAS GGG -- HH

  19. Toward Documentation of Program Evolution

    DEFF Research Database (Denmark)

    Vestdam, Thomas; Nørmark, Kurt

    2005-01-01

    The documentation of a program often falls behind the evolution of the program source files. When this happens it may be attractive to shift the documentation mode from updating the documentation to documenting the evolution of the program. This paper describes tools that support the documentation...... of program evolution. The tools are refinements of the Elucidative Programming tools, which in turn are inspired from Literate Programming tools. The version-aware Elucidative Programming tools are able to process a set of program source files in different versions together with unversioned documentation...... files. The paper introduces a set of fine grained program evolution steps, which are supported directly by the documentation tools. The automatic discovery of the fine grained program evolution steps makes up a platform for documenting coarse grained and more high-level program evolution steps...

  20. Formation peculiarities of tourism documentation

    OpenAIRE

    Zhezhnych, Pavlo; Soprunyuk, Oksana

    2013-01-01

    The article describes formation peculiarities of tourism documentation, the role of tourism data consolidation for unified format creation and the the need to use existing software tools to handle tourism information, formation process of tourism documentation is presented.

  1. Leak testing of IR sensor dewars to 1E-15 std He/s

    Science.gov (United States)

    Sasaki, Y. Tito; Bergquist, Lyle E.

    1990-09-01

    The results of tests for leakage performed on ten IR sensor dewars are presented, and the design principles of the new testing devices are discussed. The ultrasensitive leak detector used for testing is compared to conventional detectors. The superfine leak calibrator consisting of a tracer gas supply, an aliquot volume, a pressure transducer, temperature gage, and valves was used to measure leak rates in the E-4 to E-12 std cc He/s range. The testing method is explained, including the gases used, the quadrupole mass analyzer, the reference leak calibration, and the temperature coefficient of the reference leak. The test results of the IR sensor dewars are shown: seven showed leak rates in the E-15 std cc He/s range, two had no detectable leaks, and one had a mid-range E-14 leak. The shelf lives of the dewars are calculated based on the results. The vacuum integrity of small IR sensor dewars can be reliably tested to the range of 1E-15 std cc He/s using the ultrasensitive leak detector and the superfine leak calibrator.

  2. Tool Gear Documentation

    Energy Technology Data Exchange (ETDEWEB)

    May, J; Gyllenhaal, J

    2002-04-03

    Tool Gear is designed to allow tool developers to insert instrumentation code into target programs using the DPCL library. This code can gather data and send it back to the Client for display or analysis. Tools can use the Tool Gear client without using the DPCL Collector. Any collector using the right protocols can send data to the Client for display and analysis. However, this document will focus on how to gather data with the DPCL Collector. There are three parts to the task of using Tool Gear to gather data through DPCL: (1) Write the instrumentation code that will be loaded and run in the target program. The code should be in the form of one or more functions, which can pass data structures back to the Client by way of DPCL. The collections of functions is compiled into a library, as described in this report. (2) Write the code that tells the DPCL Collector about the instrumentation and how to forward data back to the Client. (3) Extend the client to accept data from the Collector and display it in a useful way. The rest of this report describes how to carry out each of these steps.

  3. INFORMATION RETRIEVAL FOR SHORT DOCUMENTS

    Institute of Scientific and Technical Information of China (English)

    Qi Haoliang; Li Mu; Gao Jianfeng; Li Sheng

    2006-01-01

    The major problem of the most current approaches of information models lies in that individual words provide unreliable evidence about the content of the texts. When the document is short, e.g. only the abstract is available, the word-use variability problem will have substantial impact on the Information Retrieval (IR) performance. To solve the problem, a new technology to short document retrieval named Reference Document Model (RDM) is put forward in this letter. RDM gets the statistical semantic of the query/document by pseudo feedback both for the query and document from reference documents. The contributions of this model are three-fold: (1) Pseudo feedback both for the query and the document; (2) Building the query model and the document model from reference documents; (3) Flexible indexing units, which can be any linguistic elements such as documents, paragraphs, sentences, n-grams, term or character. For short document retrieval, RDM achieves significant improvements over the classical probabilistic models on the task of ad hoc retrieval on Text REtrieval Conference (TREC) test sets. Results also show that the shorter the document, the better the RDM performance.

  4. Civil Conversations Using Primary Documents

    Science.gov (United States)

    Singleton, Laurel; Pereira, Carolyn

    2005-01-01

    Primary source documents can be a key element in conversation and deliberation. They lend authenticity to student consideration of issues facing people's democracy and stimulate student interest. In addition, conversation about a primary document leads to a much deeper understanding of that document and can raise authentic questions for further…

  5. Language Documentation in the Americas

    Science.gov (United States)

    Franchetto, Bruna; Rice, Keren

    2014-01-01

    In the last decades, the documentation of endangered languages has advanced greatly in the Americas. In this paper we survey the role that international funding programs have played in advancing documentation in this part of the world, with a particular focus on the growth of documentation in Brazil, and we examine some of the major opportunities…

  6. The Practicalities of Document Conversion.

    Science.gov (United States)

    Galbraith, Ian

    1993-01-01

    Describes steps involved in the conversion of source documents to scanned digital image format. Topics addressed include document preparation, including photographs and oversized material; indexing procedures, including automatic indexing possibilities; scanning documents, including resolution and throughput; quality control; backfile conversion;…

  7. Pedagogical documentation: Preschool teachers’ perspective

    Directory of Open Access Journals (Sweden)

    Pavlović-Breneselović Dragana

    2012-01-01

    Full Text Available Educational policy shapes the positions of all stakeholders and their mutual relations in the system of preschool education through its attitude towards documentation. The attitude towards the function of pedagogical documentation in preschool education programmes reflects certain views on children, learning and nature of the programmes. Although contemporary approaches to preschool education emphasise the issue of documentation, this problem is dealt with partially and technically in our country. The aim of our research was to explore preschool teachers’ perspective on documentation by investigating the current situation and teachers’ preferences related to documentation type, as well as to study the purpose, meaning and process of documentation. The research was conducted on the sample of 300 preschool teachers. The descriptive method, interviewing and scaling techniques were used. Research data suggest that the field of documentation is marked by contradictions in perceiving the meaning and function of documentation, as well as by discrepancy and lack of integration at the level of conceptions, practice and educational policy. Changing the current situation in the field of documentation is not a technical matter of elaboration of certain types and forms of documentation; it demands explication of the purpose and function of documentation in keeping with the conception of preschool education programmes and a systemic approach to changes originating from the given conception. [Projekat Ministarstva nauke Republike Srbije, br. 179060: Modeli procenjivanja i strategije unapređivanja kvaliteta obrazovanja u Srbiji

  8. Documentation of Cultural Heritage Objects

    Directory of Open Access Journals (Sweden)

    Jon Grobovšek

    2013-09-01

    Full Text Available EXTENDED ABSTRACT:The first and important phase of documentation of cultural heritage objects is to understand which objects need to be documented. The entire documentation process is determined by the characteristics and scope of the cultural heritage object. The next question to be considered is the expected outcome of the documentation process and the purpose for which it will be used. These two essential guidelines determine each stage of the documentation workflow: the choice of the most appropriate data capturing technology and data processing method, how detailed should the documentation be, what problems may occur, what the expected outcome is, what it will be used for, and the plan for storing data and results. Cultural heritage objects require diverse data capturing and data processing methods. It is important that even the first stages of raw data capturing are oriented towards the applicability of results. The selection of the appropriate working method can facilitate the data processing and the preparation of final documentation. Documentation of paintings requires different data capturing method than documentation of buildings or building areas. The purpose of documentation can also be the preservation of the contemporary cultural heritage to posterity or the basis for future projects and activities on threatened objects. Documentation procedures should be adapted to our needs and capabilities. Captured and unprocessed data are lost unless accompanied by additional analyses and interpretations. Information on tools, procedures and outcomes must be included into documentation. A thorough analysis of unprocessed but accessible documentation, if adequately stored and accompanied by additional information, enables us to gather useful data. In this way it is possible to upgrade the existing documentation and to avoid data duplication or unintentional misleading of users. The documentation should be archived safely and in a way to meet

  9. Document image analysis: A primer

    Indian Academy of Sciences (India)

    Rangachar Kasturi; Lawrence O’Gorman; Venu Govindaraju

    2002-02-01

    Document image analysis refers to algorithms and techniques that are applied to images of documents to obtain a computer-readable description from pixel data. A well-known document image analysis product is the Optical Character Recognition (OCR) software that recognizes characters in a scanned document. OCR makes it possible for the user to edit or search the document’s contents. In this paper we briefly describe various components of a document analysis system. Many of these basic building blocks are found in most document analysis systems, irrespective of the particular domain or language to which they are applied. We hope that this paper will help the reader by providing the background necessary to understand the detailed descriptions of specific techniques presented in other papers in this issue.

  10. Document Retrieval on Repetitive Collections

    OpenAIRE

    Navarro, Gonzalo; Puglisi, Simon J.; Sirén, Jouni

    2014-01-01

    Document retrieval aims at finding the most important documents where a pattern appears in a collection of strings. Traditional pattern-matching techniques yield brute-force document retrieval solutions, which has motivated the research on tailored indexes that offer near-optimal performance. However, an experimental study establishing which alternatives are actually better than brute force, and which perform best depending on the collection characteristics, has not been carried out. In this ...

  11. Survey on Text Document Clustering

    OpenAIRE

    M.Thangamani; Dr.P.Thangaraj

    2010-01-01

    Document clustering is also referred as text clustering, and its concept is merely equal to data clustering. It is hardly difficult to find the selective information from an ‘N’number of series information, so that document clustering came into picture. Basically cluster means a group of similar data, document clustering means segregating the data into different groups of similar data. Clustering can be of mathematical, statistical or numerical domain. Clustering is a fundamental data analysi...

  12. Information architecture. Volume 3: Guidance

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-04-01

    The purpose of this document, as presented in Volume 1, The Foundations, is to assist the Department of Energy (DOE) in developing and promulgating information architecture guidance. This guidance is aimed at increasing the development of information architecture as a Departmentwide management best practice. This document describes departmental information architecture principles and minimum design characteristics for systems and infrastructures within the DOE Information Architecture Conceptual Model, and establishes a Departmentwide standards-based architecture program. The publication of this document fulfills the commitment to address guiding principles, promote standard architectural practices, and provide technical guidance. This document guides the transition from the baseline or defacto Departmental architecture through approved information management program plans and budgets to the future vision architecture. This document also represents another major step toward establishing a well-organized, logical foundation for the DOE information architecture.

  13. Document understanding for a broad class of documents

    NARCIS (Netherlands)

    Aiello, Marco; Monz, Christof; Todoran, Leon; Worring, Marcel

    2002-01-01

    We present a document analysis system able to assign logical labels and extract the reading order in a broad set of documents. All information sources, from geometric features and spatial relations to the textual features and content are employed in the analysis. To deal effectively with these

  14. Document delivery services contrasting views

    CERN Document Server

    1999-01-01

    Design and maintain document delivery services that are ideal for academic patrons! In Document Delivery Services: Contrasting Views, you'll visit four university library systems to discover the considerations and challenges each library faced in bringing document delivery to its clientele. This book examines the questions about document delivery that are most pressing in the profession of library science. Despite their own unique experiences, you'll find common practices among all four?including planning, implementation of service, and evaluation of either user satisfaction and/or vendor per

  15. Lysosomal-associated transmembrane protein 5 (LAPTM5 is a molecular partner of CD1e.

    Directory of Open Access Journals (Sweden)

    Catherine Angénieux

    Full Text Available The CD1e protein participates in the presentation of lipid antigens in dendritic cells. Its transmembrane precursor is transported to lysosomes where it is cleaved into an active soluble form. In the presence of bafilomycin, which inhibits vacuolar ATPase and consequently the acidification of endosomal compartments, CD1e associates with a 27 kD protein. In this work, we identified this molecular partner as LAPTM5. The latter protein and CD1e colocalize in trans-Golgi and late endosomal compartments. The quantity of LAPTM5/CD1e complexes increases when the cells are treated with bafilomycin, probably due to the protection of LAPTM5 from lysosomal proteases. Moreover, we could demonstrate that LAPTM5/CD1e association occurs under physiological conditions. Although LAPTM5 was previously shown to act as a platform recruiting ubiquitin ligases and facilitating the transport of receptors to lysosomes, we found no evidence that LATPM5 controls either CD1e ubiquitination or the generation of soluble lysosomal CD1e proteins. Notwithstanding these last observations, the interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens.

  16. Document cards: a top trumps visualization for documents.

    Science.gov (United States)

    Strobelt, Hendrik; Oelke, Daniela; Rohrdantz, Christian; Stoffel, Andreas; Keim, Daniel A; Deussen, Oliver

    2009-01-01

    Finding suitable, less space consuming views for a document's main content is crucial to provide convenient access to large document collections on display devices of different size. We present a novel compact visualization which represents the document's key semantic as a mixture of images and important key terms, similar to cards in a top trumps game. The key terms are extracted using an advanced text mining approach based on a fully automatic document structure extraction. The images and their captions are extracted using a graphical heuristic and the captions are used for a semi-semantic image weighting. Furthermore, we use the image color histogram for classification and show at least one representative from each non-empty image class. The approach is demonstrated for the IEEE InfoVis publications of a complete year. The method can easily be applied to other publication collections and sets of documents which contain images.

  17. ITK optical links backup document

    CERN Document Server

    Huffman, B T; The ATLAS collaboration; Flick, T; Ye, J

    2013-01-01

    This document describes the proposed optical links to be used for the ITK in the phase II upgrade. The current R&D for optical links pursued in the Versatile Link group is reviewed. In particular the results demonstrating the radiation tolerance of all the on-detector components are documented. The bandwidth requirements and the resulting numerology are given.

  18. Virtual Organisation Document Management System

    OpenAIRE

    Sturis, Ričardas

    2004-01-01

    The main goal of Masters final work is to analize basics of virtual organization and its needs for document management system. Virtual organisation is a one of organisations methods to colaborate. Virtual organisation require the system, who will guarantee document managent and control.

  19. Bulkloading and Maintaining XML Documents

    NARCIS (Netherlands)

    Schmidt, A.R.; Kersten, M.L.

    2002-01-01

    The popularity of XML as a exchange and storage format brings about massive amounts of documents to be stored, maintained and analyzed -- a challenge that traditionally has been tackled with Database Management Systems (DBMS). To open up the content of XML documents to analysis with declarative quer

  20. Storing XML Documents in Databases

    NARCIS (Netherlands)

    Schmidt, A.R.; Manegold, S.; Kersten, M.L.; Rivero, L.C.; Doorn, J.H.; Ferraggine, V.E.

    2005-01-01

    The authors introduce concepts for loading large amounts of XML documents into databases where the documents are stored and maintained. The goal is to make XML databases as unobtrusive in multi-tier systems as possible and at the same time provide as many services defined by the XML standards as pos

  1. Government Documents Departmental Operations Guide.

    Science.gov (United States)

    Wilson, John S.; And Others

    This manual for the operation and maintenance of the Government Documents Department at Baylor University's Moody Memorial Library is divided into 13 topical sections. The guide opens with the collection development policy statement, which covers the general collection, the maps division, and weeding government documents. Technical processing…

  2. SRS ecology: Environmental information document

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L.D.; Shipley, R.W.; Bowers, J.A. [and others

    1993-09-01

    The purpose of this Document is to provide a source of ecological information based on the exiting knowledge gained from research conducted at the Savannah River Site. This document provides a summary and synthesis of ecological research in the three main ecosystem types found at SRS and information on the threatened and endangered species residing there.

  3. Documents Related to the Quincentenary.

    Science.gov (United States)

    Hale, Charles R., Comp.

    1993-01-01

    Presents three documents related to the Columbus Quincentenary and indigenous populations. Includes the Declaration of Quito (Ecuador) of July 21, 1990; the final text of the Declaration of Xelaju (Guatemala); and the document "After the 500 Years: Indigenous and Peoples' Unity Proposals for Political Action." (CFR)

  4. Unstructured Documents Categorization: A Study

    Directory of Open Access Journals (Sweden)

    Debnath Bhattacharyya

    2008-12-01

    Full Text Available The main purpose of communication is to transfer information from onecorner to another of the world. The information is basically stored in forms of documents or files created on the basis of requirements. So, the randomness of creation and storage makes them unstructured in nature. As a consequence, data retrieval and modification become hard nut to crack. The data, that is required frequently, should maintain certain pattern. Otherwise, problems like retrievingerroneous data or anomalies in modification or time consumption in retrieving process may hike. As every problem has its own solution, these unstructured documents have also given the solution named unstructured document categorization. That means, the collected unstructured documents will be categorized based on some given constraints. This paper is a review which deals with different techniques like text and data mining, genetic algorithm, lexicalchaining, binarization method to reach the fulfillment of desired unstructured document categorization appeared in the literature.

  5. International Documents on Landscape Restoration

    Directory of Open Access Journals (Sweden)

    Olga Pouperová

    2015-01-01

    Full Text Available In the theory and practice of cultural monuments protection, including garden art monuments and landscape protection, it has been often referred to international conventions and other international documents relating to this protection. Necessary condition for these documents to be adequately used in the practice is the precise understanding of their legal nature and a question arising therefrom, if and to what extent and to whom are those documents binding.The aim of this paper is to provide an analysis of the international documents relating to the landscape restoration. Following the analysis, the authors explore the scope and way of transposition of these documents and obligation arising therefrom into the Czech legal order. In the general part the authors analyse knowledge of the current jurisprudence on treaties and other international documents. They focus on the issue of the legal force of such documents, both on the international and national level. In the following part the authors deal with international documents on landscape restoration, explain legal nature of those documents and explicate whether the documents are formally legally binding or whether they may have other practical effects. The legally binding international treaties on the landscape protection include in particular the Convention on the Protection of the World Cultural and Natural Heritage (Paris, 1972 and the European Landscape Convention (Florence, 2000. As regard legally non-binding acts of international non-governmental organizations, the paper discusses the charters of the International Council on Monuments and Sites (ICOMOS, the Venice Charter of 1964 and the Florence Charter of 1981. Mentioned is also the Athens Charter (1933, respectively the New Athens Charter of 1998 dealing with the landscape in terms of the principles of urban planning.

