Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1, Technology Evaluation; Vol. 2, Technology Logic Diagram and Vol. 3, Technology EvaLuation Data Sheets. Part A of Vols. 1 and 2 focuses on RA. Part B of Vols. 1 and 2 focuses on the D&D of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TM, an explanation of the problems facing the volume-specific program, a review of identified technologies, and rankings of technologies applicable to the site. Volume 2 (Pts. A. B. and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A. B, and C) contains the TLD data sheets. This volume provides the technology evaluation data sheets (TEDS) for ER/WM activities (D&D, RA and WM) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than is given for the technologies in Vol. 2.
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. [ed.
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration (ER) and waste management (WN) problems at the Oak Ridge K-25 Site. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remediation, decontamination, and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This volume 3 B provides the Technology Evaluation Data Sheets (TEDS) for ER/WM activities (Remedial Action Robotics and Automation, Waste Management) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than each technology in Vol. 2. The TEDS are arranged alphanumerically by the TEDS code number in the upper right corner of each data sheet. Volume 3 can be used in two ways: (1) technologies that are identified from Vol. 2 can be referenced directly in Vol. 3 by using the TEDS codes, and (2) technologies and general technology areas (alternatives) can be located in the index in the front of this volume.
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision-support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Part A of Vols. 1 and 2 focuses on D&D. Part B of Vols. 1 and 2 focuses on RA of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the ranking os remedial technologies. Volume 2 (Pts. A, B, and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A, B, and C) contains the TLD data sheets. The focus of Vol. 1, Pt. B, is RA, and it has been divided into six chapters. The first chapter is an introduction, which defines problems specific to the ER Program for ORNL. Chapter 2 provides a general overview of the TLD. Chapters 3 through 5 are organized into necessary subelement categories: RA, characterization, and robotics and automation. The final chapter contains regulatory compliance information concerning RA.
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Part A of Vols. 1. and 2 focuses on D&D. Part B of Vols. 1 and 2 focuses on the RA of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the rankings of remedial technologies. Volume 2 (Pts. A, B, and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A, B, and C) contains the TLD data sheets. Remedial action is the focus of Vol. 2, Pt. B, which has been divided into the three necessary subelements of the RA: characterization, RA, and robotics and automation. Each of these sections address general ORNL problems, which are then broken down by problem area/constituents and linked to potential remedial technologies. The diagrams also contain summary information about a technology`s status, its science and technology needs, and its implementation needs.
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. [ed.
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration and waste management problems at the Oak Ridge K-25 Site to potential technologies that can remediate these problems. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remedial action, and decontamination and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This report is part A of Volume 3 concerning characterization, decontamination, and dismantlement.
Dynamics of structures '89. Vol. 3
International Nuclear Information System (INIS)
1989-01-01
The proceedings, comprising 3 volumes published by the Plzen Centre of the Czechoslovak Society for Science and Technology (Vol. 1 and 2) and by Skoda Works in Plzen (Vol. 3), contain 107 papers, out of which 8 fall within the INIS Subject Scope; these deal with problems related to the earthquake resistance of nuclear power plants. Attention is paid to the evaluation of seismic characteristics of nuclear power plant equipment, to the equipment testing and to calculations of its dynamic characteristics under simulated seismic stress. (Z.M.)
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1, Technology Evaluation; Vol. 2, Technology Logic Diagram and Vol. 3, Technology EvaLuation Data Sheets. Part A of Vols. 1 and 2 focuses on RA. Part B of Vols. 1 and 2 focuses on the D&D of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TM, an explanation of the problems facing the volume-specific program, a review of identified technologies, and rankings of technologies applicable to the site. Volume 2 (Pts. A. B. and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A. B, and C) contains the TLD data sheets. This volume provides the technology evaluation data sheets (TEDS) for ER/WM activities (D&D, RA and WM) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than is given for the technologies in Vol. 2.
Economic and Policy Review - Vol 13, No 3 (2007)
African Journals Online (AJOL)
Economic and Policy Review - Vol 13, No 3 (2007). Journal Home > Archives > Vol 13, No 3 ... Snagging the wheel of progress: Corruption, New anti-corruption drive and Nigeria\\'s quest for development. S B Kura ... Book Review: challenges of African growth opportunities, constraints and strategic directions. S I Owualah ...
International Nuclear Information System (INIS)
1993-01-01
Proceedings of the conference consist of 3 volumes: Vol. 1 - 'Environmental Impact Assessment of all Economical Activities including Industry'; Vol. 2 - 'Air Pollution Control and Prevention'; Vol. 3 - Waste Management and Environmental Problems in Construction Industry'. Out of 39 papers contained in Vol. 3, 3 were inputted to INIS. They deal with the use of portable radioisotope X-ray fluorescence analyzers in the determination of building material contamination by toxic elements, with underground waste repositories and ground water contamination, and the impact of the Temelin nuclear power plant on the hydrosphere and other environmental components. (Z.S.)
Oak Ridge K-25 Site Technology Logic Diagram. Volume 2, Technology Logic Diagrams
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. [ed.
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates envirorunental restoration and waste management problems at the Oak Ridge K-25 Site to potential technologies that can remediate these problems. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remedial action, and decontamination and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. This volume, Volume 2, contains logic diagrams with an index. Volume 3 has been divided into two separate volumes to facilitate handling and use.
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 86 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the third one, the content is about nuclear power sub-volume (Pt.2)
Soil-structure interaction Vol.3. Influence of ground water
Energy Technology Data Exchange (ETDEWEB)
Costantino, C J
1986-04-01
This study has been performed for the Nuclear Regulatory Commission (NRC) by the Structural Analysis Division of Brookhaven National Laboratory (BNL). The study was conducted during the fiscal year 1965 on the program entitled 'Benchmarking of Structural Engineering Problems' sponsored by NRC. The program considered three separate but complementary problems, each associated with the soil-structure interaction (551) phase of the seismic response analysis of nuclear plant facilities. The reports, all entitled Soil-Structure Interaction, are presented in three separate volumes, namely: Vol. 1 Influence of Layering by AJ Philippacopoulos, Vol. 2 Influence of Lift-Off by C.A. Miller, Vol. 3 Influence of Ground Water by C.J. Costantino. The two problems presented in Volumes 2 and 3 were conducted at the City University of New York (CUNY) under subcontract to BNL. This report, Volume 3 of the report, presents a summary of the first year's effort on the subject of the influence of foundation ground water on the SSI phenomenon. A finite element computer program was developed for the two-phased formulation of the combined soil-water problem. This formulation is based on the Biot dynamic equations of motion for both the solid and fluid phases of a typical soil. Frequency dependent interaction coefficients were generated for the two-dimensional plane problem of a rigid surface footing moving against a saturated linear soil. The results indicate that interaction coefficients are significantly modified as compared to the comparable values for a dry soil, particularly for the rocking mode of response. Calculations were made to study the impact of the modified interaction coefficients on the response of a typical nuclear reactor building. The amplification factors for a stick model placed atop a dry and saturated soil were computed. It was found that pore water caused the rocking response to decrease and translational response to increase over the frequency range of interest, as
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 28 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the tenth one, the content is about Nuclear Information sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 10 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the eighth one, the content is about nuclear agriculture sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 37 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the fourth one, the content is about isotope separation sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 13 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the sixth one, the content is about computational physics sub-volume
Proceedings of the third arab conference on the peaceful uses of atomic energy, vol.a,b
International Nuclear Information System (INIS)
El-Mashri, S.M.
1998-06-01
The publication has been set up as a textbook for peaceful uses of atomic energy vol.A: (1) reactor,materials,energy; (2) nuclear raw materials; (3) radiocesium-waste; (4) nuclear safety; (5) nuclear physics; (6) radiochemistry; (7) radiobiology; vol.B: (1) nuclear medicine; (2) agriculture and soil science; (3) isotope hydrology; (4) food preservation; (5) insect eradication; (6 )industrial application; (7) nuclear activation analysis; (8) health physics and environmental studies
Proceedings of the third arab conference on the peaceful uses of atomic energy, vol.a,b
Energy Technology Data Exchange (ETDEWEB)
El-Mashri, S M [ed.