  6. Data of evolutionary structure change: 1AIJL-1E14M [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AIJL-1E14M 1AIJ 1E14 L M -------------------ALLSFERKYRVPGGTLV--G...ment> 0 1AIJ L 1AIJ...2218189239502 8.040038108825684 1 1AIJ... L 1AIJL YGLGG-A... 333 GLU CA 294 ARG CA 276 1AIJ

  7. Data of evolutionary structure change: 1CTMA-1E2ZC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available M A 1CTMA IVDASNERQVI ...1CTMA-1E2ZC 1CTM 1E2Z A C YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEE EEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CT...M A 1CTMA KILRK--EKGGY ure>EEEEE-- EEure>

  8. Data of evolutionary structure change: 1CTMA-1E2WA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2WA 1CTM 1E2W A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...index> 1CTM A 1CTM...A ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE ure>EE EEEure> IEKAN-GEVVV ure>EEE - EEEEure> <

  9. Data of evolutionary structure change: 1CTMA-1E2ZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2ZA 1CTM 1E2Z A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEEEE EEEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CTM A 1CTMA ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE EEEE EEEure>

  10. Data of evolutionary structure change: 1E4WL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4WL-1MCEA 1E4W 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...ain>A 1MCEA CSSYEGSDNFV EE...263 ALA CA 289 1MCE A 1MCEA...in>A 1MCEA SKQSN-NKYAA -

  11. Data of evolutionary structure change: 1E4XL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XL-1MCEA 1E4X 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...hain>A 1MCEA YYCSSYEGSDN E...line> ALA CA 288 1MCE A 1MCEA...onfEVID> 3 1MCE A 1MCEA

  12. Data of evolutionary structure change: 1E6OL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E6OL-1MCEA 1E6O 1MCE L A EIVLTQSPAITAASLGQKVTITCSAS----SSVSYMHWY...DINVKWKIDGSERQNGVLNSWTDQDS-KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN--- PSALTQ-PPSASGSLGQSVT...82 1MCE A 1MCEA...in> 1MCE A 1MCEA...2 1MCE A 1MCEA

  13. Physicochemical and biological characterization of 1E10 Anti-Idiotype vaccine

    Directory of Open Access Journals (Sweden)

    Machado Yoan J

    2011-11-01

    Full Text Available Abstract Background 1E10 monoclonal antibody is a murine anti-idiotypic antibody that mimics N-glycolyl-GM3 gangliosides. This antibody has been tested as an anti-idiotypic cancer vaccine, adjuvated in Al(OH3, in several clinical trials for melanoma, breast, and lung cancer. During early clinical development this mAb was obtained in vivo from mice ascites fluid. Currently, the production process of 1E10 is being transferred from the in vivo to a bioreactor-based method. Results Here, we present a comprehensive molecular and immunological characterization of 1E10 produced by the two different production processes in order to determine the impact of the manufacturing process in vaccine performance. We observed differences in glycosylation pattern, charge heterogeneity and structural stability between in vivo-produced 1E10 and bioreactor-obtained 1E10. Interestingly, these modifications had no significant impact on the immune responses elicited in two different animal models. Conclusions Changes in 1E10 primary structure like glycosylation; asparagine deamidation and oxidation affected 1E10 structural stability but did not affect the immune response elicited in mice and chickens when compared to 1E10 produced in mice.

  14. Data of evolutionary structure change: 1E2TE-2PFRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E2TE-2PFRB 1E2T 2PFR E B HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPF...ine>ARG CA 540 2PFR B 2PFR...U CA 192 GLN CA 212 VAL CA 235 2PFR... B 2PFRB RKFNYKDNTDLVEFK 2.9440479278564453 2 2PFR

  15. Data of evolutionary structure change: 1E2TG-2PFRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E2TG-2PFRB 1E2T 2PFR G B HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPF...ine> ARG CA 539 2PFR B 2PFR...CA 191 GLN CA 212 VAL CA 236 2PFR B 2PFRB RKFNYKDNTDLVEFK 2.972101926803589 2 2PFR<

  16. Data of evolutionary structure change: 1E52A-4OTAI [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAI 1E52 4OTA A I LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA I 4OTAI 21.018999099731445 -8.57699966430664 97.70899963378906 tion> 0.95...999752044678 0.28600001335144043 tion> 1.992616057395935 2.8046770095825195 ...

  17. Data of evolutionary structure change: 1E52A-4OTAR [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAR 1E52 4OTA A R LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA R 4OTAR 26.631000518798828 -29.371999740600586 72.0260009765625 ...74316 -0.878000020980835 -0.3100000023841858 tion> 1.9946750402450562 2.806180953979492 ...

  18. Data of evolutionary structure change: 1E52A-4OTAG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAG 1E52 4OTA A G LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA G 4OTAG -7.752999782562256 -21.667999267578125 97.37799835205078 tion> ... -0.6010000109672546 0.1940000057220459 tion> 1.9995390176773071 2.805448055267334 ...

  19. Data of evolutionary structure change: 1E52B-4OTAM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAM 1E52 4OTA B M LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...EVID> 0 4OTA M 4OTA... -21.030000686645508 -2.2130000591278076 40.415000915527344 ...-0.5630000233650208 -0.19499999284744263 -0.8029999732971191 tion> 1.9910509586334229 2.7949159145355225 ...

  20. Data of evolutionary structure change: 1E52A-4OTAD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAD 1E52 4OTA A D LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA D 4OTAD -19.621000289916992 33.64500045776367 tion> 0.58799999...60437 -0.2669999897480011 tion> 2.00280499458313 2.825521945953369 ...

  1. Data of evolutionary structure change: 1E52A-4OTAJ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAJ 1E52 4OTA A J LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA J 4OTA...rallel> 16.440000534057617 -7.355000019073486 113.11000061035156 tion>....4909999966621399 -0.23899999260902405 tion> 1.9981789588928223 2.8151841163635254 ...

  2. Data of evolutionary structure change: 1E52A-4OTAH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAH 1E52 4OTA A H LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA H 4OTA...23486328 tion> -0.4189999997615814 -0.828000009059906 -0.3720000088214...6055 -0.8370000123977661 0.5109999775886536 -0.1940000057220459 tion> 1.9984849691390991 2.812535047531128 ...

  3. Data of evolutionary structure change: 1E52B-4OTAJ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAJ 1E52 4OTA B J LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA J 4OTA...llel> 3.2679998874664307 16.643999099731445 95.48200225830078 tion> 0.8259999752044678 tion> 1.9976840019226074 2.8146679401397705 ...

  4. Data of evolutionary structure change: 1E52B-4OTAQ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAQ 1E52 4OTA B Q LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...> 0 4OTA... Q 4OTAQ KETLI-REVSE 38.95899963378906 tion> 0.08500000089406967 0.9610000252723694 0.4729999899864197 -0.27300000190734863 -0.8379999995231628

  5. Data of evolutionary structure change: 1E52B-4OTAH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAH 1E52 4OTA B H LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA H 4OTA...> -0.5889999866485596 -0.09799999743700027 0.8019999861717224 tion> 1.9979859590530396 2.8120179176330566 ... ... -20.273000717163086 -4.440999984741211 94.379997253...41797 tion> 0.39899998903274536 0.828000009059906 0.39399999380111694<

  6. Data of evolutionary structure change: 1E52B-4OTAB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAB 1E52 4OTA B B LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA B 4OTA...3.15999984741211 20.631000518798828 17.600000381469727 tion> 0.9430000...04632568 0.8389999866485596 tion> 1.9927129745483398 2.7974250316619873 ...

  7. Data of evolutionary structure change: 1E52B-4OTAK [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAK 1E52 4OTA B K LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA K 4OTAK -16.0939998626709 77.69400024414062 tion> 0.4510000050...1858 -0.847000002861023 tion> 1.994042992591858 2.79762601852417 ...

  8. Data of evolutionary structure change: 1E52A-4OTAB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAB 1E52 4OTA A B LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA B 4OTA...0.013000000268220901 -3.368000030517578 35.22800064086914 tion> -0.947...000171661377 -0.1899999976158142 tion> 1.993204951286316 2.797945976257324 ...

  9. Data of evolutionary structure change: 1E52B-4OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAA 1E52 4OTA B A LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...t> 0 4OTA A 4OTA...allel> -8.633999824523926 23.224000930786133 2.4660000801086426 tion> ...y>0.6079999804496765 -0.7549999952316284 tion> 2.0007169246673584 2.8046839237213135 ...

  10. Data of evolutionary structure change: 1E52A-4OTAQ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAQ 1E52 4OTA A Q LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...> 0 4OTA... Q 4OTAQ KETLI-REVSE -32.874000549316406 56.58599853515625 tion> -0.06800000369548798 -0....21400000154972076 tion> 1.9998979568481445 2.8079090118408203 ...

  11. Data of evolutionary structure change: 1E52A-4OTAP [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAP 1E52 4OTA A P LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA P 4OTAP -3.50600004196167 74.552001953125 tion> -0.80599999427...3 -0.17900000512599945 tion> 1.997607946395874 2.8045730590820312 ...

  12. Data of evolutionary structure change: 1E52A-4OTAO [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAO 1E52 4OTA A O LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA O 4OTAO -2.740999937057495 59.154998779296875 tion> 0.8669999837875366 0.3...949999809265137 -0.4779999852180481 0.8199999928474426 0.3149999976158142

  13. Data of evolutionary structure change: 1E52A-4OTAE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAE 1E52 4OTA A E LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA E 4OTAE -5.197999954223633 -31.14299964904785 19.062000274658203 tion> -0.972000002861023 0.22200000286102295 tion> 1.9988939762115479 2.805737018585205 ...

  14. Data of evolutionary structure change: 1E52B-4OTAL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAL 1E52 4OTA B L LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA L 4OTAL 9.65999984741211 -14.574000358581543 92.75199890136719 tion> -0.....5839999914169312 0.734000027179718 1.9978070259094238 2.8073511123657227 ...

  15. Data of evolutionary structure change: 1E52B-4OTAN [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAN 1E52 4OTA B N LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...x>0 4OTA N 4OTAN -17.95800018310547 -8.309000015258789 55.1609992980957 tion> -0.3370000123977661 0.7979999780654907 tion> 1.993736982345581 2.7896270751953125 ...

  16. Data of evolutionary structure change: 1E52A-4OTAM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAM 1E52 4OTA A M LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...EVID> 0 4OTA M 4OTA...> -7.85699987411499 -26.211999893188477 58.04199981689453 ...x>-0.4690000116825104 -0.8650000095367432 0.18000000715255737 tion> 1.9915380477905273 2.7954370975494385 ...

  17. Data of evolutionary structure change: 1E52B-4OTAE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAE 1E52 4OTA B E LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA E 4OTAE -18.371000289916992 -7.144000053405762 1.434999942779541 tion> 0...>-0.4449999928474426 -0.7960000038146973 tion> 1.9984110593795776 2.8052260875701904 ...

  18. Data of evolutionary structure change: 1E52A-4OTAC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAC 1E52 4OTA A C LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA C 4OTAC -24.429000854492188 18.4689998626709 tion> 0.3219999...62260437 0.2590000033378601 tion> 1.9993360042572021 2.7992570400238037 ...

  19. Data of evolutionary structure change: 1E52A-4OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAA 1E52 4OTA A A LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...t> 0 4OTA A 4OTA...arallel> 4.539000034332275 -0.7739999890327454 20.0939998626709 tion> ...639038 0.3109999895095825 tion> 2.001197099685669 2.8052051067352295 ...

  20. Data of evolutionary structure change: 1E52B-4OTAO [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAO 1E52 4OTA B O LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA O 4OTAO 21.257999420166016 41.527000427246094 tion> -0.8690000176429749 -0.3...0000023841858 0.019999999552965164 0.652999997138977 -0.7570000290870667

  1. Ways to Environmental Education, Volume 4.

    Science.gov (United States)

    Allen, Rodney F., Ed.; And Others

    Four environmental education booklets presented in this document comprise the fourth volume of the environmental series developed by community groups around the Tallahassee Junior Museum and its pioneer farm. The focus of the document is on ways to environmental education. Part one presents a mini-history of Tallahassee, its origin, inhabitants,…

  2. Audit of Orthopaedic Surgical Documentation

    Directory of Open Access Journals (Sweden)

    Fionn Coughlan

    2015-01-01

    Full Text Available Introduction. The Royal College of Surgeons in England published guidelines in 2008 outlining the information that should be documented at each surgery. St. James’s Hospital uses a standard operation sheet for all surgical procedures and these were examined to assess documentation standards. Objectives. To retrospectively audit the hand written orthopaedic operative notes according to established guidelines. Methods. A total of 63 operation notes over seven months were audited in terms of date and time of surgery, surgeon, procedure, elective or emergency indication, operative diagnosis, incision details, signature, closure details, tourniquet time, postop instructions, complications, prosthesis, and serial numbers. Results. A consultant performed 71.4% of procedures; however, 85.7% of the operative notes were written by the registrar. The date and time of surgery, name of surgeon, procedure name, and signature were documented in all cases. The operative diagnosis and postoperative instructions were frequently not documented in the designated location. Incision details were included in 81.7% and prosthesis details in only 30% while the tourniquet time was not documented in any. Conclusion. Completion and documentation of operative procedures were excellent in some areas; improvement is needed in documenting tourniquet time, prosthesis and incision details, and the location of operative diagnosis and postoperative instructions.

  3. Near Duplicate Document Detection Survey

    Directory of Open Access Journals (Sweden)

    Bassma S. Alsulami

    2012-04-01

    Full Text Available Search engines are the major breakthrough on the web for retrieving the information. But List of retrieved documents contains a high percentage of duplicated and near document result. So there is the need to improve the performance of search results. Some of current search engine use data filtering algorithm which can eliminate duplicate and near duplicate documents to save the users’ time and effort. The identification of similar or near-duplicate pairs in a large collection is a significant problem with wide-spread applications. In this paper survey present an up-to-date review of the existing literature in duplicate and near duplicate detection in Web

  4. Contextualizing Data Warehouses with Documents

    DEFF Research Database (Denmark)

    Perez, Juan Manuel; Berlanga, Rafael; Aramburu, Maria Jose

    2008-01-01

    Current data warehouse and OLAP technologies are applied to analyze the structured data that companies store in databases. The context that helps to understand data over time is usually described separately in text-rich documents. This paper proposes to integrate the traditional corporate data...... warehouse with a document warehouse, resulting in a contextualized warehouse. Thus, the user first selects an analysis context by supplying some keywords. Then, the analysis is performed on a novel type of OLAP cube, called an R-cube, which is materialized by retrieving and ranking the documents...

  5. Working with Documents in Databases

    Directory of Open Access Journals (Sweden)

    Marian DARDALA

    2008-01-01

    Full Text Available Using on a larger and larger scale the electronic documents within organizations and public institutions requires their storage and unitary exploitation by the means of databases. The purpose of this article is to present the way of loading, exploitation and visualization of documents in a database, taking as example the SGBD MSSQL Server. On the other hand, the modules for loading the documents in the database and for their visualization will be presented through code sequences written in C#. The interoperability between averages will be carried out by the means of ADO.NET technology of database access.

  6. Handwritten Document Editor: An Approach

    Directory of Open Access Journals (Sweden)

    Sumit Nalawade

    2014-05-01

    Full Text Available With advancement in new technologies many individuals are moving towards personalization of the same. The same idea inspired us to develop a system which can provide a personal touch to all our documents including both electronic and paper media. In this article we are proposing a novel idea for creating an edito r system which will take handwritten scanned document as the input, recognizes the characters from the document, then proceed with creating the font of recognized handwriting to allow user to edit the document. We have proposed use of genetic algorithm along with K-NN classifier for fast recognition of handwritten characters and use of marching squares algorithm for tracing contour points of characters to generate a handwritten font.

  7. Handwritten Document Editor: An Approach

    Directory of Open Access Journals (Sweden)

    Sumit Nalawade

    2015-11-01

    Full Text Available With advancement in new technologies many individuals are moving towards personalization of the same. The same idea inspired us to develop a system which can provide a personal touch to all our documents including both electronic and paper media. In this article we are proposing a novel idea for creating an editor system which will take handwritten scanned document as the input, recognizes the characters from the document, then proceed with creating the font of recognized handwriting to allow user to edit the document. We have proposed use of genetic algorithm along with K-NN classifier for fast recognition of handwritten characters and use of marching squares algorithm for tracing contour points of characters to generate a handwritten font.

  8. CERN Document Server (CDS): Introduction

    CERN Document Server

    CERN. Geneva; Costa, Flavio

    2017-01-01

    A short online tutorial introducing the CERN Document Server (CDS). Basic functionality description, the notion of Revisions and the CDS test environment. Links: CDS Production environment CDS Test environment  

  9. ENDF/B summary documentation

    Energy Technology Data Exchange (ETDEWEB)

    Kinsey, R. (comp.)

    1979-07-01

    This publication provides a localized source of descriptions for the evaluations contained in the ENDF/B Library. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The summary documentations were written by the CSEWB (Cross Section Evaluation Working Group) evaluators and compiled by NNDC (National Nuclear Data Center). This edition includes documentation for materials found on ENDF/B Version V tapes 501 to 516 (General Purpose File) excluding tape 504. ENDF/B-V also includes tapes containing partial evaluations for the Special Purpose Actinide (521, 522), Dosimetry (531), Activation (532), Gas Production (533), and Fission Product (541-546) files. The materials found on these tapes are documented elsewhere. Some of the evaluation descriptions in this report contain cross sections or energy level information. (RWR)

  10. Document Analysis by Crosscount Approach

    Institute of Scientific and Technical Information of China (English)

    王海琴; 戴汝为

    1998-01-01

    In this paper a new feature called crosscount for document analysis is introduced.The reature crosscount is a function of white line segment with its start on the edge of document images.It reflects not only the contour of image,but also the periodicity of white lines(background)and text lines in the document images.In complex printed-page layouts,there are different blocks such as textual,graphical,tabular,and so on.Of these blocks,textual ones have the most obvious periodicity with their homogeneous white lines arranged regularly.The important property of textual blocks can be extracted by crosscount functions.here the document layouts are classified into three classes on the basis of their physical structures.Then the definition and properties of the crosscount function are described.According to the classification of document layouts,the application of this new feature to different types of document images' analysis and understanding is discussed.

  11. Evaluating document filtering systems over time

    NARCIS (Netherlands)

    Kenter, T.; Balog, K.; de Rijke, M.

    2015-01-01

    Document filtering is a popular task in information retrieval. A stream of documents arriving over time is filtered for documents relevant to a set of topics. The distinguishing feature of document filtering is the temporal aspect introduced by the stream of documents. Document filtering systems, up

  12. Implementing US Department of Energy lessons learned programs. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    The DOE Lessons Learned Handbook is a two-volume publication developed to supplement the DOE Lessons Learned Standard (DOE-STD-7501-95) with information that will organizations in developing or improving their lessons learned programs. Volume 1 includes greater detail than the Standard in areas such as identification and documentation of lessons learned; it also contains sections on specific processes such as training and performance measurement. Volume 2 (this document) contains examples of program documents developed by existing lessons learned programs as well as communications material, functional categories, transmittal documents, sources of professional and industry lessons learned, and frequently asked questions about the Lessons Learned List Service.

  13. Converting environmental documentation to management information

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, M.J.; Frentz, H.J. [Tracor Technology Resources, Inc., Rockville, MD (United States)

    1996-12-01

    The growth of environmental, health, and safety regulations and their reporting requirements has been extraordinary. Penalties for missteps in environmental documentation also grow more serious. Every major piece of environmental legislation requires facilities to collect data and maintain records, in many cases detailed records for long periods of time, on raw materials, processes, emissions, events, personnel, and many other facets of business operations. Unfortunately, for some organizations, the collection of data that satisfies regulatory requirements is an end in itself. Data acquired in this manner may result in little useful information that managers can use to foster their business goals. For organizations of any appreciable size, the volume of environmental data, in manual form, makes analysis difficult to impossible. Too often, data resides in disparate databases, in different locations, and within incompatible information management systems. This paper discusses converting these disparate databases into a useful system.