1998-06-01
The publication has been set up as a textbook for peaceful uses of atomic energy vol.A: (1) reactor,materials,energy; (2) nuclear raw materials; (3) radiocesium-waste; (4) nuclear safety; (5) nuclear physics; (6) radiochemistry; (7) radiobiology; vol.B: (1) nuclear medicine; (2) agriculture and soil science; (3) isotope hydrology; (4) food preservation; (5) insect eradication; (6 )industrial application; (7) nuclear activation analysis; (8) health physics and environmental studies.
Oak Ridge K-25 Site Technology Logic Diagram. Volume 1, Technology evaluation
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. [ed.
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration and waste management problems at the Oak Ridge K-25 Site to potential technologies that can remediate these problems. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remedial action, and decontamination and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. This Volume, Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This volume is divided into ten chapters. The first chapter is a brief introduction, and the second chapter details the technical approach of the TLD. These categories are the work activities necessary for successful decontamination and decommissioning, waste management, and remedial action of the K-25 Site. The categories are characterization, decontamination, dismantlement, robotics and automation, remedial action, and waste management. Materials disposition is addressed in Chap. 9. The final chapter contains regulatory compliance information concerning waste management, remedial action, and decontamination and decommissioning.
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 48 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the second one, the content is about uranium mining and metallurgy sub-volume
Directory of Open Access Journals (Sweden)
Hongqi Si
2013-01-01
Full Text Available Sodium dodecyl sulfate (SDS sedimentation volume has long been used to characterize wheat flours and meals with the aim of predicting processing and end-product qualities. In order to survey the influence of low-molecular-weight glutenin subunits (LMW-GSs at Glu-B3 locus on wheat SDS sedimentation volume, a total of 283 wheat (Triticum aestivum L. varieties including landraces and improved and introduced cultivars were analyzed using 10 allele-specific PCR markers at the Glu-B3 locus. The highest allele frequency observed in the tested varieties was Glu-B3i with 21.9% in all varieties, 21.1% in landraces, 25.5% in improved cultivars, and 12% in introduced cultivars. Glu-B3 locus represented 8.6% of the variance in wheat SDS sedimentation volume, and Glu-B3b, Glu-B3g, and Glu-B3h significantly heightened the SDS sedimentation volume, but Glu-B3a, Glu-B3c, and Glu-B3j significantly lowered the SDS sedimentation volume. For the bread-making quality, the most desirable alleles Glu-B3b and Glu-B3g become more and more popular and the least desirable alleles Glu-B3a and Glu-B3c got less and less in modern improved cultivars, suggesting that wheat grain quality in China has been significantly improved through breeding effort.
Prognostic value of defining the systemic tumor volume with FDG-PET in diffuse large b cell lymphoma
International Nuclear Information System (INIS)
Byun, Byung Hyun; Lim, Sang Moo; Cheon, Gi Jeong; Choi, Chang Woon; Kang, Hye Jin; Na, Im Il; Ryoo, Baek Yeol; Yang, Sung Hyun
2007-01-01
We measured the systemic tumor volume using FDG-PET in patients with diffuse large B cell lymphoma (DLBL). We also investigated its prognostic role, and compared it with that of other prognostic factors. FDG PET was performed in 38 newly diagnosed DLBL patients (20 men, 18 women, age 55.715.1 years) at pre-treatment of chemotherapy. Clinical staging of lymphoma was evaluated by Ann Arbor system. On each FDG PET scan, we acquired volume of interest (VOl) at the cut-off value of SUV=2.5 in every measurable tumor by the automatic edge detection software. According to the VOI, we measured the metabolic volume and mean SUV, and estimated volume-activity indexes (SUV Vol) as mean SUV times metabolic volume. And then, we calculated the summed metabolic volume (VOLsum) and summed SUV Vol (SUV Volsum) in every FDG PET scan. Maximum SUV of involved lesion (SUVmax) was also acquired on each FDG PET scan. Time to treatment failure (TTF) was compared among VOLsum (median), SUV Volsum (median), SUVmax (median), clinical stage, gender, age, LDH, and performance status-assigned response designations by Kaplan-Meier survival analysis. Initial stages of DLBL patients were stage I in 4, II in 14, III in 15, and IV in 4 by Ann Arbor system. Median follow up period was 15.5months, and estimated mean TTF was 22.3 months. Univariate analysis demonstrated that TTF is statistically significantly reduced in those with high VOLsum (>215.1cm2, p=0.004), high SUV Volsum (>1577.5, p=0.003), and increased LDH (p=0.036). TTF did not correlate with SUVmax (p=0.571), clinical stage (p=0.194), gender (p=0.549), and age (p=0.128), and performance status =2 (p=0.074). Multivariate analysis using VOLsum, SUV Volsum, LDH, and performance status demonstrated no statistically significant predictor of TTF (p>0.05). Systemic tumor volume measurement using FDG-PET is suggestive to be the significant prognostic factor in patients with DLBL
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 22 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the seventh one, the content is about nuclear fusion and plasma physics sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 35 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the ninth one, the content is about nuclear technology applied in industry sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 12 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the eighth one, the content is about radiation research and its application sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 24 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the fourth one, the content is about Nuclear chemistry and radiation chemistry sub-volume
International Nuclear Information System (INIS)
Griffith, W.P.; Jehn, H.; McCleverty, J.A.; Raub, C.J.; Robinson, S.D.
1982-01-01
The present rhodium vol. B1 is concerned largely with linary compounds and coordination complexes of this important metal, which is used either alone or in alloy form for fabrication of other materials or for heterogeneous catalysis. In first two chapters are devoted for hydrides, oxides, ternary and quaternary oxorhodates. Third chapter is on different type of complexes with nitrogen. From chapter four to seven is on halogen complexes with this metal. Next chapters are on sulphides, sulphoxide and sulphito complexes, sulphates and sulphato complexes, selenides and tellurides, borides, borane complexes, carbides, carbonato, cyno, fulminato and thiocyanato complexes. Finally, silicide, phosphides, phosphito and arsenides are treated over here. (AB)
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 18 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the seventh one, the content is about pulse power technology and its application sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 57 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the seventh one, the content is about Nuclear electronics and nuclear detection technology sub-volume
International Nuclear Information System (INIS)
2014-05-01
Progress report on nuclear science and technology in China (Vol. 3) includes 18 articles which are communicated on the third national academic annual meeting of China Nuclear Society. There are 10 books totally. This is the tenth one, the content is about nuclear technology economy and management modernization sub-volume
Directory of Open Access Journals (Sweden)
V. Kishan
2017-02-01
Full Text Available The aim of present study is to analyze the influence of volume percentage (vol.% of nano-sized particles (TiB2: average size is 35 nm on microstructure, mechanical and tribological behavior of 6061-T6 Al alloy surface nano composite prepared via Friction stir process (FSP. The microstructure of the fabricated surface nanocomposites is examined using optical microscopy (OM and scanning electron microscope (SEM for distribution of TiB2 nano reinforcement particles, thickness of nano composite layer formed on the Aluminum alloy substrate and fracture features. The depth of surface nano composite layer is measured as 3683.82 μm along the cross section of stir zone of nano composite perpendicular to FSP. It was observed that increase in volume percentage of TiB2 particles, the microhardness is increased up to 132 Hv and it is greater than as-received Al alloy's microhardness (104 Hv. It is also observed that at 4 volume percentage higher tensile properties exhibited as compared with the 2 and 8 vol. %. It is found that high wear resistance exhibited at 4 volume percentage as-compared with the 2 and 8 vol. %. The observed wear and mechanical properties are interrelated with microstructure, fractography and worn morphology.
International Journal of Humanistic Studies - Vol 3 (2004)
African Journals Online (AJOL)
International Journal of Humanistic Studies - Vol 3 (2004). Journal Home > Archives > Vol 3 (2004). Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. DOWNLOAD FULL TEXT ...
A background to risk analysis. Vol. 3
International Nuclear Information System (INIS)
Taylor, J.R.
1979-01-01
This 4-volumes report gives a background of ideas, principles, and examples which might be of use in developing practical methods for risk analysis. Some of the risk analysis techniques described are somewhat experimental. The report is written in an introductory style, but where some point needs further justifi- cation or evaluation, this is given in the form of a chapter appenix. In this way, it is hoped that the report can serve two purposes, - as a basis for starting risk analysis work and as a basis for discussing effectiveness of risk analysis procedures. The report should be seen as a preliminary stage, prior to a program of industrial trials of risk analysis methods. Vol. 3 contains chapters on quantification of risk, failure and accident probability, risk analysis and design, and examles of risk analysis for process plant. (BP)
Energy Technology Data Exchange (ETDEWEB)
Gautam, Gaurav, E-mail: gauravgautamm1988@gmail.com; Mohan, Anita, E-mail: amohan.app@iitbhu.ac.in
2015-11-15
Present study outlines the effect of ZrB{sub 2} particles variation on the morphology and mechanical properties of (ZrB{sub 2}+Al{sub 3}Zr)/AA5052Al alloy composites. Composites with varying amount of ZrB{sub 2} particles have been produced by direct melt reaction (DMR) technique. These composites have been characterized by X-ray diffractometer (XRD) and energy-dispersive spectroscopy (EDS) to confirm the presence of ZrB{sub 2} and Al{sub 3}Zr particles. Optical microscopy (OM) and scanning-electron microscopy (SEM) have been used to understand the morphology. To see the effect of ZrB{sub 2} variation on mechanical properties, hardness and tensile properties have been evaluated. The XRD and EDS results confirm the successful formation of ZrB{sub 2} particles in matrix of AA5052Al alloy. SEM and TEM studies exhibit that ZrB{sub 2} particles are mostly in hexagonal and some rectangular shape while Al{sub 3}Zr particles are in polyhedron and rectangular shapes. Most of ZrB{sub 2} particles are within a size range of 10–190 nm. Interface region is free of any impurity. OM studies show grain refinement of AA5052Al alloy matrix with formation of second phase ZrB{sub 2} particles. Tensile results indicate that the UTS and YS improve up to 3 vol.% of ZrB{sub 2} but beyond this composition a decreasing trend is observed. The strength coefficient increases with increase in ZrB{sub 2} particles up to 3 vol.% in the Al{sub 3}Zr/Al alloy composites, whereas strain hardening decreases. While beyond 3 vol.% ZrB{sub 2} particles in the Al{sub 3}Zr/Al alloy composite, opposite trend is observed in strength coefficient and strain hardening. Percentage elongation also improves with 1vol.% ZrB{sub 2}, but further addition of ZrB{sub 2} shows an adverse effect. However, a continuous increasing trend has been observed in bulk hardness. Fracture studies show facets of Al{sub 3}Zr particles and dimples of matrix, but with inclusion of ZrB{sub 2} dimple size decreases. Increase in ZrB
International Nuclear Information System (INIS)
Uher, M.; Benes, P.; Carsky, J.; Ctrnactova, H.; Fecenko, J.; Fellner, P.; Hodul, P.; Koprda, V.; Kratochvil, B.; Krkoska, P.; Kuruc, J.; Lehotay, J.; Matousek, J.; Milichovsky, P.; Omastova, M.; Petrus, L. jr.; Petrus, L. sr.; Schwendt, P.; Silny, P.; Sevcik, P.; Toma, S.; Uherova, R.; Zachar, P.
1999-09-01
The publication has been set up as a abstracts of the meeting dealing with different chemical problems. The book (Vol. 1) consists of the sections: All-plenary lectures (9 papers); (D) History of the chemistry (14); (K) Didactics of chemistry (32); The book (Vol. 2) consists of the sections: (A) Analytical chemistry (48); (B) Inorganic chemistry (75); (C) Physical chemistry (27); (F) Nuclear chemistry and radioecology (12); (L) Environmental chemistry and toxicology (33); (M) Agricultural chemistry (20). The book (Vol. 3) consists of the sections: (E) Wood, pulp, paper (15); (G) Macromolecular chemistry (42); (H) Organic chemistry, bio-organic chemistry and pharmaceutical chemistry (96); (I) Food chemistry and biochemistry (34); (J) Textile, fibres and foil materials (9). The book (Vol. 4) consists of the workshop Molecular models (3 papers)
Advances in boundary elements. Vol. 1-3
International Nuclear Information System (INIS)
Brebbia, C.A.; Connor, J.J.
1989-01-01
This book contains some of the edited papers presented at the 11th Boundary Element Conference, held in Cambridge, Massachusetts, during August 1989. The papers are arranged in three different books comprising the following topics: Vol. 1: Computations and Fundamentals - comprises sections on fundamentals, adaptive techniques, error and convergence, numerical methods and computational aspects. (283 p.). Vol. 2: Field and fluid flow solutions - includes the following topics: potential problems, thermal studies, electrical and electromagnetic problems, wave propagation, acoustics and fluid flow. (484 p.). Vol. 3: Stress analysis - deals with advances in linear problems, nonlinear problems, fracture mechanics, contact mechanics, optimization, geomechanics, plates and shells, vibrations and industrial applications. (450 p). (orig./HP)
The Canada country study: Climate impacts and adaptation -- Vol. 7: National sectoral volume
Energy Technology Data Exchange (ETDEWEB)
Koshida, G.; Avis, W. [eds.] [Environment Canada, Downsview, ON (Canada)
1998-10-01
The Canada Country Study is a comprehensive source of knowledge on how climate change could impact on communities across Canada. The Study consists of a series of eight volumes and constitutes the scientific and technical results of the assessment phase of the project. This volume (Vol. 7) contains 12 sectoral papers which provide a digest of the findings of the previous six regional volumes, but viewed from the vantage points of the various sectors of national life and the economy, i.e. (1) agriculture, (2) built environment, (3) energy, (4) fisheries, (5) forestry, (6) human health, (7) insurance, (8) recreation and tourism, (9) transportation, (10) unmanaged ecosystems, (11) water resources, and (12) wetlands. Each paper is accompanied by an extensive list of references, a list of tables, a list of figures, and a list of appendices. Readers are cautioned that confidence levels are higher in the hemispheric-to-continental projections of climate change than in the regional projections. Also, it should be borne in mind that the identified changes in climate are projected to occur over the next century, and that the average rate of warming used in the models underlying these projections may be greater than any seen in the last several millenia.
Dynamics of structures '89. Vol. 1 and 2
International Nuclear Information System (INIS)
1989-01-01
The proceedings, comprising 3 volumes published by the Plzen Centre of the Czechoslovak Society for Science and Technology (Vol. 1 and 2) and by Skoda Works in Plzen (Vol. 3), contain 107 papers, out of which 8 fall within the INIS Subject Scope; these deal with problems related to the earthquake resistance of nuclear power plants. Attention is paid to the evaluation of seismic characteristics of nuclear power plant equipment, to the equipment testing and to calculations of its dynamic characteristics under simulated seismic stress. (Z.M.)
International Nuclear Information System (INIS)
1993-01-01
Proceedings of the conference consist of 3 volumes: Vol. 1 - 'Environmental Impact Assessment of all Economical Activities including Industry'; Vol. 2 - 'Air Pollution Control and Prevention'; Vol. 3 - Waste Management and Environmental Problems in Construction Industry'. Out of 32 papers contained in Vol. 1, 2 were inputted to INIS. They deal with models of radionuclide transport in food chains and the use of aerial monitoring in the study of environmental contamination. (Z.S.)
Energy Technology Data Exchange (ETDEWEB)
1992-06-01
This report, Part B (Vol. 3) of the permit application for the WIPP facility, contains information related to the site characterization of the facility, including geology, design, rock salt evaluations, maps, drawings, and shaft excavations. (CBS)
International Nuclear Information System (INIS)
1993-01-01
Proceedings of the conference consist of 3 volumes: Vol. 1 - 'Environmental Impact Assessment of all Economical Activities including Industry'; Vol. 2 - 'Air Pollution Control and Prevention'; Vol. 3 - Waste Management and Environmental Problems in Construction Industry'. Out of 32 papers contained in Vol. 2, 4 were inputted to INIS. They deal with nuclear fusion as a potential energy source, with environmental aspects of disposal of ashes from power plants in the Czech Republic, and with land reclamation after mining activities. (Z.S.)
Proceedings of the Seventh Conference of Nuclear Sciences and Applications. Vol.1,2,3
International Nuclear Information System (INIS)
Aly, H.F.