  14. Aperiodic Volume Optics

    Science.gov (United States)

    Gerke, Tim D.

    periodic and quasi-periodic systems for the manipulation of light in the IR regime. The general thesis of this document is that aperiodic three-dimensional structures provide additional degrees of freedom that can be utilized to improve on the performance of periodic volume devices. The results we will discuss suggest that, under certain circumstances, a departure from the Bragg paradigm provides enhanced volume diffraction properties.

  15. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID)

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 3) presents the standards and requirements for the following sections: Safeguards and Security, Engineering Design, and Maintenance.

  16. Construction of a recombinant adenovirus Vector of human papillomavirus type 16 L1_E7c

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Human papillomaviruses are closely associated with human cervical cancer, especially HPV types 16 and 18. At present, HPV can not be produced in large quantity; it also has tumorgenicity and these properties of HPV have seriously hampered the development of HPV vaccine. HPV type 16 L1 proteins can assembled into virus-like particles (VLP), which are morphologically identical to the nature virion. In order to develop the recombinant adenovirus vectors of HPV, we constructed a recombinant adenovirus shuttle plasmid pCA14 L1-E7c. Methods: Human papillomavirus type 16 L1 open reading frame without terminator codon (TAA) (5559- 7152) and E7c (682- 855) were amplified using PCR. The L1 and E7c fragments were inserted into pGEM-T easy vectors by T- A strategy, named pTAL1 and pTAE7c. pTAL1 was cut with Hind III and BglII, the pTAE7c with BamHI and ClaI. The L1 DNA fragment, E7c and pBluesscript SK were ligated together using T4 DNA ligase. pBSL1-E7c and pBSL1-E7c was digested with Hind III and Xhol. The L1-E7c fragment was inserted into adenovirus shuttle plasmids pCAl4, named pCAl4L1-E7c. DNA sequence results indicated that The L1-E7c DNA fragment can encode the HPV16L1-E7 fusion protein correctly. Results: The L1 and E7c DNA fragments were amplified by PCR and recombinant plasmid pTAL1, pTAE7c, pBSL1-E7c and pCA14L1-E7c were constructed correctly. The pCAl4L1-E7c can be used in the further research work, cotransfected the 293 cell with the parent adenovirus pBHG10. Conclusion: Our results indicated that we have constructed a HPV16L1-E7 fusion DNA fragments and the adenovirus shuttle plasmids pCALl-E7c for the further research.

  17. Hanford site solid waste management environmental impact statement technical information document [SEC 1 THRU 4

    Energy Technology Data Exchange (ETDEWEB)

    FRITZ, L.L.

    2003-04-01

    This Technical Information Document (TID) provides engineering data to support DOE/EIS-0286, ''Hanford Site Solid (Radioactive and Hazardous) Waste Program Environmental Impact Statement,'' including assumptions and waste volumes calculation data.

  18. Shark (Prionace glauca) elastoidin: characterization of its collagen as [alpha 1(E)]3 homotrimers.

    Science.gov (United States)

    Kimura, S; Uematsu, Y; Miyauchi, Y

    1986-01-01

    A new type of collagen was isolated from elastoidin of great blue shark by limited pepsin digestion. The collagen alpha chain of elastoidin, designated alpha 1(E), was very similar in electrophoretic and chromatographic behavior and amino acid composition to shark skin alpha 1(I) chain, but they were genetically-distinct on the basis of CNBr-peptide maps. The collagen molecule of elastoidin was shown to be an [alpha 1(E)]3 homotrimer.

  19. Evolution of the ubiquitin-activating enzyme Uba1 (E1)

    Science.gov (United States)

    Allan, Douglas C.; Phillips, J. C.

    2017-10-01

    Ubiquitin tags diseased proteins and initiates an enzyme conjugation cascade, which has three stages. The first-stage enzyme Uba1 (E1) has evolved only modestly from slime mold to humans, and is > 14 times larger than Ub. Here we use critical point thermodynamic scaling theory to connect Uba1 (E1) evolution from yeast and slime mold to fruit flies and humans to subtle changes in its amino acid sequences.

  20. Evolutionary analysis of rubella viruses in mainland China during 2010-2012: endemic circulation of genotype 1E and introductions of genotype 2B.

    Science.gov (United States)

    Zhu, Zhen; Rivailler, Pierre; Abernathy, Emily; Cui, Aili; Zhang, Yan; Mao, Naiyin; Xu, Songtao; Zhou, Shujie; Lei, Yue; Wang, Yan; Zheng, Huanying; He, Jilan; Chen, Ying; Li, Chongshan; Bo, Fang; Zhao, Chunfang; Chen, Meng; Lu, Peishan; Li, Fangcai; Gu, Suyi; Gao, Hui; Guo, Yu; Chen, Hui; Feng, Daxing; Wang, Shuang; Tang, Xiaomin; Lei, Yake; Feng, Yan; Deng, Lili; Gong, Tian; Fan, Lixia; Xu, Wenbo; Icenogle, Joseph

    2015-01-23

    Rubella remains a significant burden in mainland China. In this report, 667 viruses collected in 24 of 31 provinces of mainland China during 2010-2012 were sequenced and analyzed, significantly extending previous reports on limited numbers of viruses collected before 2010. Only viruses of genotypes 1E and 2B were found. Genotype 1E viruses were found in all 24 provinces. Genotype 1E viruses were likely introduced into mainland China around 1997 and endemic transmission of primarily one lineage became established. Viruses reported here from 2010-2012 are largely in a single cluster within this lineage. Genotype 2B viruses were rarely detected in China prior to 2010. This report documents a previously undetected 2B lineage, which likely became endemic in eastern provinces of China between 2010 and 2012. Bayesian analyses were performed to estimate the evolutionary rates and dates of appearance of the genotype 1E and 2B viral linages in China. A skyline plot of viral population diversity did not provide evidence of reduction of diversity as a result of vaccination, but should be useful as a baseline for such reductions as vaccination programs for rubella become widespread in mainland China.

  1. Renormalized Volume

    Science.gov (United States)

    Gover, A. Rod; Waldron, Andrew

    2017-09-01

    We develop a universal distributional calculus for regulated volumes of metrics that are suitably singular along hypersurfaces. When the hypersurface is a conformal infinity we give simple integrated distribution expressions for the divergences and anomaly of the regulated volume functional valid for any choice of regulator. For closed hypersurfaces or conformally compact geometries, methods from a previously developed boundary calculus for conformally compact manifolds can be applied to give explicit holographic formulæ for the divergences and anomaly expressed as hypersurface integrals over local quantities (the method also extends to non-closed hypersurfaces). The resulting anomaly does not depend on any particular choice of regulator, while the regulator dependence of the divergences is precisely captured by these formulæ. Conformal hypersurface invariants can be studied by demanding that the singular metric obey, smoothly and formally to a suitable order, a Yamabe type problem with boundary data along the conformal infinity. We prove that the volume anomaly for these singular Yamabe solutions is a conformally invariant integral of a local Q-curvature that generalizes the Branson Q-curvature by including data of the embedding. In each dimension this canonically defines a higher dimensional generalization of the Willmore energy/rigid string action. Recently, Graham proved that the first variation of the volume anomaly recovers the density obstructing smooth solutions to this singular Yamabe problem; we give a new proof of this result employing our boundary calculus. Physical applications of our results include studies of quantum corrections to entanglement entropies.

  2. Oncogenic AKT1(E17K) mutation induces mammary hyperplasia but prevents HER2-driven tumorigenesis.

    Science.gov (United States)

    Mancini, Maria L; Lien, Evan C; Toker, Alex

    2016-04-05

    One of the most frequently deregulated signaling pathways in breast cancer is the PI 3-K/Akt cascade. Genetic lesions are commonly found in PIK3CA, PTEN, and AKT, which lead to excessive and constitutive activation of Akt and downstream signaling that results in uncontrolled proliferation and increased cellular survival. One such genetic lesion is the somatic AKT1(E17K) mutation, which has been identified in 4-8% of breast cancer patients. To determine how this mutation contributes to mammary tumorigenesis, we constructed a genetically engineered mouse model that conditionally expresses human AKT1(E17K) in the mammary epithelium. Although AKT1(E17K) is only weakly constitutively active and does not promote proliferation in vitro, it is capable of escaping negative feedback inhibition to exhibit sustained signaling dynamics in vitro. Consistently, both virgin and multiparous AKT1(E17K) mice develop mammary gland hyperplasia that do not progress to carcinoma. This hyperplasia is accompanied by increased estrogen receptor expression, although exposure of the mice to estrogen does not promote tumor development. Moreover, AKT1(E17K) prevents HER2-driven mammary tumor formation, in part through negative feedback inhibition of RTK signaling. Analysis of TCGA breast cancer data revealed that the mRNA expression, total protein levels, and phosphorylation of various RTKs are decreased in human tumors harboring AKT1(E17K).

  3. Insulin-secreting INS-1E cells express functional TRPV1 channels.

    Science.gov (United States)

    Fågelskiöld, Amanda Jabin; Kannisto, Kristina; Boström, Anna; Hadrovic, Banina; Farre, Cecilia; Eweida, Mohamed; Wester, Kenneth; Islam, Md Shahidul

    2012-01-01

    We have studied whether functional TRPV1 channels exist in the INS-1E cells, a cell type used as a model for β-cells, and in primary β-cells from rat and human. The effects of the TRPV1 agonists capsaicin and AM404 on the intracellular free Ca (2+) concentration ([Ca (2+)]i) in the INS-1E cells were studied by fura-2 based microfluorometry. Capsaicin increased [Ca (2+)]i in a concentration-dependent manner, and the [Ca (2+)]i increase was dependent on extracellular Ca (2+). AM404 also increased [Ca (2+)]i in the INS-1E cells. Capsazepine, a specific antagonist of TRPV1, completely blocked the capsaicin- and AM404-induced [Ca (2+)]i increases. Capsaicin did not increase [Ca (2+)]i in the primary β-cells from rat and human. Whole cell patch clamp configuration was used to record currents across the plasma membrane in the INS-1E cells. Capsaicin elicited inward currents that were inhibited by capsazepine. Western blot analysis detected TRPV1 proteins in the INS-1E cells and the human islets. Immunohistochemistry was used to study the expression of TRPV1, but no TRPV1 protein immunoreactivity was detected in the human islet cells and the human insulinoma cells. We conclude that the INS-1E cells, but not the primary β-cells, express functional TRPV1 channels.

  4. Modeling Documents with Event Model

    Directory of Open Access Journals (Sweden)

    Longhui Wang

    2015-08-01

    Full Text Available Currently deep learning has made great breakthroughs in visual and speech processing, mainly because it draws lessons from the hierarchical mode that brain deals with images and speech. In the field of NLP, a topic model is one of the important ways for modeling documents. Topic models are built on a generative model that clearly does not match the way humans write. In this paper, we propose Event Model, which is unsupervised and based on the language processing mechanism of neurolinguistics, to model documents. In Event Model, documents are descriptions of concrete or abstract events seen, heard, or sensed by people and words are objects in the events. Event Model has two stages: word learning and dimensionality reduction. Word learning is to learn semantics of words based on deep learning. Dimensionality reduction is the process that representing a document as a low dimensional vector by a linear mode that is completely different from topic models. Event Model achieves state-of-the-art results on document retrieval tasks.

  5. Terminologie de Base de la Documentation. (Basic Terminology of Documentation).

    Science.gov (United States)

    Commission des Communautes Europeennes (Luxembourg). Bureau de Terminologie.

    This glossary is designed to aid non-specialists whose activities require that they have some familiarity with the terminology of the modern methods of documentation. Definitions have been assembled from various dictionaries, manuals, etc., with particular attention being given to the publications of UNESCO and the International Standards…

  6. Electronic documents circulation in taxation

    Directory of Open Access Journals (Sweden)

    Yanchev A.V.

    2015-03-01

    Full Text Available Scientific recommendations on electronic documents circulation’s introduction in the system of the taxation are developed. The model of the initial tax calculation is offered which in contrast to available one takes into account the specific of enterprise’s administrative business-processes and also the algorithm of tax-payer’s electronic authentication in global system of electronic government. This allows without additional costs to boost information streams’ quality on electronic documentation of tax calculations. This also allows avoiding documents’ doubling and their separate requisites in state database.

  7. Expression of Estrogen Sulfotransferase 1E1 and Steroid Sulfatase in Breast Cancer: A Immunohistochemical Study

    Directory of Open Access Journals (Sweden)

    D. Poisson Paré

    2009-01-01

    Full Text Available It is known that the steroid sulfatase (STS and the estrogen sulfotransferase (EST1E1 are commonly expressed in human breast carcinomas. STS and EST1E1 combined action could maintain the equilibrium between sulfated (inactive and unconjugated (active estrogens, which might have effects on development of hormone dependent breast cancer. We studied the expression of the STS and EST1E1 in 88 breast carcinomas and 57 adjacent non-malignant tissues by immunohistochemistry. The results were correlated with the tumor expression of estrogen receptor α (ER-α and β (ER-β, progesterone receptor A (PR-A and B (PR-B and the proliferation marker CDC47, the tumoral type and stage and the age at surgery. STS expression was higher in carcinoma specimens than in adjacent normal tissues, although not to a significant level (p = 0.064 and it was positively associated with CDC47 expression (p 0.05. These observations support the hypothesis that STS is overexpressed in breast cancer and associated with a worse prognosis. EST1E1 was observed for the first time in the nuclei of epithelial and tumoral cells. Tumor expression of EST1E1 was positively correlated with ER-β (p 0.01 and PR-B (p 0.05, two steroid receptors already associated with an improve prognosis for breast cancer. Controlling the STS overexpression in carcinomas could be a way to inhibit cancer growth. The significance of the association between EST1E1 and ER-β or PR-B should be further studied since these two receptors are transcription activators and may regulate the expression of protective enzymes like EST1E1.

  8. Seneca Falls: Achieving Woman's Rights. Teaching with Primary Sources Series, Volume 12.

    Science.gov (United States)

    Hodges, Elaine Prater

    This volume provides documentation on the origin of the women's rights movement placing the documents in a context that aims to show the rationale that blocked women from achieving full equality. The volume contains 127 fully annotated documents presented in chronological order (with a few exceptions) beginning in 1632 with colonial laws regarding…

  9. Making the Grade? Globalisation and the Training Market in Australia. Volume 1 [and] Volume 2.

    Science.gov (United States)

    Hall, Richard; Buchanan, John; Bretherton, Tanya; van Barneveld, Kristin; Pickersgill, Richard

    This two-volume document reports on a study of globalization and Australia's training market. Volume 1 begins by examining debate on globalization and industry training in Australia. Discussed next is the study methodology, which involved field studies of the metals and engineering industry in South West Sydney and the Hunter and the information…

  10. Verification of Safety Margins of Battery Banks Capacity of Class 1E DC System in a Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Lukman, Abdulrauf [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Zhu, Oon-Pyo [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-10-15

    According to Ref 'Station blackout (SBO) is generally a plant condition with complete loss of all alternating current (AC) power from off-site sources, from the main generator and from standby AC power sources important to safety to the essential and nonessential switchgear buses. Direct current (DC) power supplies and uninterruptible AC power supplies may be available as long as batteries can supply the loads, alternate AC power supplies are available'. The above IAEA document indicated the importance of batteries during SBO. Prior to the Fukushima accident, most batteries might be designed with coping capability of four hours. However, the accident showed the need for the coping capability to be increased to at least eight hours. The purpose of this research is to verify the safety capacity margin of the nuclear qualified battery banks of class 1E DC system and test the response to SBO using the load profile of a Korean design nuclear power plant (NPP). The capacity margins of class 1E batteries of DC power system batteries in a nuclear power plant were determined using the load profile of the plant. It was observed that if appropriate manufacturer Kt data are not available, the accuracy of the battery capacity might not be accurately calculated. The result obtained shows that the batteries have the coping capability of two hours for channel A and B, and eight hours for channel C and D. Also capacity margin as show in figure show a reasonable margin for each batteries of the DC system.

  11. La Documentacion Automatica (Automated Documentation).

    Science.gov (United States)

    Levery, Francis

    1971-01-01

    Documentation centers are needed to handle the vast amount of scientific and technical information currently being issued. Such centers should be concerned both with handling inquiries in a particular field and with producing a general catalog of current information. Automatic analysis of texts by computers will be the best way to handle material,…

  12. Measuring Interestingness of Political Documents

    NARCIS (Netherlands)

    Azarbonyad, H.

    2016-01-01

    Political texts are pervasive on the Web covering laws and policies in national and supranational jurisdictions. Access to this data is crucial for government transparency and accountability to the population. The main aim of our research is developing a ranking method for political documents which

  13. Methodological Aspects of Architectural Documentation

    Directory of Open Access Journals (Sweden)

    Arivaldo Amorim

    2011-12-01

    Full Text Available This paper discusses the methodological approach that is being developed in the state of Bahia in Brazil since 2003, in architectural and urban sites documentation, using extensive digital technologies. Bahia has a vast territory with important architectural ensembles ranging from the sixteenth century to present day. As part of this heritage is constructed of raw earth and wood, it is very sensitive to various deleterious agents. It is therefore critical document this collection that is under threats. To conduct those activities diverse digital technologies that could be used in documentation process are being experimented. The task is being developed as an academic research, with few financial resources, by scholarship students and some volunteers. Several technologies are tested ranging from the simplest to the more sophisticated ones, used in the main stages of the documentation project, as follows: work overall planning, data acquisition, processing and management and ultimately, to control and evaluate the work. The activities that motivated this paper are being conducted in the cities of Rio de Contas and Lençóis in the Chapada Diamantina, located at 420 km and 750 km from Salvador respectively, in Cachoeira city at Recôncavo Baiano area, 120 km from Salvador, the capital of Bahia state, and at Pelourinho neighbourhood, located in the historic capital. Part of the material produced can be consulted in the website: < www.lcad.ufba.br>.

  14. Melter Disposal Strategic Planning Document

    Energy Technology Data Exchange (ETDEWEB)

    BURBANK, D.A.

    2000-09-25

    This document describes the proposed strategy for disposal of spent and failed melters from the tank waste treatment plant to be built by the Office of River Protection at the Hanford site in Washington. It describes program management activities, disposal and transportation systems, leachate management, permitting, and safety authorization basis approvals needed to execute the strategy.

  15. Technical Documentation and Legal Liability.

    Science.gov (United States)

    Caher, John M.

    1995-01-01

    States that litigation over the interpretation and sufficiency of technical documentation is increasingly common as a number of suits have been filed in state and federal courts. Describes the case of "Martin versus Hacker," a recent case in which New York's highest court analyzed a technical writer's prose in the context of a lawsuit…

  16. Annex II technical documentation assessed.

    Science.gov (United States)

    van Drongelen, A W; Roszek, B; van Tienhoven, E A E; Geertsma, R E; Boumans, R T; Kraus, J J A M

    2005-12-01

    Annex II of the Medical Device Directive (MDD) is used frequently by manufacturers to obtain CE-marking. This procedure relies on a full quality assurance system and does not require an assessment of the individual medical device by a Notified Body. An investigation into the availability and the quality of technical documentation for Annex II devices revealed severe shortcomings, which are reported here.