2000-01-01
The publication has been set up as a textbook for nuclear sciences and applications vol.1: (1) radiochemistry; (2) radiation chemistry; (3) isotope production; (4) waste management; vol.2: (1) nuclear and reactor; (2) physics; (3) plasma physics; (4) instrumentation and devices; (5) trace and ultra trace analysis; (6) environmental; vol.3: (1) radiation protection; (2) radiation health hazards; (3) nuclear safety; (4) biology; (5) agriculture
Proceedings of the Seventh Conference of Nuclear Sciences and Applications. Vol.1,2,3
Energy Technology Data Exchange (ETDEWEB)
Aly, H F [ed.
2000-07-01
The publication has been set up as a textbook for nuclear sciences and applications vol.1: (1) radiochemistry; (2) radiation chemistry; (3) isotope production; (4) waste management; vol.2: (1) nuclear and reactor; (2) physics; (3) plasma physics; (4) instrumentation and devices; (5) trace and ultra trace analysis; (6) environmental; vol.3: (1) radiation protection; (2) radiation health hazards; (3) nuclear safety; (4) biology; (5) agriculture.
Rivers, M. L.; Gualda, G. A.
2009-05-01
One of the challenges in tomography is the availability of suitable software for image processing and analysis in 3D. We present here 'tomo_display' and 'vol_tools', two packages created in IDL that enable reconstruction, processing, and visualization of tomographic data. They complement in many ways the capabilities offered by Blob3D (Ketcham 2005 - Geosphere, 1: 32-41, DOI: 10.1130/GES00001.1) and, in combination, allow users without programming knowledge to perform all steps necessary to obtain qualitative and quantitative information using tomographic data. The package 'tomo_display' was created and is maintained by Mark Rivers. It allows the user to: (1) preprocess and reconstruct parallel beam tomographic data, including removal of anomalous pixels, ring artifact reduction, and automated determination of the rotation center, (2) visualization of both raw and reconstructed data, either as individual frames, or as a series of sequential frames. The package 'vol_tools' consists of a series of small programs created and maintained by Guilherme Gualda to perform specific tasks not included in other packages. Existing modules include simple tools for cropping volumes, generating histograms of intensity, sample volume measurement (useful for porous samples like pumice), and computation of volume differences (for differential absorption tomography). The module 'vol_animate' can be used to generate 3D animations using rendered isosurfaces around objects. Both packages use the same NetCDF format '.volume' files created using code written by Mark Rivers. Currently, only 16-bit integer volumes are created and read by the packages, but floating point and 8-bit data can easily be stored in the NetCDF format as well. A simple GUI to convert sequences of tiffs into '.volume' files is available within 'vol_tools'. Both 'tomo_display' and 'vol_tools' include options to (1) generate onscreen output that allows for dynamic visualization in 3D, (2) save sequences of tiffs to disk
Effect of Si3N4 Addition on Oxidation Resistance of ZrB2-SiC Composites
Directory of Open Access Journals (Sweden)
Manab Mallik
2017-06-01
Full Text Available The oxidation behavior of ZrB2-20 vol % SiC and ZrB2-20 vol % SiC-5 vol % Si3N4 composites prepared by hot-pressing and subjected to isothermal exposure at 1200 or 1300 °C for durations of 24 or 100 h in air, as well as cyclic exposure at 1300 °C for 24 h, have been investigated. The oxidation resistance of the ZrB2-20 vol % SiC composite has been found to improve by around 20%–25% with addition of 5 vol % Si3N4 during isothermal or cyclic exposures at 1200 or 1300 °C. This improvement in oxidation resistance has been attributed to the formation of higher amounts of SiO2 and Si2N2O, as well as a greater amount of continuity in the oxide scale, because these phases assist in closing the pores and lower the severity of cracking by exhibiting self-healing type behavior. For both the composites, the mass changes are found to be higher during cyclic exposure at 1300 °C by about 2 times compared to that under isothermal conditions.
Large hadron collider workshop. Proceedings. Vol. 3
International Nuclear Information System (INIS)
Jarlskog, G.; Rein, D.
1990-01-01
The aim of the LHC workshop at Aachen was to discuss the 'discovery potential' of a high-luminosity hadron collider (the Large Hadron Collider) and to define the requirements of the detectors. Of central interest was whether a Higgs particle with mass below 1 TeV could be seen using detectors potentially available within a few years from now. Other topics included supersymmetry, heavy quarks, excited gauge bosons, and exotica in proton-proton collisions, as well as physics to be observed in electron-proton and heavy-ion collisions. A large part of the workshop was devoted to the discussion of instrumental and detector concepts, including simulation, signal processing, data acquisition, tracking, calorimetry, lepton identification and radiation hardness. The workshop began with parallel sessions of working groups on physics and instrumentaiton and continued, in the second half, with plenary talks giving overviews of the LHC project and the SSC, RHIC, and HERA programmes, summaries of the working groups, presentations from industry, and conclusions. Vol. 1 of these proceedings contains the papers presented at the plenary sessions, Vol. 2 the individual contributions to the physics sessions, and Vol. 3 those to the instrumentation sessions. (orig.)
International Nuclear Information System (INIS)
Altarelli, G.; Kleiss, R.; Verzegnassi, C.
1989-01-01
The contents of this final report from the Workshop on Z Physics at LEP can be divided into two parts. The first part, comprising Vols. 1 and 2, is a relatively concise but fairly complete handbook on the physics of e + e - annihilation near the Z peak (with normal LEP luminosity and unpolarized beams, appropriate for the first phase of LEP operation). The second part (Vol. 3) is devoted to a review of the existing Monte Carlo event generators for LEP physics. A special effort has been made to co-ordinate the different parts of this report, with the aim of achieving a systematic and balanced review of the subject, rather than having simply a collection of separate contributions. (orig.)
AFRREV STECH, Vol. 3(1) February, 2014
African Journals Online (AJOL)
Toshiba
Indexed African Journals Online: www.ajol.info. AFRREV STECH. An International Journal of Science and Technology. Bahir Dar, Ethiopia. Vol. 3 (1), S/No 6, February, 2014: 1-11. ISSN 2225-8612 (Print) ISSN 2227-5444 (Online). EFFECTS OF DEFORESTATION ON NATURAL. BIO-DIVERSITY IN DELTA NORTH ...