  17. Synchronizing Web Documents with Style

    NARCIS (Netherlands)

    R.L. Guimarães (Rodrigo); D.C.A. Bulterman (Dick); P.S. Cesar Garcia (Pablo Santiago); A.J. Jansen (Jack)

    2014-01-01

    htmlabstractIn this paper we report on our efforts to define a set of document extensions to Cascading Style Sheets (CSS) that allow for structured timing and synchronization of elements within a Web page. Our work considers the scenario in which the temporal structure can be decoupled from the

  18. Chemical Abstracts' Document Delivery Service.

    Science.gov (United States)

    Rollins, Stephen

    1984-01-01

    The Document Delivery Service offered by Chemical Abstracts is described in terms of the DIALORDER option on the Dialog information retrieval system, mail requests, and requests transmitted through OCLC's Interlibrary Loan system. Transmission costs, success rates, delivery rates, and other considerations in utilizing the service are included.…

  19. Synchronizing Web Documents with Style

    NARCIS (Netherlands)

    Guimarães, R.L.; Bulterman, D.C.A.; Cesar Garcia, P.S.; Jansen, A.J.

    2014-01-01

    In this paper we report on our efforts to define a set of document extensions to Cascading Style Sheets (CSS) that allow for structured timing and synchronization of elements within a Web page. Our work considers the scenario in which the temporal structure can be decoupled from the content of the W

  20. The Digital technical documentation handbook

    CERN Document Server

    Schultz, Susan I; Kavanagh, Frank X; Morse, Marjorie J

    1993-01-01

    The Digital Technical Documentation Handbook describes the process of developing and producing technical user information at Digital Equipment Corporation. * Discusses techniques for making user information _more effective * Covers the draft and reviewprocess, the production and distribution of printed and electronic media, archiving, indexing, testing for usability, and many other topics * Provides quality assurance checklists, contains a glossary and a bibliography of resources for technicalcommunicators

  1. Population Education Documents, Reprint Series.

    Science.gov (United States)

    United Nations Educational, Scientific, and Cultural Organization, Bangkok (Thailand). Regional Office for Education in Asia and Oceania.

    This publication contains reprints of five documents that were either published in foreign journals or released in limited numbers by author or publisher. The papers are all concerned with population education, but deal more specifically with the role of population and the schools. Among the topics discussed are population education and the school…

  2. ELECTRICAL SUPPORT SYSTEM DESCRIPTION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    S. Roy

    2004-06-24

    The purpose of this revision of the System Design Description (SDD) is to establish requirements that drive the design of the electrical support system and their bases to allow the design effort to proceed to License Application. This SDD is a living document that will be revised at strategic points as the design matures over time. This SDD identifies the requirements and describes the system design as they exist at this time, with emphasis on those attributes of the design provided to meet the requirements. This SDD has been developed to be an engineering tool for design control. Accordingly, the primary audience/users are design engineers. This type of SDD both ''leads'' and ''trails'' the design process. It leads the design process with regard to the flow down of upper tier requirements onto the system. Knowledge of these requirements is essential in performing the design process. The SDD trails the design with regard to the description of the system. The description provided in the SDD is a reflection of the results of the design process to date. Functional and operational requirements applicable to electrical support systems are obtained from the ''Project Functional and Operational Requirements'' (F&OR) (Siddoway 2003). Other requirements to support the design process have been taken from higher-level requirements documents such as the ''Project Design Criteria Document'' (PDC) (Doraswamy 2004), and fire hazards analyses. The above-mentioned low-level documents address ''Project Requirements Document'' (PRD) (Canon and Leitner 2003) requirements. This SDD contains several appendices that include supporting information. Appendix B lists key system charts, diagrams, drawings, and lists, and Appendix C includes a list of system procedures.

  3. Executive overview and introduction to the SMAP information system life-cycle and documentation standards

    Science.gov (United States)

    1989-01-01

    An overview of the five volume set of Information System Life-Cycle and Documentation Standards is provided with information on its use. The overview covers description, objectives, key definitions, structure and application of the standards, and document structure decisions. These standards were created to provide consistent NASA-wide structures for coordinating, controlling, and documenting the engineering of an information system (hardware, software, and operational procedures components) phase by phase.

  4. Data collection system. Volume 1, Overview and operators manual; Volume 2, Maintenance manual; Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Caudell, R.B.; Bauder, M.E.; Boyer, W.B.; French, R.E.; Isidoro, R.J.; Kaestner, P.C.; Perkins, W.G.

    1993-09-01

    Sandia National Laboratories (SNL) Instrumentation Development Department was tasked by the Defense Nuclear Agency (DNA) to record data on Tektronix RTD720 Digitizers on the HUNTERS TROPHY field test conducted at the Nevada Test Site (NTS) on September 18, 1992. This report contains a overview and description of the computer hardware and software that was used to acquire, reduce, and display the data. The document is divided into two volumes: an overview and operators manual (Volume 1) and a maintenance manual (Volume 2).

  5. Effects of E2 and E1-E2 Interference on Coulomb Dissociation of 19C

    Institute of Scientific and Technical Information of China (English)

    Rajesh Kharab; Pardeep Singh; Ravinder Kumar

    2007-01-01

    We investigate the effects of higher order multipole transitions, in particular electric quadrupole (E2) and E1-E2interference, on the Coulomb dissociation of 19 C within the framework of the first order eikonal approximation.The sensitivity of the total Coulomb breakup cross section and the longitudinal momentum distribution of the core fragment to these effects are checked. The breakup occurs predominately through the dipole transition and the contribution of E2 transition to the total cross section is found to be within the range from 1 to 3% of that of E1. It is further observed that the E1-E2 interference term contributes nothing to the integrated cross section.On the other hand, the longitudinal momentum distribution is observed to be insensitive to the E2 transition while the E1-E2 interference introduces a small asymmetry in its shape.

  6. ServCat Document Selection Guidelines

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The ServCat document selection guidelines were developed for selecting appropriate documents to upload into ServCat. When beginning to upload documents into ServCat,...

  7. Informative document halogenated hydrocarbon-containing waste

    NARCIS (Netherlands)

    Verhagen H

    1992-01-01

    This "Informative document halogenated hydrocarbon-containing waste" forms part of a series of "Informative documents waste materials". These documents are conducted by RIVM on the instructions of the Directorate General for the Environment, Waste Materials Directorate, in behal

  8. FOSSIL2 energy policy model documentation: FOSSIL2 documentation

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-10-01

    This report discusses the structure, derivations, assumptions, and mathematical formulation of the FOSSIL2 model. Each major facet of the model - supply/demand interactions, industry financing, and production - has been designed to parallel closely the actual cause/effect relationships determining the behavior of the United States energy system. The data base for the FOSSIL2 program is large, as is appropriate for a system dynamics simulation model. When possible, all data were obtained from sources well known to experts in the energy field. Cost and resource estimates are based on DOE data whenever possible. This report presents the FOSSIL2 model at several levels. Volumes II and III of this report list the equations that comprise the FOSSIL2 model, along with variable definitions and a cross-reference list of the model variables. Volume III lists the model equations and a one line definition for equations, in a short, readable format.

  9. Bare-Hand Volume Cracker for Raw Volume Data Analysis

    Directory of Open Access Journals (Sweden)

    Bireswar Laha

    2016-09-01

    Full Text Available Analysis of raw volume data generated from different scanning technologies faces a variety of challenges, related to search, pattern recognition, spatial understanding, quantitative estimation, and shape description. In a previous study, we found that the Volume Cracker (VC 3D interaction (3DI technique mitigated some of these problems, but this result was from a tethered glove-based system with users analyzing simulated data. Here, we redesigned the VC by using untethered bare-hand interaction with real volume datasets, with a broader aim of adoption of this technique in research labs. We developed symmetric and asymmetric interfaces for the Bare-Hand Volume Cracker (BHVC through design iterations with a biomechanics scientist. We evaluated our asymmetric BHVC technique against standard 2D and widely used 3D interaction techniques with experts analyzing scanned beetle datasets. We found that our BHVC design significantly outperformed the other two techniques. This study contributes a practical 3DI design for scientists, documents lessons learned while redesigning for bare-hand trackers, and provides evidence suggesting that 3D interaction could improve volume data analysis for a variety of visual analysis tasks. Our contribution is in the realm of 3D user interfaces tightly integrated with visualization, for improving the effectiveness of visual analysis of volume datasets. Based on our experience, we also provide some insights into hardware-agnostic principles for design of effective interaction techniques.

  10. Birc1e/Naip5 rapidly antagonizes modulation of phagosome maturation by Legionella pneumophila.

    Science.gov (United States)

    Fortier, Anne; de Chastellier, Chantal; Balor, Stéphanie; Gros, Philippe

    2007-04-01

    Legionella survives intracellularly by preventing fusion with lysosomes, due to phagosome escape from the endocytic pathway at an early stage of phagosome maturation, and by creating a replicative organelle that acquires endoplasmic reticulum (ER) characteristics through sustained interactions and fusion with the ER. Intracellular replication of Legionella pneumophila in mouse macrophages is controlled by the Lgn1 locus. Functional complementation in vivo has identified the Birc1e/Naip5 gene as being responsible for the Lgn1 effect. To understand the function and temporal site of action of Birc1e/Naip5 in susceptibility to L. pneumophila, we examined the biogenesis of Legionella-containing vacuoles (LCVs) formed in permissive A/J macrophages and in their Birc1e/Naip5 transgenic non-permissive counterpart. Birc1e/Naip5 effects on acquisition of lysosomal and ER markers were evident within 1-2 h following infection. A significantly higher proportion of LCVs formed in Birc1e/Naip5 transgenic macrophages had acquired the lysosomal markers cathepsin D and Lamp1 by 2 h post infection, whereas a significantly higher proportion of LCVs formed in permissive macrophages were positively stained for the ER markers BAP31 and calnexin, 6 h post infection. Likewise, studies by electron microscopy showed acquisition of lysosomal contents (horseradish peroxidase), within the first hour following phagocytic uptake, by LCVs formed in Birc1e/Naip5 transgenic macrophages and delivery of the ER marker glucose 6-phosphatase (G6Pase) only to the lumen of LCVs formed in A/J macrophages. Finally, a larger proportion of LCVs formed in A/J macrophages were studded with ribosomes 24 h post infection, compared with LCVs formed in Birc1e/Naip5 transgenic macrophages. These results suggest that sensing of L. pneumophila products by Birc1e/Naip5 in macrophages occurs rapidly following phagocytosis, a process that antagonizes the ability of L. pneumophila to remodel its phagosome into a specialized

  11. A Note on the Discovery of Absorption Features in 1E 1207.4-5209

    Institute of Scientific and Technical Information of China (English)

    徐仁新; 王洪光; 乔国俊

    2003-01-01

    Sanwal et al. [Astrophys. J. 574 (2002) L61] supposed that it is very difficult to interpret the absorption features in terms of cyclotron lines. However, we would like to address here that the possibility of the absorption being cyclotron resonance cannot be ruled out. We propose that the isolate neutron star, 1E 1207.4-5209 in the centre of supernova remnant PKS 1209-51/52, has a debris disc and is in a propeller phase, with an accretion rate ~ 6 × 10-11M⊙/year. In this scenario, 1E 1207.4-5209 could also be a bare strange star.

  12. MUSE Integral Field Observations of the Oxygen-rich SNR 1E 0102.2-7219

    OpenAIRE

    Seitenzahl, Ivo R.; Vogt, Frédéric P. A.; Terry, Jason P.; Dopita, Michael A.; Ruiter, Ashley J.; Ghavamian, Parviz; Sukhbold, Tuguldur

    2017-01-01

    We have observed the oxygen-rich SNR 1E 0102.2-7219 with the integral field spectrograph WiFeS at Siding Spring Observatory and discovered sulfur-rich ejecta for the first time. Follow-up deep DDT observations with MUSE on the VLT (8100 s on source) have led to the additional discovery of fast- moving hydrogen as well as argon-rich and chlorine-rich material. The detection of fast-moving hydrogen knots challenges the interpretation that the progenitor of 1E 0102 was a compact core of a Wolf-R...

  13. FOSSIL2 energy policy model documentation: FOSSIL2 documentation

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-10-01

    This report discusses the structure, derivations, assumptions, and mathematical formulation of the FOSSIL2 model. Each major facet of the model - supply/demand interactions, industry financing, and production - has been designed to parallel closely the actual cause/effect relationships determining the behavior of the United States energy system. The data base for the FOSSIL2 program is large, as is appropriate for a system dynamics simulation model. When possible, all data were obtained from sources well known to experts in the energy field. Cost and resource estimates are based on DOE data whenever possible. This report presents the FOSSIL2 model at several levels. Volumes II and III of this report list the equations that comprise the FOSSIL2 model, along with variable definitions and a cross-reference list of the model variables. Volume II provides the model equations with each of their variables defined, while Volume III lists the equations, and a one line definition for equations, in a shorter, more readable format.

  14. Text line Segmentation of Curved Document Images

    Directory of Open Access Journals (Sweden)

    Anusree.M

    2014-05-01

    Full Text Available Document image analysis has been widely used in historical and heritage studies, education and digital library. Document image analytical techniques are mainly used for improving the human readability and the OCR quality of the document. During the digitization, camera captured images contain warped document due perspective and geometric distortions. The main difficulty is text line detection in the document. Many algorithms had been proposed to address the problem of printed document text line detection, but they failed to extract text lines in curved document. This paper describes a segmentation technique that detects the curled text line in camera captured document images.

  15. 13. Project Management Documentation and Communications

    DEFF Research Database (Denmark)

    Kampf, Constance Elizabeth

    2014-01-01

    This chapter discusses the relationship between documentation and communication practices in organizational contexts.......This chapter discusses the relationship between documentation and communication practices in organizational contexts....

  16. Documentation requirements for radiation sterilization

    DEFF Research Database (Denmark)

    Miller, A.

    1995-01-01

    Several standards are recently approved or are under development by the standard organizations ISO and CEN in the field of radiation sterilization. Particularly in Europe these standards define new requirements on some issues and on other issues they emphasize the necessary documentation for appr......Several standards are recently approved or are under development by the standard organizations ISO and CEN in the field of radiation sterilization. Particularly in Europe these standards define new requirements on some issues and on other issues they emphasize the necessary documentation...... for approval of radiation sterilized products. The impact of these standards on the radiation sterilization is discussed, with special attention given to a few special issues, mainly traceability and uncertainty of measurement results....

  17. Wilmar joint market model, Documentation

    Energy Technology Data Exchange (ETDEWEB)

    Meibom, P.; Larsen, Helge V. [Risoe National Lab. (Denmark); Barth, R.; Brand, H. [IER, Univ. of Stuttgart (Germany); Weber, C.; Voll, O. [Univ. of Duisburg-Essen (Germany)

    2006-01-15

    The Wilmar Planning Tool is developed in the project Wind Power Integration in Liberalised Electricity Markets (WILMAR) supported by EU (Contract No. ENK5-CT-2002-00663). A User Shell implemented in an Excel workbook controls the Wilmar Planning Tool. All data are contained in Access databases that communicate with various sub-models through text files that are exported from or imported to the databases. The Joint Market Model (JMM) constitutes one of these sub-models. This report documents the Joint Market model (JMM). The documentation describes: 1. The file structure of the JMM. 2. The sets, parameters and variables in the JMM. 3. The equations in the JMM. 4. The looping structure in the JMM. (au)

  18. Endangered Language Documentation and Transmission

    Directory of Open Access Journals (Sweden)

    D. Victoria Rau

    2007-01-01

    Full Text Available This paper describes an on-going project on digital archiving Yami language documentation (http://www.hrelp.org/grants/projects/index.php?projid=60. We present a cross-disciplinary approach, involving computer science and applied linguistics, to document the Yami language and prepare teaching materials. Our discussion begins with an introduction to an integrated framework for archiving, processing and developing learning materials for Yami (Yang and Rau 2005, followed by a historical account of Yami language teaching, from a grammatical syllabus (Dong and Rau 2000b to a communicative syllabus using a multimedia CD as a resource (Rau et al. 2005, to the development of interactive on-line learning based on the digital archiving project. We discuss the methods used and challenges of each stage of preparing Yami teaching materials, and present a proposal for rethinking pedagogical models for e-learning.

  19. On Tangut Historical Documents Recognition*

    Science.gov (United States)

    Liu, Changqing

    As the Tangut studies have made progress, a considerable number of Tangut historical documents' copies have been published. It is of great importance to carry out digitalization and domestication of these copies. The paper firstly makes an initial processing of images by global threshold, then dissect the photocopies by scanning. Finally adopts the recognition approach of principal component analysis. The experiment shows that a better recognition can be achieved by calculation without extra time.

  20. Future of laser electrophotographic technology for color document printing

    Science.gov (United States)

    Shahin, Michael M.

    1997-04-01

    Recent years have witnessed the development of laser electrophotography as one of the major technologies for document printing, serving a wide range of market applications. With the evolution of color and market demand for color hard copy, electrophotography is again taking center stage to serve the customer need in quality, cost and convenience. Today, electrophotographic technology is used to offer products for color document printing for desktop, mid-volume and high-speed applications. Total cost of ownership, convenience and quality today favor the use of this technology over alternatives in many applications. Development of higher speed color electrophotographic engines demands very high speed, Raster Input Processors and pre-press applications that are expected to become available in the market during the next five years. This presentation will cover the changing environment of office communication and the continuing role of electrophotography in color document printing.

  1. Distributed Learning over Massive XML Documents in ELM Feature Space

    Directory of Open Access Journals (Sweden)

    Xin Bi

    2015-01-01

    Full Text Available With the exponentially increasing volume of XML data, centralized learning solutions are unable to meet the requirements of mining applications with massive training samples. In this paper, a solution to distributed learning over massive XML documents is proposed, which provides distributed conversion of XML documents into representation model in parallel based on MapReduce and a distributed learning component based on Extreme Learning Machine for mining tasks of classification or clustering. Within this framework, training samples are converted from raw XML datasets with better efficiency and information representation ability and taken to distributed learning algorithms in Extreme Learning Machine (ELM feature space. Extensive experiments are conducted on massive XML documents datasets to verify the effectiveness and efficiency for both classification and clustering applications.

  2. Review Document: Full Software Trigger

    CERN Document Server

    Albrecht, J; Raven, G

    2014-01-01

    This document presents a trigger system for the upgraded LHCb detector, scheduled to begin operation in 2020. This document serves as input for the internal review towards the "DAQ, online and trigger TDR". The proposed trigger system is implemented entirely in software. In this document we show that track reconstruction of a similar quality to that available in the offline algorithms can be performed on the full inelastic $pp$-collision rate, without prior event selections implemented in custom hardware and without relying upon a partial event reconstruction. A track nding eciency of 98.8 % relative to oine can be achieved for tracks with $p_T >$ 500 MeV/$c$. The CPU time required for this reconstruction is about 40 % of the available budget. Proof-of-principle selections are presented which demonstrate that excellent performance is achievable using an inclusive beauty trigger, in addition to exclusive beauty and charm triggers. Finally, it is shown that exclusive beauty and charm selections that do not intr...

  3. SNF AGING SYSTEM DESCRIPTION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    L.L. Swanson

    2005-04-06

    The purpose of this system description document (SDD) is to establish requirements that drive the design of the spent nuclear fuel (SNF) aging system and associated bases, which will allow the design effort to proceed. This SDD will be revised at strategic points as the design matures. This SDD identifies the requirements and describes the system design, as it currently exists, with emphasis on attributes of the design provided to meet the requirements. This SDD is an engineering tool for design control; accordingly, the primary audience and users are design engineers. This SDD is part of an iterative design process. It leads the design process with regard to the flow down of upper tier requirements onto the system. Knowledge of these requirements is essential in performing the design process. The SDD follows the design with regard to the description of the system. The description provided in the SDD reflects the current results of the design process. Throughout this SDD, the term aging cask applies to vertical site-specific casks and to horizontal aging modules. The term overpack is a vertical site-specific cask that contains a dual-purpose canister (DPC) or a disposable canister. Functional and operational requirements applicable to this system were obtained from ''Project Functional and Operational Requirements'' (F&OR) (Curry 2004 [DIRS 170557]). Other requirements that support the design process were taken from documents such as ''Project Design Criteria Document'' (PDC) (BSC 2004 [DES 171599]), ''Site Fire Hazards Analyses'' (BSC 2005 [DIRS 172174]), and ''Nuclear Safety Design Bases for License Application'' (BSC 2005 [DIRS 171512]). The documents address requirements in the ''Project Requirements Document'' (PRD) (Canori and Leitner 2003 [DIRS 166275]). This SDD includes several appendices. Appendix A is a Glossary; Appendix B is a list of key system charts

  4. NuSTAR Observations of the Magnetar 1E 2259+586

    DEFF Research Database (Denmark)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.;

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We pr...

  5. Exceptional flaring activity of the anomalous X-ray pulsar 1E 1547.0-5408

    CERN Document Server

    Savchenko, V; Beckmann, V; Produit, N; Walter, R

    2009-01-01

    (Abridged) We studied an exceptional period of activity of the anomalous X-ray pulsar 1E 1547.0-5408 in January 2009, during which about 200 bursts were detected by INTEGRAL. The major activity episode happened when the source was outside the field of view of all the INTEGRAL instruments. But we were still able to study the properties of 84 bursts detected simultaneously by the anti-coincidence shield of the spectrometer SPI and by the detector of the imager ISGRI. We find that the luminosity of the 22 January 2009 bursts of 1E 1547.0-5408 was > 1e42 erg/s. This luminosity is comparable to that of the bursts of soft gamma repeaters (SGR) and is at least two orders of magnitude larger than the luminosity of the previously reported bursts from AXPs. Similarly to the SGR bursts, the brightest bursts of 1E 1547.0-5408 consist of a short spike of ~100 ms duration with a hard spectrum, followed by a softer extended tail of 1-10 s duration, which occasionally exhibits pulsations with the source spin period of ~2 s. ...

  6. NuSTAR observations of magnetar 1e 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Hascoet, Romain; Kaspi, Victoria M.

    2013-01-01

    We report new spectral and temporal observations of the magnetar 1E 1841-045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized by a bl...

  7. Complete Genome Sequences of Legionella pneumophila subsp. fraseri Strains Detroit-1 and Dallas 1E

    Science.gov (United States)

    Raphael, Brian H.; Kozak-Muiznieks, Natalia A.; Morrison, Shatavia S.; Mercante, Jeffrey W.

    2017-01-01

    ABSTRACT We report here the complete genome sequences of two of the earliest known strains of Legionella pneumophila subsp. fraseri. Detroit-1 is serogroup 1 and was isolated from a lung biopsy specimen in 1977. Dallas 1E is serogroup 5 and was isolated in 1978 from a cooling tower. PMID:28153889

  8. The spectrum and pulses of 1E 2259+586 from ASCA and BBXRT observations

    Science.gov (United States)

    Corbet, R. H. D.; Smale, A. P.; Ozaki, M.; Koyama, K.; Iwasawa, K.

    1995-01-01

    The 7 s X-ray pulsator 1E 2259+586 was observed for approximately 1 day in 1993 with the Advanced Satellite for Cosmology and Astrophysics (ASCA). Observations were also obtained with Broad Band X-ray Telescope (BBXRT) in 1990 a few months after Ginga had observed 1E 2259+586 to be brighter than normal and the BBXRT data show 1E 2259+586 to be at an intermediate brightness level. By contrast, the ASCA data appear to have been obtained during a more common lower luminosity state. The pulse profiles we obtain are consistent with a connection between flux and pulse shape reported from Ginga data, and the pulsator continues to spin down. We use our high spectral resolution data to search for cyclotron lines in the spectrum that were claimed from observations made with other satellites. We find that the ASCA spectra of 1E 2259+586 cannot be satisfactorily fitted with either a single power law or a combination of two power laws, and that significant residuals occur around 1.5 and 5 keV. However, a combination of a power law and blackbody gives a good fit over the entire ASCA energy band with no evidence of spectral features. We have reanalyzed a Ginga LAC spectrum and find that this is also significantly better fitted by this two-component spectrum than a single power law. A possible explanation for such a two-component spectrum is that the blackbody emission comes from a neutron star and that the power-law component comes, at least in part, from a surrounding nebula. As there has, so far, no direct evidence that 1E 2259+586 is a binary system we consider whether there are other plausible mechanisms that might power the observed X-ray emission.

  9. Secure Copier Which Allows Reuse Copied Documents with Sorting Capability in Accordance with Document Types

    OpenAIRE

    Kohei Arai

    2013-01-01

    Secure copy machine which allows reuse copied documents with sorting capability in accordance with the document types. Through experiments with a variety of document types, it is found that copied documents can be shared and stored in database in accordance with automatically classified document types securely. The copied documents are protected by data hiding based on wavelet Multi Resolution Analysis: MRA.

  10. Secure Copier Which Allows Reuse Copied Documents with Sorting Capability in Accordance with Document Types

    Directory of Open Access Journals (Sweden)

    Kohei Arai

    2013-09-01

    Full Text Available Secure copy machine which allows reuse copied documents with sorting capability in accordance with the document types. Through experiments with a variety of document types, it is found that copied documents can be shared and stored in database in accordance with automatically classified document types securely. The copied documents are protected by data hiding based on wavelet Multi Resolution Analysis: MRA.

  11. Renormalized Volume

    CERN Document Server

    Gover, A Rod

    2016-01-01

    For any conformally compact manifold with hypersurface boundary we define a canonical renormalized volume functional and compute an explicit, holographic formula for the corresponding anomaly. For the special case of asymptotically Einstein manifolds, our method recovers the known results. The anomaly does not depend on any particular choice of regulator, but the coefficients of divergences do. We give explicit formulae for these divergences valid for any choice of regulating hypersurface; these should be relevant to recent studies of quantum corrections to entanglement entropies. The anomaly is expressed as a conformally invariant integral of a local Q-curvature that generalizes the Branson Q-curvature by including data of the embedding. In each dimension this canonically defines a higher dimensional generalization of the Willmore energy/rigid string action. We show that the variation of these energy functionals is exactly the obstruction to solving a singular Yamabe type problem with boundary data along the...

  12. Autonomous Rendezvous and Docking Conference, volume 3

    Science.gov (United States)

    1990-01-01

    This document consists of the presentation submitted at the Autonomous Rendezvous and Docking (ARD) Conference. The document contains three volumes: ARD hardware technology; ARD software technology; and ARD operations. The purpose of this conference is to identify the technologies required for an on orbit demonstration of ARD, assess the maturity of these technologies, and provide the necessary insight for a quality assessment of programmatic management, technical, schedule, and cost risks.

  13. Performance Concept in Buildings. Volume 1: Invited Papers. Proceedings of a Symposium Jointly Sponsored by the International Union of Testing and Research Laboratories for Materials and Structures (RILEM), the American Society for Testing and Materials (ASTM), and the International Council for Building Research Studies and Documentation (CIB) (Philadelphia, Pennsylvania, May 2-5, 1972).

    Science.gov (United States)

    Foster, Bruce E., Ed.

    Volume 1 contains all the invited papers accepted for the symposium. The subject matter covered in the papers includes physiological, anthropometrical, psychological, sociological, and economic human requirements and methods of evaluation; physical requirements and methods of evaluation in mechanical, acoustical, thermal, dimensional stability,…

  14. Documentation: Motivation and training or automation

    Science.gov (United States)

    Mouton, M. L.

    1970-01-01

    The road blocks and mental blocks in areas where automation is not taking care of basic documentation problems are discussed. Original project documentation, documentation for project maintenance, and comparison of preliminary and final documentation are described. The use of flow charts is also mentioned.

  15. Personal documentation and information system for engineers

    OpenAIRE

    Sridhar, M. S.

    1989-01-01

    Enumerates the information explosion environment and the findings of past research on information gathering patterns of engineers, presents basic concepts of documentation, information and personal documentation and information system, stresses the need for systematic management of personal documentation and information system, explains briefly the various principles, procedures and processes involved in developing and managing personal documentation and information system and concludes ...

  16. 10 CFR 55.27 - Documentation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Documentation. 55.27 Section 55.27 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) OPERATORS' LICENSES Medical Requirements § 55.27 Documentation. The... documentation to the Commission upon request. The facility licensee shall retain this documentation while...

  17. 36 CFR 219.30 - Plan documentation.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Plan documentation. 219.30... National Forest System Land and Resource Management Planning Planning Documentation § 219.30 Plan documentation. A plan is a repository of documents that integrates and displays the desired...

  18. Document Ranking Based upon Markov Chains.

    Science.gov (United States)

    Danilowicz, Czeslaw; Balinski, Jaroslaw

    2001-01-01

    Considers how the order of documents in information retrieval responses are determined and introduces a method that uses a probabilistic model of a document set where documents are regarded as states of a Markov chain and where transition probabilities are directly proportional to similarities between documents. (Author/LRW)

  19. Assessing and documenting fluid balance.

    Science.gov (United States)

    Pinnington, Sarah; Ingleby, Sarah; Hanumapura, Prasanna; Waring, Deryn

    2016-12-07

    Concerns about inadequate patient hydration and suboptimal monitoring of fluid balance have been documented in recent reports. The Fluid Balance Improvement Project at Central Manchester University Hospitals NHS Foundation Trust was undertaken to identify risk factors influencing hydration and to implement a revised process to manage these risks, resulting in the development of a hydration pathway. This new approach to monitoring patient hydration, together with staff education and support, has resulted in improved compliance with fluid balance monitoring standards, as well as significant improvements in identifying patients at risk of dehydration, and an increase in patients with acute kidney injury commencing appropriate fluid balance monitoring.

  20. Shoulder dystocia: management and documentation.

    Science.gov (United States)

    Stitely, Michael L; Gherman, Robert B

    2014-06-01

    Shoulder dystocia is an obstetric emergency that occurs when the fetal shoulders become impacted at the pelvic inlet. Management is based on performing maneuvers to alleviate this impaction. A number of protocols and training mnemonics have been developed to assist in managing shoulder dystocia when it occurs. This article reviews the evidence regarding the performance, timing, and sequence of these maneuvers; reviews the mechanism of fetal injury in relation to shoulder dystocia; and discusses issues concerning documentation of the care provided during this obstetric emergency.

  1. 15 – Document Management System Conceptions

    OpenAIRE

    Dhwanil

    2010-01-01

    Document management system is a method of organizing and storing documents electronically on one computer system or various computer systems. This system keeps track of the history of the document thereby enabling users to cognise the creation date, modification date, deletion date and other operations performed on document. Document management systems help users to easily find and share information. These systems are generally used by organizations to maintain their official records.

  2. Information architecture. Volume 4: Vision

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    The Vision document marks the transition from definition to implementation of the Department of Energy (DOE) Information Architecture Program. A description of the possibilities for the future, supported by actual experience with a process model and tool set, points toward implementation options. The directions for future information technology investments are discussed. Practical examples of how technology answers the business and information needs of the organization through coordinated and meshed data, applications, and technology architectures are related. This document is the fourth and final volume in the planned series for defining and exhibiting the DOE information architecture. The targeted scope of this document includes DOE Program Offices, field sites, contractor-operated facilities, and laboratories. This document paints a picture of how, over the next 7 years, technology may be implemented, dramatically improving the ways business is conducted at DOE. While technology is mentioned throughout this document, the vision is not about technology. The vision concerns the transition afforded by technology and the process steps to be completed to ensure alignment with business needs. This goal can be met if those directing the changing business and mission-support processes understand the capabilities afforded by architectural processes.

  3. Extractive Summarisation of Medical Documents

    Directory of Open Access Journals (Sweden)

    Abeed Sarker

    2012-09-01

    Full Text Available Background Evidence Based Medicine (EBM practice requires practitioners to extract evidence from published medical research when answering clinical queries. Due to the time-consuming nature of this practice, there is a strong motivation for systems that can automatically summarise medical documents and help practitioners find relevant information. Aim The aim of this work is to propose an automatic query-focused, extractive summarisation approach that selects informative sentences from medical documents. MethodWe use a corpus that is specifically designed for summarisation in the EBM domain. We use approximately half the corpus for deriving important statistics associated with the best possible extractive summaries. We take into account factors such as sentence position, length, sentence content, and the type of the query posed. Using the statistics from the first set, we evaluate our approach on a separate set. Evaluation of the qualities of the generated summaries is performed automatically using ROUGE, which is a popular tool for evaluating automatic summaries. Results Our summarisation approach outperforms all baselines (best baseline score: 0.1594; our score 0.1653. Further improvements are achieved when query types are taken into account. Conclusion The quality of extractive summarisation in the medical domain can be significantly improved by incorporating domain knowledge and statistics derived from a specialised corpus. Such techniques can therefore be applied for content selection in end-to-end summarisation systems.

  4. SRS ECOLOGY ENVIRONMENTAL INFORMATION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L; Doug Martin, D; Eric Nelson, E; Nancy Halverson, N; John Mayer, J; Michael Paller, M; Rodney Riley, R; Michael Serrato, M

    2006-03-01

    The SRS Ecology Environmental Information Document (EEID) provides a source of information on the ecology of Savannah River Site (SRS). The SRS is a U.S. Department of Energy (DOE)--owned property on the upper Atlantic Coastal Plain of South Carolina, centered approximately 40 kilometers (25 miles) southeast of Augusta, Georgia. The entire site was designated a National Environmental Research Park in 1972 by the Atomic Energy Commission, the predecessor of DOE. This document summarizes and synthesizes ecological research and monitoring conducted on the three main types of ecosystems found at SRS: terrestrial, wetland and aquatic. It also summarizes the available information on the threatened and endangered species found on the Savannah River Site. SRS is located along the Savannah River and encompasses an area of 80,267 hectares (310 square miles) in three South Carolina counties. It contains diverse habitats, flora, and fauna. Habitats include upland terrestrial areas, wetlands, streams, reservoirs, and the adjacent Savannah River. These diverse habitats support a variety of plants and animals, including many commercially or recreationally valuable species and several rare, threatened, or endangered species. Soils are the basic terrestrial resource, influencing the development of terrestrial biological communities. Many different soils exist on the SRS, from hydric to well-drained, and from sand to clay. In general, SRS soils are predominantly well-drained loamy sands.

  5. Areva reference document 2007; Areva document de reference 2007

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains also information on the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the reference document and persons responsible for auditing the financial statements; 2 - Information pertaining to the transaction (not applicable); 3 - General information on the company and its share capital: Information on Areva, Information on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; 4 - Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts 140 Principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and Development programs, Intellectual Property and Trademarks, Risk and insurance; 5 - Assets financial position financial performance: Analysis of and comments on the group's financial position and performance, Human Resources report, Environmental report, Consolidated financial statements 2007, Notes to the consolidated financial statements, Annual financial statements 2007, Notes to the corporate financial statements; 6 - Corporate governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Ordinary General Meeting of Shareholders of April 17, 2008; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2007, Outlook; Glossary; table of

  6. Areva, reference document 2006; Areva, document de reference 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains information on the markets, market shares and competitive position of the AREVA group. Content: - 1 Person responsible for the reference document and persons responsible for auditing the financial statements; - 2 Information pertaining to the transaction (Not applicable); - 3 General information on the company and its share capital: Information on AREVA, on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; - 4 Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts, The principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and development programs, intellectual property and trademarks, Risk and insurance; - 5 Assets - Financial position - Financial performance: Analysis of and comments on the group's financial position and performance, 2006 Human Resources Report, Environmental Report, Consolidated financial statements, Notes to the consolidated financial statements, AREVA SA financial statements, Notes to the corporate financial statements; 6 - Corporate Governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Combined General Meeting of Shareholders of May 3, 2007; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2006, Outlook; 8 - Glossary; 9 - Table of concordance.

  7. Converting environmental documentation to management information

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, M.J.; Frentz, H.J.

    1996-05-01

    The growth of environmental, health, and safety regulations and their reporting requirements has been extraordinary. Penalties for missteps in environmental documentation also grow more serious. Every major piece of environmental legislation requires facilities to collect data and maintain records, in many cases detailed records for long periods of time, on raw materials, processes, emissions, events, personnel, and many other facets of business operations. Unfortunately, for some organizations, the collection of data that satisfies regulatory requirements is an end in itself. Data acquired in this manner may result in little useful information that managers can use to foster their business goals. For organizations of any appreciable size, the volume of environmental data, in manual form, makes analysis difficult to impossible. For example, in 1993 a Fortune 50 chemical manufacturer with a superior environmental program received a notice from the Center for Disease Control that working with sulfuric acid might carry a risk of occupational cancer. Senior environmental managers posed the question, {open_quotes}Where in our facilities do we use sulfuric acid?{close_quotes} Two industrial hygienists spent six weeks researching the question. When they finished, they could state unequivocally where the material was used, but they could not say how much was being used, or who was routinely or occasionally exposed to the material or at what levels. The information was available, but not accessible and not in a useable format.

  8. A comparison of Fisher vectors and Gaussian supervectors for document versus non-document image classification

    Science.gov (United States)

    Smith, David C.; Kornelson, Keri A.

    2013-09-01

    This research addresses the document vs. non-document image classification problem. The ability to select images containing text from an OCR processing stream that also includes images of scenes, people, faces, etc., will eliminate unnecessary computation and free up valuable computer resources for other tasks. This is particularly true for high volume OCR systems. Fisher vectors represent images as gradients of a global generative Gaussian Mixture Model (GMM) of low level image descriptors, and exhibit state-of-the-art performance for object categorization. Gaussian supervectors represent images by soft clustering low level image descriptors according to posterior GMM mixture probabilities, optionally using MAP adaptation, and have demonstrated state-of-the-art performance for scene categorization. We compare results obtained by applying linear SVMs to Fisher vector and Gaussian supervector representations to categorize images as having only text, no text, or a mixture of text and non-text. We also report the performance of GMM-based soft versions of vectors of locally aggregated descriptors (VLAD) and Bag of Visual words (BOV).

  9. Collected software engineering papers, volume 11

    Science.gov (United States)

    1993-01-01

    This document is a collection of selected technical papers produced by participants in the Software Engineering Laboratory (SEL) from November 1992 through November 1993. The purpose of the document is to make available, in one reference, some results of SEL research that originally appeared in a number of different forums. This is the 11th such volume of technical papers produced by the SEL. Although these papers cover several topics related to software engineering, they do not encompass the entire scope of SEL activities and interests. Additional information about the SEL and its research efforts may be obtained from the sources listed in the bibliography at the end of this document.