Energy Technology Data Exchange (ETDEWEB)
Svensson, Anders; Cederlund, Kerstin; Aspelin, Peter; Brismar, Torkel B. [Intervention and Technology at Karolinska Institutet, Department of Clinical Science, Division of Medical Imaging and Technology, Stockholm (Sweden); Karolinska University Hospital in Huddinge, Department of Radiology, Stockholm (Sweden); Bjoerk, Jonas [FoU-centrum Skaane Skaanes Universitetssjukhus i Lund, Lund (Sweden); Nyman, Ulf [University of Lund, Department of Diagnostic Radiology, Lasarettet Trelleborg, Trelleborg (Sweden)
2014-08-15
To compare hepatic parenchymal contrast media (CM) enhancement during multi-detector row computed tomography (MDCT) and its correlation with volume pitch-corrected computed tomography dose index (CTDI{sub vol}) and body weight (BW). One hundred patients referred for standard three-phase thoraco-abdominal MDCT examination were enrolled. BW was measured in the CT suite. Forty grams of iodine was administered intravenously (iodixanol 320 mg I/ml at 5 ml/s or iomeprol 400 mg I/ml at 4 ml/s) followed by a 50-ml saline flush. CTDI{sub vol} presented by the CT equipment during the parenchymal examination was recorded. The CM enhancement of the liver was defined as the attenuation HU of the liver parenchyma during the hepatic parenchymal phase minus the attenuation in the native phase. Liver parenchymal enhancement was negatively correlated to both CTDI{sub vol} (r = -0.60) and BW (r = -0.64), but the difference in correlation between those two was not significant. CTDI{sub vol} may replace BW when adjusting CM doses to body size. This makes it potentially feasible to automatically individualize CM dosage by CT. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Uher, M [ed.; Dept. of Org. Chem., Slovak Techn. Univ., Bratislava (Slovakia); Benes, P [ed.; Dept. Nucl. Chem., Czech Techn. Univ., Prague (Czech Republic); Carsky, J [ed.; Inst. of Med. Chem., Biochem. and Clin. Biochem., Comenius Univ., Bratislava (Slovakia); Ctrnactova, H [ed.; Dept. of Educat. and Didactics of Chem., Charles Univ., Prague (Czech Republic); Fecenko, J [ed.; Dept. of Agricult. Chem. and Susten. of Veget., Slovak Agricult. Univ., Nitra (Slovakia); Fellner, P [ed.; Dept. of Inorg. Chem., Slovak Techn. Univ., Bratislava (Slovakia); Hodul, P [ed.; Dept. of Fibres and Textile, Slovak Techn. Univ., Bratislava (Slovakia); Koprda, V [ed.; Dept. of Envir., Slovak Techn. Univ., Bratislava (Slovakia); Kratochvil, B [ed.; Inst. of. Solid State Chem., Chem. Univ., Prague (Czech Republic); Krkoska, P [ed.; Dept. of Chem. Technol. of Wood, Pulp and Paper, Slovak Techn. Univ., Bratislava (Slovakia); Kuruc, J [ed.; Dept. of Nucl. Chem., Comenius Univ., Bratislava (Slovakia); Lehotay, J [ed.; Dept. of Anal. Chem., Slovak Techn. Univ., Bratislava (Slovakia); Matousek, J [ed.; Inst. of Chem. and Technol. of the Envir., Techn. Univ, Brno (Czech Republic); Milichovsky, P [ed.; Dept. of Chem. Techn. of Wood, Pulp and Paper, Univ. Pardubice, Pardubice (Czech Republic); Omastova, M [ed.; Inst. of Polym., SAS, Bratislava (Slovakia); Petrus, L jr; Petrus, L sr [eds.; Inst. of Chem., SAS, Bratislava (Slovakia); Salisova, M [ed.; Dept. of Org. Chem., Comenius Univ., Bratislava (Slovakia); Schwendt, P [ed.; Dept. of Inorg. Chem., Comenius Univ., Bratislava (Slovakia); Silny, P; Sevcik, P; Toma, S [eds.; Comenius Univ., Bratislava (Slovakia); Uherova, R [ed.; Slovak Techn. Univ., Bratislava (Slovakia); Vanek, L [ed.; Charles Univ., Prague (Czech Republic); Zachar, P [ed.; Chem. Univ., Prague (Czech Republic)
1999-09-01
The publication has been set up as a abstracts of the meeting dealing with different chemical problems. The book (Vol. 1) consists of the sections: All-plenary lectures (9 papers); (D) History of the chemistry (14); (K) Didactics of chemistry (32); The book (Vol. 2) consists of the sections: (A) Analytical chemistry (48); (B) Inorganic chemistry (75); (C) Physical chemistry (27); (F) Nuclear chemistry and radioecology (12); (L) Environmental chemistry and toxicology (33); (M) Agricultural chemistry (20). The book (Vol. 3) consists of the sections: (E) Wood, pulp, paper (15); (G) Macromolecular chemistry (42); (H) Organic chemistry, bio-organic chemistry and pharmaceutical chemistry (96); (I) Food chemistry and biochemistry (34); (J) Textile, fibres and foil materials (9). The book (Vol. 4) consists of the workshop Molecular models (3 papers)
The NJOY Nuclear Data Processing System: Volume 3, The GROUPR, GAMINR, and MODER modules
International Nuclear Information System (INIS)
MacFarlane, R.E.; Muir, D.W.
1987-10-01
The NJOY Nuclear Data Processing System is a comprehensive computer code package for producing pointwise and multigroup cross sections and related quantities from ENDF/B-IV, V, or VI evaluated nuclear data. A concise description of the code system and references to the ancestors of NJOY are given in Vol. 1 of this report. This volume describes the GROUPR module, which produces multigroup neutron interaction cross sections and group-to-group production cross sections for neutrons and photons; the GAMINR module, which produces multigroup photon-interaction cross sections and group-to-group matrices; and the MODER module, which converts ENDF/B and NJOY interface files back and forth between formatted (i.e., BCD, ASCII) and binary modes and performs several associated editing functions. 34 refs., 13 figs
Perception and acceptance of technological risks. Vol. 3
Energy Technology Data Exchange (ETDEWEB)
Renn, O
1981-01-01
Vol. 3 discusses the problem of attitudes towards nuclear power. Data are compiled for five communities in North-Rhine Westphalia with nuclear facilities and the control community of Kerpen, which has no nuclear power plant. At the same time, the empirical and theoretical investigations are comprehensively evaluated.
Energy Technology Data Exchange (ETDEWEB)
Andrade, Marcos Ely Almeida
2008-07-01
The Computed Tomography (CT) is an important diagnostic imaging method, widely used. However, in spite of all the advantages and technologic advances within the CT scanners, the tomographic procedures result in high absorbed doses to patients. The main objective of this work was to perform a dosimetric study of CT scanners located at Recife and to evaluate the image quality on CT examinations in these equipment. The volume CT air kerma index (C{sub VOL}) and air kerma length product (P{sub KL,CT}) were estimated. These values were calculated using normalized weighted air kerma indexes in CT standard dosimetry phantoms ({sub n}C{sub W}), supplied by ImPACT group for several CT scanners, and the scan parameters of routine head, routine chest and hi-resolution chest CT exams performed at 20 institutions. The irradiation parameters of 15 adult patients for each CT procedure were registered at six participating centres, at which the phantom from the American College of Radiology (ACR) CT accreditation protocol was used for the image quality measurements. For routine head exams, the C{sub VOL} values varied between 12 and 58 mGy (at the posterior fossa) and 15 to 58 mGy (at the cerebrum) and the P{sub KL,CT}, from 150 to 750 mGy{center_dot}cm. The C{sub VOL} values for routine chest procedures varied from 3 to 26 mGy and the P{sub KL,CT}, between 120 and 460 mGy{center_dot}cm. In relation to Hi-resolution chest exams, C{sub VOL} values were from 1.0 to 2.7 mGy and the P{sub KL,CT} values varied between 24 and 67 mGy{center_dot}cm. The image quality evaluations results showed that almost all scanners presented at least one inadequacy. One of the equipment presented faults at 70% of the tests. With regard to the image noise, only two scanners presented acceptable results. From these results, it is possible to conclude that the volume CT air kerma index values are lower than the European reference levels. However, the image quality of these CT scanners does not attend the
C:\\Users\\AISA\\Desktop\\B. DIALLO.xps
African Journals Online (AJOL)
AISA
Pistacia vera L.). Comptes Rendus Biologies. Volume 332 ; (8) : 752 - 758. Borg P., Lê G., Lebrun S., Pées B. 2009. Example of industrial valorisation of derivative products of Castor oil. Innovation-. Technologie. Oléagineux, Corps Gras,. Lipides. Vol.
Yield Stress Model for Molten Composition B-3
Davis, Stephen; Zerkle, David
2017-06-01
Composition B-3 (Comp B-3) is a melt-castable explosive composed of 60/40 wt% RDX/TNT (hexahydro-1,3,5-trinitro-1,3,5-triazine/2,4,6-trinitrotoluene). During casting operations thermal conditions are controlled which along with the low melting point of TNT and the insensitivity of the mixture to external stimuli leading to safe use. Outside these standard operating conditions a more rigorous model of Comp B-3 rheological properties is necessary to model thermal transport as Comp B-3 evolves from quiescent solid through vaporization/decomposition upon heating. One particular rheological phenomena of interest is Bingham plasticity, where a material behaves as a quiescent solid unless a sufficient load is applied, resulting in fluid flow. In this study falling ball viscometer data is used to model the change in Bingham plastic yield stresses as a function of RDX particle volume fraction; a function of temperature. Results show the yield stress of Comp B-3 (τy) follows the expression τy = B ϕ -ϕc N , where Φ and Φc are the volume fraction of RDX and a critical volume fraction, respectively and B and N are experimentally evaluated constants.
International Nuclear Information System (INIS)
1994-09-01
The Y-12 Plant Remedial Action Technology Logic Diagram (TLD) was developed to provide a decision-support tool that relates environmental restoration (ER) problems at the Y-12 Plant to potential technologies that can remediate theses problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed for sufficient development of these technologies to allow for technology transfer and application to remedial action (RA) activities. The TLD consists of three volumes. Volume 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the rankings of remedial technologies. Volume 2 contains the logic linkages among environmental management goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 contains the TLD data sheets. This report is Part B of Volume 3 and contains the Characterization and Robotics/Automation sections
Oak Ridge K-25 Site Technology Logic Diagram
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. (ed.)