  10. Collected software engineering papers, volume 12

    Science.gov (United States)

    1994-01-01

    This document is a collection of selected technical papers produced by participants in the Software Engineering Laboratory (SEL) from November 1993 through October 1994. The purpose of the document is to make available, in one reference, some results of SEL research that originally appeared in a number of different forums. This is the 12th such volume of technical papers produced by the SEL. Although these papers cover several topics related to software engineering, they do not encompass the entire scope of SEL activities and interests. Additional information about the SEL and its research efforts may be obtained from the sources listed in the bibliography at the end of this document.

  11. Suzaku Studies of the Supernova Remnant CTB~109 Hosting the Magnetar 1E~2259+586

    CERN Document Server

    Nakano, Toshio; Hiraga, Junoko S; Uchiyama, Hideki; Kaneda, Hidehiro; Enoto, Teruaki

    2015-01-01

    Ages of the magnetar 1E 2259+586 and the associated supernova remnant CTB~109 were studied. Analyzing the Suzaku data of CTB~109, its age was estimated to be $\\sim$14~kyr, which is much shorter than the measured characteristic age of 1E 2259+586, 230 kyr. This reconfirms the previously reported age discrepancy of this magnetar/remnant association, and suggests that the characteristic ages of magnetars are generally over-estimated as compared to their true ages. This discrepancy is thought to arise because the former are calculated without considering decay of the magnetic fields. This novel view is supported independently by much stronger Galactic-plane concentration of magnetars than other pulsars. The process of magnetic field decay in magnetars is mathematically modeled. It is implied that magnetars are much younger objects than previously considered, and can dominate new-born neutron stars.

  12. Possible NIR counterpart to the AXP 1E 1547.0-5408

    Science.gov (United States)

    Mignani, R. P.; Rea, N.; Israel, G. L.; Testa, V.; Esposito, P.

    2008-10-01

    On 2008 October 3rd, Swift-BAT triggered on several short bursts from the direction of the Anomalous X-ray Pulsar (AXP) 1E1547.0-5408 (Krimm et al. GCN 8311, 8312; Rea et al. Atel #1756). This is the second known transient radio AXP discovered to date (Gelfand & Gaensler 2007; Camilo et al. 2007), and it showed the previous X-ray outburst around June 2007 (Halpern et al. 2008). During the decay of the 2007 X-ray outburst we observed 1E 1547.0-5408 in the Ks band (on 2007 July 8th, 12th, and August 17th) with the NAOS -CONICA (NACO) instrument mounted at the ESO- VLT (Mignani, Rea, Testa, et al., 2008 submitted).

  13. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    Science.gov (United States)

    D'Aì, A.; Evans, P. A.; Burrows, D. N.; Kuin, N. P. M.; Kann, D. A.; Campana, S.; Maselli, A.; Romano, P.; Cusumano, G.; La Parola, V.; Barthelmy, S. D.; Beardmore, A. P.; Cenko, S. B.; De Pasquale, M.; Gehrels, N.; Greiner, J.; Kennea, J. A.; Klose, S.; Melandri, A.; Nousek, J. A.; Osborne, J. P.; Palmer, D. M.; Sbarufatti, B.; Schady, P.; Siegel, M. H.; Tagliaferri, G.; Yates, R.; Zane, S.

    2016-12-01

    We report on the detection of a bright, short, structured X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the Swift/Burst Alert Telescope (BAT) monitor, and on the follow-up campaign made with Swift/X-ray Telescope, Swift/UV/Optical Telescope, and the optical/near-infrared (NIR) Gamma-Ray burst Optical and Near-infrared Detector. The characteristics of this flash, such as duration and spectral shape, are consistent with typical short bursts observed from soft gamma repeaters. The BAT error circle at 68 per cent confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated due to a periodicity of 6.67 h in X-rays, which could indicate either an extremely slow pulsating neutron star, or the orbital period of a very compact X-ray binary system. We found that 20 min before the BAT trigger, the soft X-ray emission of 1E 161348-5055 was a factor of ˜100 higher than measured 2 yr earlier, indicating that an outburst had already started. By comparing the spectral and timing characteristics of the source in the 2 yr before the outburst and after the BAT event, we find that, besides a change in luminosity and spectral shape, also the 6.67 h pulsed profile has significantly changed with a clear phase shift with respect to its low-flux profile. The UV/optical/NIR observations did not reveal any counterpart at the position of 1E 161348-5055. Based on these findings, we associate the BAT burst with 1E 161348-5055, we classify it as a magnetar, and pinpoint the 6.67 h periodicity as the magnetar spin period.

  14. Phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains identified in China

    Institute of Scientific and Technical Information of China (English)

    赵璇

    2014-01-01

    Objective To understand the phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from different provinces in China during the last 50 years.Methods Traditional biotyping testings including susceptibility to polymyxin B,sensitivity to groupⅣphage,Voges-Proskauer test and haemolysis of sheep erythrocytes were conducted.Results Data from Biotype-specific phenotype analysis revealed that only 133 isolates carried the typical E1 Tor phenotypes while the other 251

  15. "5M1E"法在生产管理中的运用

    Institute of Scientific and Technical Information of China (English)

    刘秋香

    2010-01-01

    人(man)、机械(machine)、材料(material)、方法(method)、环境(enviroment)、管理(manage)这几个主要环节实行全面质量管理,称为"5M1E"法.在生产管理中应用该法,可以达到提升人品质、提升产品品质,提高员工士气.

  16. VizieR Online Data Catalog: MAGIC map of 1E 2259+586 (Aleksic+, 2013)

    Science.gov (United States)

    Aleksic, J.; Antonelli, L. A.; Antoranz, P.; Asensio, M.; Barres de Almeida, U.; Barrio, J. A.; Becerra Gonzalez, J.; Bednarek, W.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Bretz, T.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Caneva, G.; de Cea Del Pozo, E.; de Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Dominis Prester, D.; Dorner, D.; Doro, M.; Eisenacher, D.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Garcia Lopez, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giavitto, G.; Godinovic, N.; Gonzalez Munoz, A.; Gozzini, S. R.; Hadamek, A.; Hadasch, D.; Hafner, D.; Herrero, A.; Hose, J.; Hrupec, D.; Huber, B.; Jankowski, F.; Jogler, T.; Kadenius, V.; Klepser, S.; Knoetig, M. L.; Krahenbuhl, T.; Krause, J.; Kushida, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lewandowska, N.; Lindfors, E.; Lombardi, S.; Lopez, M.; Lopez-Coto, R.; Lopez-Oramas, A.; L Orenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martinez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Moldon, J.; Moralejo, A.; Munar-Adrover, P.; Niedzwiecki, A.; Nieto, D.; Nilsson, K.; Nowak, N.; Orito, R.; Paiano, S.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Partini, S.; Persic, M.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribo, M.; Rico, J.; Rugamer, S.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Saggion, A.; Schweizer, T.; Shore, S. N.; Sillanpaa, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamatescu, V.; Stamerra, A.; Steinke, B.; Storz, J.; Sun, S.; Suric, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzic, T.; Tescaro, D.; Teshima, M.; Tibolla, O.; Torres, D. F.; Toyama, T.; Treves, A.; Uellenbeck, M.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.; Rea, N.

    2012-11-01

    We observed the two sources with atmospheric Cherenkov telescopes in the very high energy range (E>100GeV). 4U 0142+61 was observed with the MAGIC I telescope in 2008 for ~25h and 1E 2259+586 was observed with the MAGIC stereoscopic system in 2010 for ~14h. The data were analyzed with the standard MAGIC analysis software. (3 data files).

  17. Security 1E10 anti-idiotypic vaccine in patients with tumors of different locations

    Directory of Open Access Journals (Sweden)

    Carmen Viada

    2016-02-01

    Full Text Available Cancer is a leading cause of death in Cuba and the world. Lung cancer is the leading cause of death, breast cancer is the second leading cause of death and colorectal cancer is the third leading cause of death. The 1E10 anti-idiotype vaccine is a new immunotherapeutic agent, registered for lung cancer by the Center for Molecular Immunology (CIM. You want to evaluate the safety of this vaccine in the treatment of various cancer sites. To determine the safety adverse events occurred in six clinical trials (one stage I lung, 3 phase II in breast, colon and lung, 1 phase II-III and program expanded use, both in lung were evaluated. 656 patients were studied. Demographic variables, the characteristics of the disease and adverse events were measured. The studies were balanced with respect to baseline characteristics. The most common adverse events were local reactions associated with 1E10 anti-idiotype vaccine and systemic reactions of mild or moderate intensity that were not related to the administration of the vaccine under study. The 1E10 anti-idiotype vaccine is safe for the low frequency and intensity of adverse events reported.

  18. HST and VLT observations of the neutron star 1E 1207.4-5209

    CERN Document Server

    De Luca, A; Sartori, A; Hummel, W; Caraveo, P A; Mereghetti, S; Bignami, G F

    2010-01-01

    1E 1207.4-5209, the peculiar Central Compact object in the G296.5+10.0 supernova remnant, has been proposed to be an "anti-magnetar" - a young neutron star born with a weak dipole field. Accretion, possibly of supernova fallback material, has also been invoked to explain a large surface temperature anisotropy as well as the generation of peculiar cyclotron absorption features superimposed to its thermal spectrum. Interestingly enough, a faint optical/infrared source was proposed as a possible counterpart to 1E 1207.4-5209, but later questioned, based on coarse positional coincidence. Considering the large offset of 1E 1207.4-5209 with respect to the center of its host supernova remnant, the source should move at ~70 mas/yr. Thus, we tested the association by measuring the proper motion of the proposed optical counterpart. Using HST observations spanning 3.75 years, we computed a 3 sigma upper limit of 7 mas/yr. Absolute astrometry on the same HST data set also places the optical source significantly off the 9...

  19. A Mid-Infrared Counterpart to the Magnetar 1E 2259+586

    CERN Document Server

    Kaplan, David L; Wang, Zhongxiang; Wachter, Stefanie

    2009-01-01

    We report the discovery of a 4.5 um counterpart to the anomalous X-ray pulsar (magnetar) 1E 2259+586 with the Spitzer Space Telescope. The mid-infrared flux density is 6.3+/-1.0 uJy at 4.5 um and <20 uJy (at 95% confidence) at 8 um, or 0.02% of the 2-10 keV X-ray flux (corrected for extinction). Combining our Spitzer measurements with previously published near-infrared data, we show that the overall infrared emission from 1E 2259+586 is qualitatively similar to that from the magnetar 4U 0142+61. Therefore the passive X-ray-heated dust disk model originally developed for 4U 0142+61 might also apply to 1E 2259+586. However, the IR data from this source can also be fitted by a simple power-law spectrum as might be expected from magnetospheric emission.

  20. Document image representation using XML technologies

    Science.gov (United States)

    El-Kwae, Essam A.; Atmakuri, Kusuma H.

    2001-12-01

    Electronic documents have gained wide acceptance due to the ease of editing and sharing of information. However, paper documents are still widely used in many environments. Moving into a paperless and distributed office has become a major goal for document image research. A new approach for form document representation is presented. This approach allows for electronic document sharing over the World Wide Web (WWW) using Extensible Markup Language (XML) technologies. Each document is mapped into three different views, an XML view to represent the preprinted and filled-in data, an XSL (Extensible style Sheets) view to represent the structure of the document, and a DTD (Document Type Definition) view to represent the document grammar and field constraints. The XML and XSL views are generated from a document template, either automatically using image processing techniques, or semi-automatically with minimal user interaction. The DTD representation may be fixed for general documents or may be generated semi-automatically by mining a number of filled-in document examples. Document templates need to be entered once to create the proposed representation. Afterwards, documents may be displayed, updated, or shared over the web. The merits of this approach are demonstrated using a number of examples of widely used forms.

  1. Ce que permet le document

    OpenAIRE

    2012-01-01

    Avec l’archive, à laquelle il est souvent associé, le document occupe une place centrale dans les expositions comme dans les publications actuelles sur l’art contemporain. Les présents ouvrages n’ont pas pour objectif d’apporter un éclairage à ce vaste tournant mnémonique qui semble s’emparer des pratiques et des discours sur l’art depuis le début de ce troisième millénaire, même si les contributions de certains de leurs auteurs pointent des éléments conjoncturels (l’après 11 septembre) ou te...

  2. PSP Program close out documentation

    Energy Technology Data Exchange (ETDEWEB)

    Andringa, K.; Hootman, H.E.; Ferrara, A.S.; Smith, P.K.; Congdon, J.W.; Randolph, H.W.; Young, R.H.; Driggers, F.E.; Topp, S.V.

    1985-12-31

    In December 1982 DOE-SR directed SRL to study the feasibility and impact of a program to lower the U-236 content of the Highly Enriched Uranium (HEU) stockpile used as fuel for the SRP reactors. In response to this request SRL assessed four technologies, Atomic Vapor Laser Isotope Separation (AVLIS), Molecular Laser Isotope Separation (MLIS), Gas Centrifuge, and the Plasma Separation Process (PSP) for this purpose with the assistance of the Engineering Department. In April 1983 cost/benefit analyses for these processes, high spot cost estimates for production facilities, and process uncertainties were submitted to DOE-SR with a recommendation to proceed with the conceptual design and supporting development programs for a facility based on the use of the PSP process. The current program status for the PSP development program at SRL and the design and documentation of a production facility at SRP, referred to as the Fuel Improvement Demonstration Facility (FIDF), is described in this report.

  3. 1992 Conversion Resources Supply Document

    Energy Technology Data Exchange (ETDEWEB)

    1992-03-01

    In recent years conservation of electric power has become an integral part of utility planning. The 1980 Pacific Northwest Electric Power Planning and Conservation Act (Northwest Power Act) requires that the region consider conservation potential in planning acquisitions of resources to meet load growth. The Bonneville Power Administration (BPA) developed its first estimates of conservation potential in 1982. Since that time BPA has updated its conservation supply analyses as a part of its Resource Program and other planning efforts. Major updates were published in 1985 and in January 1990. This 1992 document presents updated supply curves, which are estimates of the savings potential over time (cumulative savings) at different cost levels of energy conservation measures (ECMs). ECMs are devices, pieces of equipment, or actions that increase the efficiency of electricity use and reduce the amount of electricity used by end-use equipment.

  4. PORFLOW TESTING AND VERIFICATION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    Aleman, S

    2007-06-18

    The PORFLOW software package is a comprehensive mathematical model for simulation of multi-phase fluid flow, heat transfer and mass transport in variably saturated porous and fractured media. PORFLOW can simulate transient or steady-state problems in Cartesian or cylindrical geometry. The porous medium may be anisotropic and heterogeneous and may contain discrete fractures or boreholes with the porous matrix. The theoretical models within the code provide a unified treatment of concepts relevant to fluid flow and transport. The main features of PORFLOW that are relevant to Performance Assessment modeling at the Savannah River National Laboratory (SRNL) include variably saturated flow and transport of parent and progeny radionuclides. This document involves testing a relevant sample of problems in PORFLOW and comparing the outcome of the simulations to analytical solutions or other commercial codes. The testing consists of the following four groups. Group 1: Groundwater Flow; Group 2: Contaminant Transport; Group 3: Numerical Dispersion; and Group 4: Keyword Commands.

  5. Managing Very Large Document Collections Using Semantics

    Institute of Scientific and Technical Information of China (English)

    WANG GuoRen(王国仁); LU HongJun(陆宏钧); YU Ge(于戈); BAO YuBin(鲍玉斌)

    2003-01-01

    In this paper, a system is presented where documents are no longer identified bytheir file names. Instead, a document is represented by its semantics in terms of descriptor andcontent vector. The descriptor of a document consists of a set of attributes, such as date of creation,its type, its size, annotations, etc. The content vector of a document consists of a set of termsextracted from the document. In this paper, a semantic document management system XBASEis designed and implemented based on the semantics and the functions of three main modules,X-Loader, X-Explorer and X-Query.

  6. Associations Between Biomarkers and Age in the Presenilin 1 E280A Autosomal Dominant Alzheimer Disease Kindred A Cross-sectional Study

    Science.gov (United States)

    Fleisher, Adam S.; Chen, Kewei; Quiroz, Yakeel T.; Jakimovich, Laura J.; Gomez, Madelyn Gutierrez; Langois, Carolyn M.; Langbaum, Jessica B. S.; Roontiva, Auttawut; Thiyyagura, Pradeep; Lee, Wendy; Ayutyanont, Napatkamon; Lopez, Liliana; Moreno, Sonia; Muñoz, Claudia; Tirado, Victoria; Acosta-Baena, Natalia; Fagan, Anne M.; Giraldo, Margarita; Garcia, Gloria; Huentelman, Matthew J.; Tariot, Pierre N.; Lopera, Francisco; Reiman, Eric M.

    2015-01-01

    IMPORTANCE Age-associated changes in brain imaging and fluid biomarkers are characterized and compared in presenilin 1 (PSEN1) E280A mutation carriers and noncarriers from the world’s largest known autosomal dominant Alzheimer disease (AD) kindred. OBJECTIVE To characterize and compare age-associated changes in brain imaging and fluid biomarkers in PSEN1 E280A mutation carriers and noncarriers. DESIGN, SETTING, AND PARTICIPANTS Cross-sectional measures of 18F-florbetapir positron emission tomography, 18F-fludeoxyglucose positron emission tomography, structural magnetic resonance imaging, cerebrospinal fluid (CSF), and plasma biomarkers of AD were assessed from 54 PSEN1 E280A kindred members (age range, 20-59 years). MAIN OUTCOMES AND MEASURES We used brain mapping algorithms to compare regional cerebral metabolic rates for glucose and gray matter volumes in cognitively unimpaired mutation carriers and noncarriers. We used regression analyses to characterize associations between age and the mean cortical to pontine 18F-florbetapir standard uptake value ratios, precuneus cerebral metabolic rates for glucose, hippocampal gray matter volume, CSF Aβ1-42, total tau and phosphorylated tau181, and plasma Aβ measurements. Age at onset of progressive biomarker changes that distinguish carriers from noncarriers was estimated using best-fitting regression models. RESULTS Compared with noncarriers, cognitively unimpaired mutation carriers had significantly lower precuneus cerebral metabolic rates for glucose, smaller hippocampal volume, lower CSF Aβ1-42, higher CSF total tau and phosphorylated tau181, and higher plasma Aβ1-42 measurements. Sequential changes in biomarkers were seen at age 20 years (95% CI, 14-24 years) for CSF Aβ1-42, age 16 years (95% CI, 11-24 years) for the mean cortical 18F-florbetapir standard uptake value ratio, age 15 years (95% CI, 10-24 years) for precuneus cerebral metabolic rate for glucose, age 15 years (95% CI, 7-20 years) for CSF total tau

  7. Reactor operation environmental information document

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L.D.; Specht, W.L.; Mackey, H.E.; Paller, M.H.; Wilde, E.W.; Dicks, A.S.

    1989-12-01

    The Savannah River Site (SRS) is a large United States Department of Energy installation on the upper Atlantic Coastal Plain of South Carolina. The SRS contains diverse habitats, flora, and fauna. Habitats include upland terrestrial areas, varied wetlands including Carolina Bays, the Savannah River swamp system, and impoundment related and riparian wetlands, and the aquatic habitats of several stream systems, two large cooling reservoirs, and the Savannah River. These diverse habitats support a large variety of plants and animals including many commercially or recreational valuable species and several rare, threatened or endangered species. This volume describes the major habitats and their biota found on the SRS, and discuss the impacts of continued operation of the K, L, and P production reactors.

  8. Information Types in Nonmimetic Documents: A Review of Biddle's Wipe-Clean Slate (Understanding Documents).

    Science.gov (United States)

    Mosenthal, Peter B.; Kirsch, Irwin S.

    1991-01-01

    Describes how the 16 permanent lists used by a first grade reading teacher (and mother of 6) to manage the household represents the whole range of documents covered in the 3 major types of documents: matrix documents, graphic documents, and locative documents. Suggests class activities to clarify students' understanding of the information in…

  9. Volumes and doses for external radiotherapy - Definitions and recommendations; Volum og doser i ekstern straaleterapi - Definisjoner og anbefalinger

    Energy Technology Data Exchange (ETDEWEB)

    Levernes, Sverre (ed.)

    2012-07-01

    The report contains definitions of volume and dose parameters for external radiotherapy. In addition the report contains recommendations for use, documentation and minimum reporting for radiotherapy of the individual patient.(Author)

  10. Universal Documentation System Handbook. Volume 2. Requirement Formats and Instructions, Program Introduction, Program Requirements Document/Operations Requirements.

    Science.gov (United States)

    1989-08-01

    Follow the preparation instructi ns for Format 1000. SUPPLEM: Follow the preparation instructia for Format 1000. TEST CIDE : FOllw the preparation...AGENCY: SUB-ITEM TESI CODE NOTE CAP TERMINATION LOCATIONS NOTES: RESPONSIBLE AGENCY: SUB-ITEM TEST CODE NOTE CAP TERMINATION LOCATIONS NOTES: * PAGE

  11. Transportation Cluster Volume 3 [Small Power Sources].

    Science.gov (United States)

    Pennsylvania State Dept. of Justice, Harrisburg. Bureau of Correction.

    The document is one of seven volumes of instructional materials developed around a cluster of Transportation Industries. Primarily technical in focus, they are designed to be used in a cluster-concept program and to integrate with a regular General Education Development (G.E.D.) program so that students may attain an employable skill level and a…

  12. Ways to Environmental Education, Volume III.

    Science.gov (United States)

    Allen, Rodney F., Ed.; And Others

    Ten environmental education booklets presented in this document are the third volume of the environmental series developed by community groups around the Tallahassee Junior Museum and its Pioneer Farm. The first three booklets present an overview of the museum and of the various education programs and activities offered for students at the museum…

  13. Electronic Document Management Using Inverted Files System

    Science.gov (United States)

    Suhartono, Derwin; Setiawan, Erwin; Irwanto, Djon

    2014-03-01

    The amount of documents increases so fast. Those documents exist not only in a paper based but also in an electronic based. It can be seen from the data sample taken by the SpringerLink publisher in 2010, which showed an increase in the number of digital document collections from 2003 to mid of 2010. Then, how to manage them well becomes an important need. This paper describes a new method in managing documents called as inverted files system. Related with the electronic based document, the inverted files system will closely used in term of its usage to document so that it can be searched over the Internet using the Search Engine. It can improve document search mechanism and document save mechanism.

  14. Utility Energy Services Contracts: Enabling Documents

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-05-01

    Utility Energy Services Contracts: Enabling Documents provides materials that clarify the authority for Federal agencies to enter into utility energy services contracts (UESCs), as well as sample documents and resources to ease utility partnership contracting.

  15. Document organization by means of graphs

    Directory of Open Access Journals (Sweden)

    Santa Vallejo Figueroa

    2016-12-01

    Full Text Available Nowadays documents are the main way to represent information and knowledge in several domains. Continuously users store documents in hard disk or online media according to some personal organization based on topics, but such documents can contain one or more topics. This situation makes hard to access documents when is required. The current search engines are based on the name of file or content, but where the desired term or terms must match exactly as are in the content. In this paper, a method for organize documents by means of graphs is proposed, taking into account the topics of the documents. For this a graph for each document is generated taking into account synonyms, semantic related terms, hyponyms, and hypernyms of nouns and verbs contained in documents. The proposal have been compares against Google Desktop and LogicalDoc with interesting results.

  16. ODQ: A Fluid Office Document Query Language

    Directory of Open Access Journals (Sweden)

    Xuhong Liu

    2015-06-01

    Full Text Available Fluid office documents, as semi-structured data often represented by Extensible Markup Language (XML are important parts of Big Data. These office documents have different formats, and their matching Application Programming Interfaces (APIs depend on developing platform and versions, which causes difficulty in custom development and information retrieval from them. To solve this problem, we have been developing an office document query (ODQ language which provides a uniform method to retrieve content from documents with different formats and versions. ODQ builds common document model ontology to conceal the format details of documents and provides a uniform operation interface to handle office documents with different formats. The results show that ODQ has advantages in format independence, and can facilitate users in developing documents processing systems with good interoperability.

  17. 23 CFR 774.7 - Documentation.

    Science.gov (United States)

    2010-04-01

    ..., WILDLIFE AND WATERFOWL REFUGES, AND HISTORIC SITES (SECTION 4(F)) § 774.7 Documentation. (a) A Section 4(f... that causes the least overall harm in accordance with § 774.3(c). This analysis must be documented in...

  18. Integrating Primary Source Documents into the Classroom.

    Science.gov (United States)

    Logan, Linda

    1999-01-01

    Addresses the introduction of primary sources to students, discusses analyzing a primary source document, and provides two example primary accounts. Offers ideas for accessing primary source documents and includes a bibliography for further reading. (CMK)

  19. A System for Information Documentation and Control

    Science.gov (United States)

    Klinger, Dennis M.; Taggart, William M. Jr.

    1974-01-01

    Southeast Regional Data Center (SERDAC) has an operational Information Documentation and Control System that provides the documentation and control necessary for SERDAC to implement an organizational data base to support its many applications. (Author)

  20. The Vicinity of Program Documentation Tools

    DEFF Research Database (Denmark)

    Nørmark, Kurt

    Program documentation plays a vital role in almost all programming processes.  Program documentation flows between separate tools of a modularized environment, and in between the components of an integrated development environment as well.  In this paper we discuss the flow of program documentation...... between program development tools.  In the central part of the paper we introduce a mapping of documentation flow between program development tools.  In addition we discuss a set of locally developed tools which is related to program documentation.  The use of test cases as examples in an interface...... documentation tool is a noteworthy and valuable contribution to the documentation flow.  As an additional contribution we identify several circular relationships which illustrate feedback of documentation to the program editor from other tools in the development environment....

  1. The documentation practice of perioperative nurses

    DEFF Research Database (Denmark)

    Søndergaard, Susanne Friis; Lorentzen, Vibeke; Sørensen, Erik Elgaard;

    2016-01-01

    AIMS AND OBJECTIVE: The aim of this review was to explore and present the existing knowledge of the documentation practices of perioperative nurses in the operating room. BACKGROUND: Studies demonstrate that the documentation of nursing care provided is important for the continuity of patient care...... as well as patient safety. Nurses find that documenting their perioperative services is important to the surgical pathway; however, a number of studies indicate that the documentation practices of perioperative nurses are characterised by subjectivity, randomness and poor quality. DESIGN: A literature....... RESULTS: Three general themes were found to be important for perioperative nurses' documentation practices. 1) The documentation tool must be adapted to the clinical practice. 2) Nurses document to improve patient safety and protect themselves legally. 3) Traditions and conditions for documentation...

  2. Electronic Document Management Using Inverted Files System

    Directory of Open Access Journals (Sweden)

    Suhartono Derwin

    2014-03-01

    Full Text Available The amount of documents increases so fast. Those documents exist not only in a paper based but also in an electronic based. It can be seen from the data sample taken by the SpringerLink publisher in 2010, which showed an increase in the number of digital document collections from 2003 to mid of 2010. Then, how to manage them well becomes an important need. This paper describes a new method in managing documents called as inverted files system. Related with the electronic based document, the inverted files system will closely used in term of its usage to document so that it can be searched over the Internet using the Search Engine. It can improve document search mechanism and document save mechanism.

  3. 22 CFR 42.65 - Supporting documents.

    Science.gov (United States)

    2010-04-01

    ... evidence attached to the visa. (e) Authenticity of records and documents. If the consular officer has... necessary to determine its authenticity or to ascertain the facts to which the record or document...

  4. A Unified Format for Language Documents

    NARCIS (Netherlands)

    Zaytsev, V.; Lämmel, R.; Brand, M.G.J. van den; Malloy, B.; Staab, S.

    2010-01-01

    We have analyzed a substantial number of language documentation artifacts, including language standards, language specifications, language reference manuals, as well as internal documents of standardization bodies. We have reverse-engineered their intended internal structure, and compared th

  5. Document watermarking based on digital holographic principle

    CERN Document Server

    Kim, Chol-Su; Im, Song-Jin

    2013-01-01

    A new method for document watermarking based on the digital Fourier hologram is proposed. It applies the methods of digital image watermarking based on holographic principle presented previously in several papers into printed documents. Experimental results show that the proposed method can not only meet the demand on invisibility, robustness and non-reproducibility of the document watermark, and but also has other advantages compared with the conventional methods for document securities such as embossed hologram, Lippmann photograph and halftone modulation.

  6. EASIER ACCESS TO STANDARDS DOCUMENTATION

    CERN Multimedia

    2001-01-01

    Many organizations issuing standards offer reduced prices for publications to their members. Paying a membership fee, even a site membership fee, can therefore be worthwhile - even if relatively few standards are needed. The Library is now exploring the possibility, in collaboration with the rest of the CERN community, of joining standards-issuing organizations. So why not share your costs with the rest of the organization wherever this can be done without violating copyright or access regulations? The Library now provides documentation and other member services from IPC, the Association Connecting Electronics Industries (http://www.ipc.org/html/fsabout.htm) at favourable prices for the entire CERN population. For more information, or if you are a member of any other organization which provides services which could be shared CERN-wide, please contact library.desk@cern.ch . We remind all users of international standards, that CERN has special agreements with ISO and IEC (see Bulletin 50/2000). You can order st...

  7. Real institution: Document and realism

    Directory of Open Access Journals (Sweden)

    Bojanić Petar

    2014-01-01

    Full Text Available Regardless of the fact that I am using certain texts by Searle, Ferraris, Smith and De Soto, my intention is not at all to reiterate someone else’s position in my own words, nor is it to question or modify some such position. My intention for now is to, using Ferraris’ theory of the document, affirm the existence of a paradox - one rejected by Searle, but unconvincingly so, I think - regarding the institution (or the institutionalization of the institution. In order to do that, it seems to me that I am forced to slightly disturb both Searle’s and Ferraris’ conception, in attempting to offer my own contribution to a new future theory of the institution. [Projekat Ministarstva nauke Republike Srbije, br. 43007: Istrаživаnje uticaja klimаtskih promenа nа životnu sredinu: prаćenje uticаjа, аdаptаcijа i ublаžаvаnje

  8. SURFACE GEOPHYSICAL EXPLORATION - COMPENDIUM DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    RUCKER DF; MYERS DA

    2011-10-04

    This report documents the evolution of the surface geophysical exploration (SGE) program and highlights some of the most recent successes in imaging conductive targets related to past leaks within and around Hanford's tank farms. While it is noted that the SGE program consists of multiple geophysical techniques designed to (1) locate near surface infrastructure that may interfere with (2) subsurface plume mapping, the report will focus primarily on electrical resistivity acquisition and processing for plume mapping. Due to the interferences from the near surface piping network, tanks, fences, wells, etc., the results of the three-dimensional (3D) reconstruction of electrical resistivity was more representative of metal than the high ionic strength plumes. Since the first deployment, the focus of the SGE program has been to acquire and model the best electrical resistivity data that minimizes the influence of buried metal objects. Toward that goal, two significant advances have occurred: (1) using the infrastructure directly in the acquisition campaign and (2) placement of electrodes beneath the infrastructure. The direct use of infrastructure was successfully demonstrated at T farm by using wells as long electrodes (Rucker et al., 2010, 'Electrical-Resistivity Characterization of an Industrial Site Using Long Electrodes'). While the method was capable of finding targets related to past releases, a loss of vertical resolution was the trade-off. The burying of electrodes below the infrastructure helped to increase the vertical resolution, as long as a sufficient number of electrodes are available for the acquisition campaign.

  9. Consumer Vehicle Choice Model Documentation

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Changzheng [ORNL; Greene, David L [ORNL

    2012-08-01

    In response to the Fuel Economy and Greenhouse Gas (GHG) emissions standards, automobile manufacturers will need to adopt new technologies to improve the fuel economy of their vehicles and to reduce the overall GHG emissions of their fleets. The U.S. Environmental Protection Agency (EPA) has developed the Optimization Model for reducing GHGs from Automobiles (OMEGA) to estimate the costs and benefits of meeting GHG emission standards through different technology packages. However, the model does not simulate the impact that increased technology costs will have on vehicle sales or on consumer surplus. As the model documentation states, “While OMEGA incorporates functions which generally minimize the cost of meeting a specified carbon dioxide (CO2) target, it is not an economic simulation model which adjusts vehicle sales in response to the cost of the technology added to each vehicle.” Changes in the mix of vehicles sold, caused by the costs and benefits of added fuel economy technologies, could make it easier or more difficult for manufacturers to meet fuel economy and emissions standards, and impacts on consumer surplus could raise the costs or augment the benefits of the standards. Because the OMEGA model does not presently estimate such impacts, the EPA is investigating the feasibility of developing an adjunct to the OMEGA model to make such estimates. This project is an effort to develop and test a candidate model. The project statement of work spells out the key functional requirements for the new model.

  10. Fossil energy program. Summary document

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-05-01

    This program summary document presents a comprehensive overview of the research, development, and demonstration (RD and D) activities that will be performed in FY 1981 by the Assistant Secretary for Fossil Energy (ASFE), US Department of Energy (DOE). The ASFE technology programs for the fossil resources of coal, petroleum (including oil shale) and gas have been established with the goal of making substantive contributions to the nation's future supply and efficienty use of energy. On April 29, 1977, the Administration submitted to Congress the National Energy Plan (NEP) and accompanying legislative proposals designed to establish a coherent energy policy structure for the United States. Congress passed the National Energy Act (NEA) on October 15, 1978, which allows implementation of the vital parts of the NEP. The NEP was supplemented by additional energy policy statements culminating in the President's address on July 15, 1979, presenting a program to further reduce dependence on imported petroleum. The passage of the NEA-related energy programs represent specific steps by the Administration and Congress to reorganize, redirect, and clarify the role of the Federal Government in the formulation and execution of national energy policy and programs. The energy technology RD and D prog4rams carried out by ASFE are an important part of the Federal Government's effort to provide the combination and amounts of energy resources needed to ensure national security and continued economic growth.

  11. Basis Document for Sludge Stabilization

    CERN Document Server

    Risenmay, H R

    2001-01-01

    DOE-RL recently issued Safety Evaluation Report (SER) amendments to the PFP Final Safety Analysis Report, HNF-SD-CP-SAR-021 Rev. 2. The Justification for Continued Operations for 2736-ZB and plutonium oxides in BTCs Safety Basis change (letter DOE-RL ABD-074) was approved by one of the SERs. Also approved by SER was the revised accident analysis for Magnesium Hydroxide Precipitation Process (MHPP) gloveboxes HC-230C-3 and HC-230C-5 containing increased glovebox inventories and corresponding increases in seismic release consequence. Numerous implementing documents require revision and issuance to implement the SER approvals. The SER plutonium oxides into BTCs specifically limited the SER scope to ''pure or clean oxides, i.e., 85 wt% or grater Pu, in this feed change'' (SER Section 3.0 Base Information paragraph 4 [page 11]). Comprehensive USQ Evaluation PFP-2001-12 addressed the packaging of Pu alloy metals into BTCs, and the packaging of Pu alloy oxides (powders) into food pack cans and determined that the ac...

  12. 10 CFR 71.113 - Document control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings,...

  13. 10 CFR 72.152 - Document control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 72.152 Section 72.152 Energy NUCLEAR... Document control. The licensee, applicant for a license, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and...

  14. 12 CFR 616.6400 - Documentation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Documentation. 616.6400 Section 616.6400 Banks and Banking FARM CREDIT ADMINISTRATION FARM CREDIT SYSTEM LEASING § 616.6400 Documentation. Each institution must document that any asset it leases is within its statutory authority....

  15. Spent Nuclear Fuel Project Document Management Plan

    Energy Technology Data Exchange (ETDEWEB)

    Connor, M.D.; Harizison, G.L.; Rice, W.C.

    1995-12-01

    The SNF Project Document Management Plan identifies and describes the currently available systems and processes for implementing and maintaining an effective document control and records management program. This program governs the methods by which documents are generated, released, distributed, maintained current, retired, and ultimately disposed.

  16. Documenting Clinical Events in Adventure Therapy.

    Science.gov (United States)

    Gray, Sky; Yerkes, Rita

    1995-01-01

    Stresses the need for documenting the application and outcomes of specific adventure activities with specific client groups and documenting critical therapeutic/clinical incidents in adventure therapy programs. Overviews current trends in documentation of therapeutic adventure programs and provides recommendations from the medical and mental…

  17. 12 CFR 563.1 - Chartering documents.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Chartering documents. 563.1 Section 563.1 Banks... Accounts § 563.1 Chartering documents. (a) Submission for approval. Any de novo savings association prior...) Availability of chartering documents. Each savings association shall cause a true copy of its charter and...

  18. Documentation and Communication in Swedish Preschools

    Science.gov (United States)

    Emilson, Anette; Pramling Samuelsson, Ingrid

    2014-01-01

    The aim of this study is to investigate communication between preschool teachers and children in documentation situations. The focus is also on what preschool teachers actually document. The research questions are: What characterizes the communication between teachers and children when these teachers are documenting at the same time? What is the…

  19. Organising European technical documentation to avoid duplication.

    Science.gov (United States)

    Donawa, Maria

    2006-04-01

    The development of comprehensive accurate and well-organised technical documentation that demonstrates compliance with regulatory requirements is a resource-intensive, but critically important activity for medical device manufacturers. This article discusses guidance documents and method of organising technical documentation that may help avoid costly and time-consuming duplication.

  20. Fuzzy Set Theoretical Approach to Document Retrieval.

    Science.gov (United States)

    Radecki, Tadeusz

    1979-01-01

    Presents a new method of document retrieval based on the fundamental operations of fuzzy set theory. Basic notions are introduced. Then the syntax and semantics of the proposed language for document retrieval is given, and an algorithm allocating documents to particular queries is described and its properties are discussed. (Author/CWM)

  1. 40 CFR 68.39 - Documentation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Documentation. 68.39 Section 68.39... ACCIDENT PREVENTION PROVISIONS Hazard Assessment § 68.39 Documentation. The owner or operator shall... passive mitigation that were assumed to limit the quantity that could be released. Documentation...

  2. 44 CFR 71.4 - Documentation.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Documentation. 71.4 Section... LEGISLATION § 71.4 Documentation. (a) In order to obtain a new policy of flood insurance for a structure which... protected area,” the owner of the structure must submit the documentation described in this section in...