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration (ER) and waste management (WN) problems at the Oak Ridge K-25 Site. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remediation, decontamination, and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This volume 3 B provides the Technology Evaluation Data Sheets (TEDS) for ER/WM activities (Remedial Action Robotics and Automation, Waste Management) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than each technology in Vol. 2. The TEDS are arranged alphanumerically by the TEDS code number in the upper right corner of each data sheet. Volume 3 can be used in two ways: (1) technologies that are identified from Vol. 2 can be referenced directly in Vol. 3 by using the TEDS codes, and (2) technologies and general technology areas (alternatives) can be located in the index in the front of this volume.
Kleb, Mary M.; Scott, A. Donald, Jr.
2003-01-01
This report provides a compendium of NASA aircraft data that are available from NASA's Global Tropospheric Experiment's (GTE) Transport and Chemical Evolution over the Pacific (TRACE-P) Mission. The broad goal of TRACE-P was to characterize the transit and evolution of the Asian outflow over the western Pacific. Conducted from February 24 through April 10, 2001, TRACE-P integrated airborne, satellite- and ground based observations, as well as forecasts from aerosol and chemistry models. The format of this compendium utilizes data plots (time series) of selected data acquired aboard the NASA/Dryden DC-8 (vol. 1) and NASA/Wallops P-3B (vol. 2) aircraft during TRACE-P. The purpose of this document is to provide a representation of aircraft data that are available in archived format via NASA Langley's Distributed Active Archive Center (DAAC) and through the GTE Project Office archive. The data format is not intended to support original research/analyses, but to assist the reader in identifying data that are of interest.
International Nuclear Information System (INIS)
1968-01-01
); (j) Unconventional working fluids and concepts (11 papers); (k) Power plant concepts and economics (4 papers). (Vol. III). 2. Closed-Cycle MHD with liquid-Metal Working Fluids: (a) Diagnostics and fluid properties (7 papers); (b) Fluid acceleration (11 papers); (c) MHD losses (10 papers); (d) Generator design and performance studies (7 papers); (e) Generator experiments; Power plant concepts and economics (6 papers). (Vol. IV) 3. Open-Cycle MHD: (a) Diagnostics and fluid properties (14 papers); (b) Fields and flow in MHD channels; Boundary layers (10 papers); (c) Striated flow MHD systems (4 papers); (d) Generator design and performance studies (8 papers); (e) Power generation experiments (6 papers); (Vol. V) (f) Power plant concepts and economics (6 papers); (g) Electrodes and insulating materials (19 papers); (h) Auxiliary equipment (heat exchangers, combustion chambers, seeding techniques, magnets) (12 papers). (Vol. VI) Invited Lecture - Superconducting magnets for MHD generators; Rapporteurs Statements; Discussions; Round Table Discussions. The contributed papers are reproduced in their original languages (99 English, 38 French, 62 Russian, 1 Spanish). Each paper is preceded by an abstract in English with a second one in the original language if this is not English. The final volume, Vol. VI, containing the invited lecture, the 25 Rapporteurs’ Statements with the ensuing discussions, and the three Round Table Discussions, is entirely in English. In this volume also are repeated the contents lists of the preceding five volumes to simplify referencing, and there are a List of Participants, Author and Transliteration Indexes, and a Pre-Print Symbol Index. (author)
International Nuclear Information System (INIS)
Cottrell, W.B.; Klein, A.
1975-04-01
This issue of the Index to Nuclear Safety covers only articles included in Nuclear Safety, Vol. 11, No. 1, through Vol. 15, No. 6. This index is presented in three sections as follows: Chronological List of Articles by Volume; Permuted Title (KWIC) Index; and Author Index. (U.S.)
The relationship of VOI threshold, volume and B/S on DISA images
International Nuclear Information System (INIS)
Song Liejing; Wang Mingming; Si Hongwei; Li Fei
2011-01-01
Objective: To explore the relationship of VOI threshold, Volume and B/S on DISA phantom images. Methods: Ten hollow spheres were placed in cylinder phantom. According to the B/S of 1 : 7, 1 : 5 and 1 : 4, 99m TcO 4- and 18 F-FDG was filled into the container and spheres simultaneously and separately. Images were acquired by DISA and SIDA protocol. Volume of interest (VOI) for each sphere was analyzed by threshold method and to fit expression individually for validating of the relationship. Results: The equation for the estimation of optimal threshold was as following Tm = d + c × Bm/(e + f × Vm) + b/Vm. In majority of data, the calculated threshold was in the 1% interval that optimal thresholds were really in. Those who were not in were at the lower or upper intervals. Conclusions: Both DISA and SIDA images, based o the relationship of VOI thresh- old. Volume and B/S and real volume, this method could accurately calculate optimal threshold with an error less than 1% for spheres whose volumes ranged from 3.3 to 30.8 ml. (authors)
Robot technology. Vol. 3B. Teleoperation and robotics: applications and technology
Energy Technology Data Exchange (ETDEWEB)
Vertut, J; Coiffet, P
1985-01-01
Teleoperation is concerned with the exploration and exploitation of of spaces which do not allow, because of their inaccessibility or hostility, direct access to man. This volume (Parts 2, 3 and 4) covers the contribution of computer science and automatic control to this technology. Part 2 includes a description of teleoperation systems followed by chapters on the operator substitution function by computer feedback to the operator. Part 3 has chapters on performance evaluation of teleoperation systems and the human operator in the teleoperation system. Part 4 is about applications of teleoperation in the nuclear industry, underwater, in space, in medicine, in industry and in security and civil protection. The nuclear applications include research and pilot facilities, reactor operation and maintenance, reactor decommissioning and dismantling and in emergencies, for example following a reactor accident. (U.K.).
Directory of Open Access Journals (Sweden)
Ren Luyang
2017-01-01
Full Text Available Hybrid composites are fabricated by adding two reinforcements into matrix materials so that the expected excellent properties can be achieved through the combined advantages of short fibres, and different size particles (micron or nano, which provide a high degree of design freedom. In this paper, hybrid preforms were produced with the different size reinforcement of the Al2O3 particles and short fibres. The Al-Si alloy-based hybrid composites reinforced by 5 vol. % Al2O3 particles and 8 vol. % Al2O3 fibres were fabricated by preform-squeezing casting route. The structure and performance of composite materials were studied with Transmission Electron Microscopy (TEM and Scanning Electron Microscopy (SEM. The results show that the reinforcements, both particles and fibres, distribute homogeneously in the matrix materials, and the properties of composites are found to improve in comparison with the matrix Al-Si alloy.
Accurate B-spline-based 3-D interpolation scheme for digital volume correlation
Ren, Maodong; Liang, Jin; Wei, Bin
2016-12-01
An accurate and efficient 3-D interpolation scheme, based on sampling theorem and Fourier transform technique, is proposed to reduce the sub-voxel matching error caused by intensity interpolation bias in digital volume correlation. First, the influence factors of the interpolation bias are investigated theoretically using the transfer function of an interpolation filter (henceforth filter) in the Fourier domain. A law that the positional error of a filter can be expressed as a function of fractional position and wave number is found. Then, considering the above factors, an optimized B-spline-based recursive filter, combining B-spline transforms and least squares optimization method, is designed to virtually eliminate the interpolation bias in the process of sub-voxel matching. Besides, given each volumetric image containing different wave number ranges, a Gaussian weighting function is constructed to emphasize or suppress certain of wave number ranges based on the Fourier spectrum analysis. Finally, a novel software is developed and series of validation experiments were carried out to verify the proposed scheme. Experimental results show that the proposed scheme can reduce the interpolation bias to an acceptable level.
International Nuclear Information System (INIS)
Behrens, D.