  3. Documentation and Communication in Swedish Preschools

    Science.gov (United States)

    Emilson, Anette; Pramling Samuelsson, Ingrid

    2014-01-01

    The aim of this study is to investigate communication between preschool teachers and children in documentation situations. The focus is also on what preschool teachers actually document. The research questions are: What characterizes the communication between teachers and children when these teachers are documenting at the same time? What is the…

  4. 32 CFR 555.8 - Program documentation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Program documentation. 555.8 Section 555.8 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY MILITARY RESERVATIONS AND... TESTS, WORK FOR OTHERS § 555.8 Program documentation. Program documentation will be submitted...

  5. 5 CFR 844.203 - Supporting documentation.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Supporting documentation. 844.203 Section... § 844.203 Supporting documentation. (a) An individual or agency filing an application for disability... whatever documentation OPM requires in order to determine whether the individual meets the...

  6. 12 CFR 1410.7 - Documentation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Documentation. 1410.7 Section 1410.7 Banks and Banking FARM CREDIT SYSTEM INSURANCE CORPORATION PREMIUMS § 1410.7 Documentation. Each insured bank shall... and records documentation supporting its certified statement for a period no less than 5...

  7. 24 CFR 55.27 - Documentation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Documentation. 55.27 Section 55.27... FLOODPLAIN MANAGEMENT Procedures for Making Determinations on Floodplain Management § 55.27 Documentation. (a... part 58) who would approve the proposed action shall require documentation of compliance with...

  8. 24 CFR 906.40 - Supporting documentation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Supporting documentation. 906.40... documentation. The following supporting documentation must be submitted to HUD with the proposed homeownership program, as appropriate for the particular program: (a) Supporting documentation—PREs. In...

  9. 19 CFR 10.24 - Documentation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Documentation. 10.24 Section 10.24 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... with United States Components § 10.24 Documentation. (a) Documents required. The following...

  10. 36 CFR 800.11 - Documentation standards.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Documentation standards. 800... PROTECTION OF HISTORIC PROPERTIES The section 106 Process § 800.11 Documentation standards. (a) Adequacy of documentation. The agency official shall ensure that a determination, finding, or agreement under the...

  11. 29 CFR 1919.90 - Documentation.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Documentation. 1919.90 Section 1919.90 Labor Regulations...) GEAR CERTIFICATION Certification of Shore-Based Material Handling Devices § 1919.90 Documentation. (a... shall advise owners of affected equipment of the necessity for maintaining required documentation...

  12. 36 CFR 216.5 - Documentation.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Documentation. 216.5 Section... PUBLIC IN THE FORMULATION OF FOREST SERVICE DIRECTIVES § 216.5 Documentation. The responsible Forest... reasons therefor, in a concise written summary. The summary may be combined with documentation required...

  13. 19 CFR 10.307 - Documentation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Documentation. 10.307 Section 10.307 Customs....307 Documentation. (a) Claims for a preference. A preference in accordance with the Agreement may be claimed by including on the entry summary, or equivalent documentation, the symbol “CA” as a prefix to...

  14. 5 CFR 536.403 - Documentation.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Documentation. 536.403 Section 536.403... and Miscellaneous Provisions § 536.403 Documentation. The application of the provisions of this part... minimum this documentation will include a copy of the letter described in § 536.404....

  15. 7 CFR 330.103 - Documentation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Documentation. 330.103 Section 330.103 Agriculture... PRODUCTS; GARBAGE General Provisions § 330.103 Documentation. Any notifications, reports, and similar documentation not specified in the regulations in this part, but necessary to carry out the purpose of...

  16. 38 CFR 59.30 - Documentation.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Documentation. 59.30... STATES FOR CONSTRUCTION OR ACQUISITION OF STATE HOMES § 59.30 Documentation. For a State to obtain a grant and grant funds under this part, the State must submit to VA documentation that the site of...

  17. 33 CFR 106.115 - Compliance documentation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Compliance documentation. 106.115... documentation. Each OCS facility owner or operator subject to this part must ensure before July 1, 2004, that copies of the following documentation are available at the OCS facility and are made available to...

  18. 7 CFR 352.4 - Documentation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Documentation. 352.4 Section 352.4 Agriculture..., DEPARTMENT OF AGRICULTURE PLANT QUARANTINE SAFEGUARD REGULATIONS § 352.4 Documentation. (a) Manifest... for examination a complete manifest or other documentation from which the inspector may...

  19. 33 CFR 104.120 - Compliance documentation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Compliance documentation. 104.120... SECURITY MARITIME SECURITY: VESSELS General § 104.120 Compliance documentation. (a) Each vessel owner or... maintain the documentation described in paragraphs (a)(1), (2), or (3) of this section. The letter...

  20. 19 CFR 191.163 - Documentation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Documentation. 191.163 Section 191.163 Customs... or Specifications § 191.163 Documentation. (a) Entry. Customs Form 7551 shall be used to claim drawback under this subpart. (b) Documentation. The drawback entry for unmerchantable merchandise shall...

  1. 33 CFR 105.120 - Compliance documentation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Compliance documentation. 105.120... SECURITY MARITIME SECURITY: FACILITIES General § 105.120 Compliance documentation. Each facility owner or... documentation are available at the facility and are made available to the Coast Guard upon request: (a)...

  2. 34 CFR 668.57 - Acceptable documentation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Acceptable documentation. 668.57 Section 668.57... Application Information § 668.57 Acceptable documentation. (a) Adjusted Gross Income (AGI), income earned from... applicant, the documentation set forth in paragraph (a)(4) of this section if the individual for the...

  3. A case-comparison study of automatic document classification utilizing both serial and parallel approaches

    Science.gov (United States)

    Wilges, B.; Bastos, R. C.; Mateus, G. P.; Dantas, M. A. R.

    2014-10-01

    A well-known problem faced by any organization nowadays is the high volume of data that is available and the required process to transform this volume into differential information. In this study, a case-comparison study of automatic document classification (ADC) approach is presented, utilizing both serial and parallel paradigms. The serial approach was implemented by adopting the RapidMiner software tool, which is recognized as the worldleading open-source system for data mining. On the other hand, considering the MapReduce programming model, the Hadoop software environment has been used. The main goal of this case-comparison study is to exploit differences between these two paradigms, especially when large volumes of data such as Web text documents are utilized to build a category database. In the literature, many studies point out that distributed processing in unstructured documents have been yielding efficient results in utilizing Hadoop. Results from our research indicate a threshold to such efficiency.

  4. Deep NuSTAR and Swift monitoring observations of the magnetar 1E 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Archibald, Robert F.; Hascoët, Romain;

    2015-01-01

    We report on a 350 ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with T90 ≲ 1 s. An elevated level of emission tail is detected after the brightest burst, persisting for ~1 ks. The emission showed a...... consistent with the footprint of the twisted magnetic field lines on the star. We also report on the 3 yr Swift monitoring observations obtained since 2011 July. The soft-X-ray spectrum remained stable during this period, and the timing behavior was noisy, with large timing residuals....

  5. The new SGR 1550-5418 is the old AXP 1E1547.0-5408

    Science.gov (United States)

    Rea, N.; Esposito, P.; Krimm, H. A.; Palmer, D. M.; Mereghetti, S.; Tiengo, A.; Israel, G. L.

    2008-10-01

    N. Rea (U. Amsterdam), P. Esposito (INAF-IASF, Milan), H. A. Krimm (CRESST/GSFC/USRA), D. M. Palmer (LANL), S. Mereghetti, A. Tiengo (INAF-IASF, Milan), G.L. Israel (INAF-OAR) Swift-BAT triggered today on several Galactic short bursts (Krimm et al. GCN 8311, 8312), which were claimed to come from a new Soft Gamma Repeater SGR 1550-5418. However, given the positional coincidence of this new putative SGR 1550-5418 with the Anomalous X-ray Pulsar (AXP) 1E1547.0-5408 (Gelfand & Gaensler 2007; Camilo et al.

  6. AKAP 18 alpha and gamma have opposing effects on insulin release in INS-1E cells

    DEFF Research Database (Denmark)

    Josefsen, Knud; Lee, Ying C; Thams, Peter;

    2010-01-01

    A-kinase anchoring proteins (AKAPs) are known to compartmentalise protein kinase(s) to discrete cellular locations. Here we show that silencing of AKAP 18 alpha or gamma expression results in decreased or increased glucose-stimulated insulin secretion in INS-1E cells. Glucose stimulates AKAP 18...... alpha and inhibits AKAP 18 gamma mRNA expressions while palmitate markedly reduces AKAP 18 alpha expression. Human growth hormone (GH) stimulates AKAP 18 alpha expression and attenuates palmitate-induced suppression of AKAP 18 alpha mRNA level. The roles of AKAP 18 alpha and gamma in mediating insulin...

  7. PRELIMINARY STUDY OF A NOVEL HUMAN PAPILLOMAVIRUS TYPE 16 L1/E6-E7 CHIMERIC RECOMBINANT DNA VACCINE

    Institute of Scientific and Technical Information of China (English)

    郑瑾; 马军; 张福萍; 杨筱凤; 董小平; 司履生; 王一理

    2004-01-01

    Objective Preparations of HPV16 L1/E6 and L1/E7 prophylactic and therapeutic DNA vaccines. Methods The nucleotides within HPV16 E6 and E7 genes, which are responsible for viral transforming activity, were mutated by mage primer site-directed mutagenesis method. The correctly mutated E6 and E7 fragments were separately cloned into an eukaryotic expression vector pVAX1, together with HPV16 L1 gene, generating chimeric recombinants plasmids 1MpVAX1-L1E6, 2MpVAX1-L1E6, 1MpVAX1-L1E7, 2MpVAX1-L1E7 and 3MpVAX1-L1E7. CHO cells were transiently transfected with the individual DNA vaccines by calcium phosphate method. Target protein expressions in the extracts of the transfected cell lines were measured by ELISA and immunohistochemistry, with HPV16 L1 and E6 specific monoclonal antibodies. Results ELISA assays showed the P/N ratios in the cell extracts transfected with L1E6 and L1E7 plasmids were more than 2.1. Immunohistochemistry revealed brownish precipitant signal in cytoplasm and nuclei of the transfected cells. Conclusion Successful constructions of prophylactic and therapeutic DNA vaccine plasmids lay solid foundation for future animal experiment and clinical trial.

  8. High-level waste tank farm set point document

    Energy Technology Data Exchange (ETDEWEB)

    Anthony, J.A. III

    1995-01-15

    Setpoints for nuclear safety-related instrumentation are required for actions determined by the design authorization basis. Minimum requirements need to be established for assuring that setpoints are established and held within specified limits. This document establishes the controlling methodology for changing setpoints of all classifications. The instrumentation under consideration involve the transfer, storage, and volume reduction of radioactive liquid waste in the F- and H-Area High-Level Radioactive Waste Tank Farms. The setpoint document will encompass the PROCESS AREA listed in the Safety Analysis Report (SAR) (DPSTSA-200-10 Sup 18) which includes the diversion box HDB-8 facility. In addition to the PROCESS AREAS listed in the SAR, Building 299-H and the Effluent Transfer Facility (ETF) are also included in the scope.

  9. Document analysis using an aggregative and iterative process.

    Science.gov (United States)

    Rasmussen, Philippa; Muir-Cochrane, Eimear; Henderson, Ann

    2012-06-01

    This paper is a descriptive commentary concerning the use of document analysis in qualitative research concerned with developing an understanding of the role of child and adolescent mental health nursing in an inpatient. The document analysis was undertaken using thematic analysis with both an iterative process (Attride-Stirling) and an aggregative process, the Joanna Briggs Institute Thematic Analysis Program (TAP). After the initial iterative process the data were entered into an online software program, TAP, for aggregation and further analysis. The TAP software consisted of a three-step approach in the analysis of data extraction of illustrations, aggregation to categories and synthesis of categories into themes. A TAP chart was generated displaying the connections between the illustrations, categories and themes. The advantage and limitations of utilising the TAP software compared with Computer Assisted Qualitative Data Analysis Software were discussed. The program afforded direct involvement by the researcher in the cognitive process of the analysis; rather than just the technical process. A limitation of the program would be the volume of the data if the research involved a vast amount of data. The TAP program was a clearly defined three-step software program that was appropriate for the documents analysis for the research. The program would have a wide application for facilitating the thematic analysis of documents, although the program is suitable for smaller amounts of data.

  10. COMPOSITIONAL AND SUBSTANTIAL STRUCTURE OF THE MEDICAL DOCUMENT: FORMATION STAGES

    Directory of Open Access Journals (Sweden)

    Romashova Olga Vladimirovna

    2015-03-01

    Full Text Available The article deals with the compositional and substantial structure of the ambulatory medical record, or "case history", which has being formed for a long time. The author allocates the three main periods in the formation of this medical document: the first period (the beginning of the 19th century – 1920s is connected with the origin and formation; the second period (1920-1980s is marked by emergence of the normative legal acts regulating registration and maintaining; the third period (1980s – up to the present is associated with the cancellation of regulations and the introduction of the new order of the Ministry of Health of the USSR that changed the document's form and name. It is determined that the composition of the case history consists of the title page and the main part. The following processes take place in the course of ambulatory medical record's formation: strengthening formalization, increase in the number of pattern text fragments, increase in the text's volume, and the implementation of bigger number of functions. The author reveals the main (informative and cumulative, accounting and additional (scientific, controlling, legal, financial functions of the document. The implementation of these functions is reflected in the compositional and substantial structure of the document text and is conditioned by a number of extralinguistic factors.

  11. System engineering approach to documentation: an evaluation of the documentation process in a gastroenterology laboratory.

    Science.gov (United States)

    Zhang, Beilei; Youngblood, Liz; Murphy, Gerald D; Ramsay, Michael; Xiao, Yan

    2012-06-01

    Documentation processes are an indispensible part of patient care. Timely access to complete and accurate documentation is crucial to patient safety. However, there is no sufficient tool to help health care professionals effectively manage documentation processes. In this study, we developed an evaluation methodology, including a documentation matrix, a documentation process flow diagram, and a document value tool, to analyze the necessity and redundancy of the documentation processes. We applied this methodology in a gastrointestinal lab and improved the transparency of the documentation processes among providers. Copyright © 2012 Elsevier Inc. All rights reserved.

  12. BOX: One Minute Volume 3

    OpenAIRE

    Butler, Rose

    2009-01-01

    BOX is a digital short originally developed in 2004 documented on a 1920’s box camera. This early moving image work formed the basis of a practice which interrogates our experience of moving image through the remediation of analogue technology with new media. In 2009 it was included in One Minute Volume 3; a programme of artists moving image curated by Kerry Baldry including work by: Tony Hill, Tina Keane, Katherine Meynell, Kayla Parker and Stuart Moore, Dave Griffiths, Marty St Jam...

  13. Document management guidelines for distributed project networks

    CERN Document Server

    Hameri, A P; Høimyr, Nils-Joar

    1999-01-01

    This paper provides the project engineer with guidelines or a checklist on tasks that must be considered, defined and documented before the project can successfully implement a document management system in geographically distributed project environment. Topics ranging from configuration management, approval process, document types, user administration and document naming are covered. The underlying cases of the paper are that of CERN (European Laboratory for Particle Physics) and its latest accelerator project, together with the Nordisk Industrifond -funded Connecting Distributed Competencies (NI#: 98082) project, with a focus on distributed shipbuilding processes. Keywords: distributed project management, product data management, networking, document management, virtual workspaces

  14. Immune Algorithm For Document Query Optimization

    Institute of Scientific and Technical Information of China (English)

    WangZiqiang; FengBoqin

    2005-01-01

    To efficiently retrieve relevant document from the rapid proliferation of large information collections, a novel immune algorithm for document query optimization is proposed. The essential ideal of the immune algorithm is that the crossover and mutation of operator are constructed according to its own characteristics of information retrieval. Immune operator is adopted to avoid degeneracy. Relevant documents retrieved am merged to a single document list according to rank formula. Experimental results show that the novel immune algorithm can lead to substantial improvements of relevant document retrieval effectiveness.

  15. Traceability Method for Software Engineering Documentation

    Directory of Open Access Journals (Sweden)

    Nur Adila Azram

    2012-03-01

    Full Text Available Traceability has been widely discussed in research area. It has been one of interest topic to be research in software engineering. Traceability in software documentation is one of the interesting topics to be research further. It is important in software documentation to trace out the flow or process in all the documents whether they depends with one another or not. In this paper, we present a traceability method for software engineering documentation. The objective of this research is to facilitate in tracing of the software documentation.

  16. Development of a nursing automated documentation system.

    Science.gov (United States)

    Holmes, S B; Fuhrmann, M; Ivancin, L

    1992-01-01

    As hospital length of stay has decreased and patient acuity has increased, the nurse is confronted daily with the challenge of managing time between patient care and documentation. Documentation of care has consistently been a time-consuming and frustrating part of nursing practice. The nursing shortage has only compounded this problem. St. Joseph's Hospital has creatively begun to facilitate documentation by developing a Nursing Automated Documentation System (NADS) in collaboration with CliniCom, Inc. of Boulder, Colorado. This article documents the development and implementation of the system.

  17. Documenting the Earliest Chinese Journals

    Directory of Open Access Journals (Sweden)

    Jian-zhong (Joe Zhou

    2001-10-01

    Full Text Available

    頁次:19-24

    According to various authoritative sources, the English word "journal" was first used in the 16lh century, but the existence of the journal in its original meaning as a daily record can be traced back to Acta Diuma (Daily Events in ancient Roman cities as early as 59 B.C. This article documents the first appearance of Chinese daily records that were much early than 59 B.C.

    The evidence of the earlier Chinese daily records came from some important archaeological discoveries in the 1970's, but they were also documented by Sima Qian (145 B.C. - 85 B.C., the grand historian of the Han Dynasty imperial court. Sima's lifetime contribution was the publication of Shi Ji (史記 (The Grand Scribe's Records, the Records hereafter. The Records is a book of history of a grand scope. It encompasses all Chinese history from 30lh century B.C. through the end of the second century B.C. in 130 chapters and over 525,000 Chinese

  18. Industrial Maintenance, Volume III. Post Secondary Curriculum Guide.

    Science.gov (United States)

    Butler, Raymond H.; And Others

    This volume is the fourth of four volumes that comprise a curriculum guide for a postsecondary industrial maintenance program. It contains three sections and appendixes. Section 4 provides suggested methods of structuring the curriculum. Suggested ways of recording and documenting student progress are presented in section 5. Section 6 contains…

  19. Indexing for ERIC. Volume 3, Lessons 3 and 4.

    Science.gov (United States)

    Langridge, D.W.; And Others

    The last half of a course in subject indexing for the Educational Resources Information Center (ERIC) system is presented in this volume. The demonstration of indexing techniques, lesson 3, uses a typical document (given in full in an appendix in volume 1) to show how indexing concepts are chosen in practice and converted into terms contained in…

  20. Brazil - Improving Fiscal Circumstances for Growth : Volume 2. Main Report

    OpenAIRE

    World Bank

    2007-01-01

    This document is part of a series of reports by the World Bank on Brazil's potential to foment more robust economic growth and reduce poverty and inequality. The main focus of this report is on the interrelated fiscal circumstances facing Brazil, with an emphasis on public sector spending. The report is divided into two volumes. This first volume distills the essential stylized facts (that...