1987-01-01
Volume 3 entitled 'Chemical Engineering and Biotechnology from A ... Z' lists all companies, institutes and organizations which participate as exhibitors in ACHEMA 88 (index of exhibitors). The section 'Who can give information?' is composed of 8,000 keywords which provide information on which special products are manufactured by which company and where more detailed data on the functions and applications of the products can be obtained. Finally an index of picture marks and trade marks completes the contents of Volume 3. The keywords contained in the section 'Who can give information?' are also listed in English, French, Spanish and Russian translation, so that Volume 3 can also be used as an alphabetical directory. The keyword index which refers to the hall and stand numbers of the exhibitors has been prepared by means of electronic data processing and this database represents the basis for the ACHEMA Information System COMPASS. COMPASS guides the visitor to the stands where he will find the products which are of interest to him. Visitors receive a printout of the name, hall and stand of the corresponding manufacturers. The information contained in Volume 2 and 3 is also stored in the DECHEMA databank DEQUIP (Dechema Equipment Suppliers Data Bank), which is accessible online throughout the world. (orig./HK) [de
Proceedings of the 1. Arabic conference on chemical applications (Chemia 2). Vol. 2
International Nuclear Information System (INIS)
1997-11-01
The conference of chemical application was held on 1-5 Nov 1997 in Cairo, This vol.2 contains of chemical application on nuclear materials. Studies on these vol.This second volume covers papers presented on the subjects
Influence of 5% dextrose volume on amphotericin B deoxycholate preparation.
Sun, Pingping; Chen, Jie; Zhang, Zhihao; Gao, Xiang; Chen, Pan; Li, Shuxia
2016-04-01
Preparation of amphotericin B deoxycholate (AmB-d) in different volumes of 5% dextrose (D5W) was studied to investigate a interesting phenomenon that AmB-d was easy to bring pipe blockage when diluted in 500 ml but not in 50 ml. AmB-d (25 mg/vial) in 50 ml, 250 ml or 500 ml D5W was prepared. Fluids were collected before and after infusion, then were assayed by validated high-performance liquid chromatography (HPLC) method. Light obscuration assay was used to detect the particles in transfusions. pH values of different volumes of D5W were all about 3.7, which was lower than the requirement of AmB-d package insert (pH > 4.2). The number of insoluble particles >10 μm/25 μm in 25 mg/500 ml infusions exceeded China Pharmacopoeia limit. Filters in 25 mg/500 ml infusion set were full of AmB-d after dripping slowly for 6 h, and 331.3 ml solution was left in the bottles and only 11.3% of AmB-d could flow out. Whereas the AmB-d infusion consists of 25 mg/50 ml, 25 mg/250 ml and 50 mg/500 ml could meet with China Pharmacopoeia standards, and they flowed out easily and completely. In practice, 25 mg/250 ml and 50 mg/500 ml would be more suitable for clinical use, rather than 25 mg/500 ml. We provided a convenient method for AmB-d preparation. © 2016 Royal Pharmaceutical Society, Journal of Pharmacy and Pharmacology.
Supersymmetric mechanics. Vol. 2. The attractor mechanism and space time singularities
International Nuclear Information System (INIS)
Bellucci, S.; Marrani, A.; Ferrara, S.
2006-01-01
This is the second volume in a series of books on the general theme of Supersymmetric Mechanics; the series is based on lectures and discussions held in 2005 and 2006 at the INFN-Laboratori Nazionali di Frascati. The first volume appears as Lect. Notes Physics, Vol. 698 ''Supersymmetric Mechanics, Vol.1: Supersymmetry, Noncommutativity and Matrix Models'' (2006) ISBN: 3-540-33313-4. The present extensive lecture supplies a pedagogical introduction, at the non-expert level, to the attractor mechanism in space-time singularities. In such a framework, supersymmetry seems to be related to dynamical systems with fixed points, describing the equilibrium state and the stability features of the thermodynamics of black holes. After a qualitative overview, explicit examples realizing the attractor mechanism are treated at some length; they include relevant cases of asymptotically flat, maximal and non-maximal, extended supergravities in 4 and 5 dimensions. A number of recent advances along various directions of research on the attractor mechanism are also given. (orig.)
Egyptian Journal of Medical Human Genetics - Vol 14, No 3 (2013)
African Journals Online (AJOL)
Egyptian Journal of Medical Human Genetics - Vol 14, No 3 (2013) ... Comparative study: Parameters of gait in Down syndrome versus matched obese and ... episodes in a Japanese child: Clinical, radiological and molecular genetic analysis ...
Lwati: A Journal of Contemporary Research - Vol 10, No 3 (2013)
African Journals Online (AJOL)
Lwati: A Journal of Contemporary Research - Vol 10, No 3 (2013) ... Evaluation of Social Studies Curriculum on Compassion Dispositions in Students of ... European Trading Companies and Economic Development in the Cross River Basin of ...
International Nuclear Information System (INIS)
Kim, Young Hwang; Jung, Jae Hoo; Kim, Ki Ho; Park, Byung Buk; Lee, Hyo Jik; Kim, Sung Hyun; Park, Hee Sung; Lee, Jong Kwang; Kim, Ho Dong
2009-12-01
A high-throughput vol-oxidizer which can handle a several ten kg HM/batch is being developed to supply U 3 O 8 powders to an electrolytic reduction reactor in pyro-processing. At the first year step(2007), for enhancement of oxidation and recovery rate, we analyzed the mechanical and chemical methods, and devised the main mechanism with ball drop methods and rotary kiln type. Also, the main devices for oxidation and recovery of rod-cuts were designed by using the Solid Works and COSMOS program tools, and manufactured after thermal/mechanical analysis. In order to verify the main devices, simulation fuels(W 90%+SiO 2 10%) were manufactured and the main devices were tested for the oxidation and recovery rate of its. Here the expansion ratio of simulation fuel is similar to U 3 O 8 (2.7). At the second year step(2008), with the constant ration of rod-cuts volume and expansion ratio of U 3 O 8 (2.7), we produced a theoretical equation that can estimate the volume of rod-cuts according to a variation of their weight and lengths. We considered various materials such as ceramics and Ni-Cr, finally, the APM material which can constantly maintain against high temperature(1,200 .deg. C) and vacuum(1 torr) was selected and a vol-oxidizer was designed. At the third year step(2009), in order to manufacture a high-throughput vol-oxidizer, we have analyzed the vol-oxidizer for remote operability and maintainability, also the remote assembling and disassembling possibilities of the selected modules have been analyzed in terms of visibility, interference, approach, weight, and so on. We have presented final modular design and manufactured a high-throughput vol-oxidizer. Also, we have conducted the blank, heating(over 500 .deg. C) and hull separation test(capacity : 50 kg HM/batch, hull length 50mm) on the high-throughput vol-oxidizer. Also, these design technologies for the high-throughput vol-oxidizer will be utilized in the development of a more efficient vol-oxidizer with higher
International Nuclear Information System (INIS)
1993-01-01
This report in three volumes substantiates the contents of the programme survey published in September 1989. The progress reports cover the following research areas: Vol. I, (1). Atomic and molecular physics - free atoms, molecules, macromolecules, clusters, matrix-isolated atoms and molecules. (2) Physics and chemistry of surfaces and interfaces - epitaxy, surface structure, adsorption, electrical, magnetic, and optical properties, thin films, synthetic layer structure. Vol. II, (3). Solid-state physics, and materials science -structural research, lattice dynamics, magnetic structure and dynamics, electronic states; load; spin and pulse density fluctuations; diffusion and internal motion, defects, unordered systems and liquids. Vol. III, (4). Chemistry - bonding and structure, kinetics and reaction mechanisms, polymer research, analysis and synthesis. (5). Biology, - structure and dynamics of biological macromolecules, membrane and cell biology. (6) Development of methods and instruments - neutron sources, synchrotron sources, special accelerators, research with interlinked systems and devices. (orig.) [de
Revised Calculated Volumes Of Individual Shield Volcanoes At The Young End Of The Hawaiian Ridge
Robinson, J. E.; Eakins, B. W.
2003-12-01
Recent, high-resolution multibeam bathymetry and a digital elevation model of the Hawaiian Islands allow us to recalculate Bargar and Jackson's [1974] volumes of coalesced volcanic edifices (Hawaii, Maui-Nui, Oahu, Kauai, and Niihau) and individual shield volcanoes at the young end of the Hawaiian Ridge, taking into account subsidence of the Pacific plate under the load of the volcanoes as modeled by Watts and ten Brink [1989]. Our volume for the Island of Hawaii (2.48 x105 km3) is twice the previous estimate (1.13 x105 km3), due primarily to crustal subsidence, which had not been accounted for in the earlier work. The volcanoes that make up the Hawaii edifice (Mahukona, Kohala, Mauna Kea, Hualalai, Mauna Loa, Kilauea, and Loihi) are generally considered to have formed within the past million years and our revised volume for Hawaii indicates that either magma-supply rates are greater than previously estimated (0.25 km3/yr as opposed to 0.1 km3/yr) or that Hawaii's volcanoes have erupted over a longer period of time (>1 million years). Our results also indicate that magma supply rates have increased dramatically to build the Hawaiian edifices: the average rate of the past 5 million years (0.096 km3/yr) is substantially greater than the overall average of the Hawaiian Ridge (0.018km3/yr) or Emperor Seamounts (0.012 km3/yr) as calculated by Bargar and Jackson, and that rates within the past million years are greater still (0.25 km3/yr). References: Bargar, K. E., and Jackson, E. D., 1974, Calculated volumes of individual shield volcanoes along the Hawaiian-Emperor Chain, Jour. Research U.S. Geol. Survey, Vol. 2, No. 5, p. 545-550. Watts, A. B., and ten Brink, U. S., 1989, Crustal structure, flexure, and subsidence history of the Hawaiian Islands, Jour. Geophys. Res., Vol. 94, No. B8, p. 10,473-10,500.
Oak Ridge K-25 Site Technology Logic Diagram
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. (ed.)
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates envirorunental restoration and waste management problems at the Oak Ridge K-25 Site to potential technologies that can remediate these problems. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remedial action, and decontamination and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. This volume, Volume 2, contains logic diagrams with an index. Volume 3 has been divided into two separate volumes to facilitate handling and use.
Oak Ridge K-25 Site Technology Logic Diagram
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. (ed.)
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration and waste management problems at the Oak Ridge K-25 Site to potential technologies that can remediate these problems. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remedial action, and decontamination and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This report is part A of Volume 3 concerning characterization, decontamination, and dismantlement.
International Nuclear Information System (INIS)
Krabal, Jacques; Sermier, Jean-Marie; Gaillard, Genevieve; Baupin, Denis; Pauvros, Remi; Benisti, Jacques Alain; Fromantin, Jean-Christophe; Calmette, Alain; Plisson, Philippe; Ginesy, Charles-Ange
2012-01-01
This huge document comprises ten volumes which present and discuss public programs (objectives, strategies, plans, and actions), public finances, economic activity data and evolutions, debates by commissions, and amendments on different issues. A first set of issues deals with ecology, sustainable development and planning: protection of the environment and risk prevention (volume 1), and then with sustainable development policies (vol. 2), landscapes, water, biodiversity, and geographic and cartographic information (vol. 3), ecological transition (vol. 4), road, railway and water transports (vol. 5), air transports (vol. 6), maritime affairs (vol. 7). The next volume addresses regional policies (vol. 8). The last parts concern research and higher education: research in the field of sustainable development (vol. 9) and in the fields of environments and resources (vol. 10)
Bulletin of the Chemical Society of Ethiopia - Vol 3, No 2 (1989)
African Journals Online (AJOL)
Bulletin of the Chemical Society of Ethiopia - Vol 3, No 2 (1989) ... Synthesis and characterization of gold (III) halide complexes of some pyridine ... Molluscicidal activities of some alkaloids · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Bulletin of the Chemical Society of Ethiopia - Vol 27, No 3 (2013)
African Journals Online (AJOL)
Bulletin of the Chemical Society of Ethiopia - Vol 27, No 3 (2013) ... of the psychoactive phenylpropylamino alkaloids of khat (Catha edulis Forsk) chewing ... Synthesis and characterization of CdTe quantum dots by one-step method · EMAIL ...
Oak Ridge National Laboratory Technology Logic Diagram
International Nuclear Information System (INIS)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D ampersand D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1, Technology Evaluation; Vol. 2, Technology Logic Diagram and Vol. 3, Technology EvaLuation Data Sheets. Part A of Vols. 1 and 2 focuses on RA. Part B of Vols. 1 and 2 focuses on the D ampersand D of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TM, an explanation of the problems facing the volume-specific program, a review of identified technologies, and rankings of technologies applicable to the site. Volume 2 (Pts. A. B. and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A. B, and C) contains the TLD data sheets. This volume provides the technology evaluation data sheets (TEDS) for ER/WM activities (D ampersand D, RA and WM) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than is given for the technologies in Vol. 2
International Nuclear Information System (INIS)
1993-01-01
This report in three volumes substantiates the contents of the programme survey published in September 1989. The progress reports cover the following research areas: Vol. I, (1). Atomic and molecular physics - free atoms, molecules, macromolecules, clusters, matrix-isolated atoms and molecules. (2) Physics and chemistry of surfaces and interfaces - epitaxy, surface structure, adsorption, electrical, magnetic, and optical properties, thin films, synthetic layer structure. Vol. II, (3). Solid-state physics, and materials science -structural research, lattice dynamics, magnetic structure and dynamics, electronic states; load; spin and pulse density fluctuations; diffusion and internal motion, defects, unordered systems and liquids. Vol. III, (4). Chemistry - bonding and structure, kinetics and reaction mechanisms, polymer research, analysis and synthesis. (5). Biology, - structure and dynamics of biological macromolecules, membrane and cell biology. (6) Development of methods and instruments - neutron sources, synchrotron sources, special accelerators, research with interlinked systems and devices. (orig.) [de
Sequence Coding and Search System for licensee event reports: coder's manual. Volume 3
International Nuclear Information System (INIS)
Gallaher, R.B.; Guymon, R.H.; Mays, G.T.; Poore, W.P.; Cagle, R.J.; Harrington, K.H.; Johnson, M.P.
1985-04-01
Operating experience data from nuclear power plants are essential for safety and reliability analyses, especially analyses of trends and patterns. The licensee event reports (LERs) that are submitted to the Nuclear Regulatory Commission (NRC) by the nuclear power plant utilities contain much of this data. The NRC's Office for Analysis and Evaluation of Operational Data (AEOD) has developed, under contract with NSIC, a system for codifying the events reported in the LERs. The primary objective of the Sequence Coding and Search System (SCSS) is to reduce the descriptive text of the LERs to coded sequences that are both computer-readable and computer-searchable. This four volume report documents and describes SCSS in detail. Volumes 3 and 4 provide a technical processor, new to SCSS, the information and methodology necessary to capture descriptive data from the LER and to codify that data into a structured format and serve as reference material for the more experienced technical processor, and contains information is essential for the more advanced user who needs to be familiar with the intricate coding techniques in order to retrieve specific details in a sequence. This volume contains updated material through amendment 1 to revision 1 of the working version of ORNL/NSIC-223, Vol. 3
EJOTMAS: Ekpoma Journal of Theatre and Media Arts - Vol 3, No 1 ...
African Journals Online (AJOL)
EJOTMAS: Ekpoma Journal of Theatre and Media Arts - Vol 3, No 1-2 (2010) ... The African composer as a social critic · EMAIL FREE FULL TEXT EMAIL FREE ... Potentials of the television in reinventing the Nigerian tourism industry · EMAIL ...
Microstructure and properties of MoSi2-MoB and MoSi2-Mo5Si3 molybdenum silicides
International Nuclear Information System (INIS)
Schneibel, J.H.; Sekhar, J.A.
2003-01-01
MoSi 2 -based intermetallics containing different volume fractions of MoB or Mo 5 Si 3 were fabricated by hot-pressing MoSi 2 , MoB, and Mo 5 Si 3 powders in vacuum. Both classes of alloys contained approximately 5 vol.% of dispersed silica phase. Additions of MoB or Mo 5 Si 3 caused the average grain size to decrease. The decrease in the grain size was typically accompanied by an increase in flexure strength, a decrease in the room temperature fracture toughness, and a decrease in the hot strength (compressive creep strength) measured around 1200 deg. C, except when the Mo 5 Si 3 effectively became the major phase. Oxidation measurements on the two classes of alloys were carried out in air. Both classes of alloys were protected from oxidation by an in-situ adherent scale that formed on exposure to high temperature. The scale, although not analyzed in detail, is commonly recognized in MoSi 2 containing materials as consisting mostly of SiO 2 . The MoB containing materials showed an increase in the scale thickness and the cyclic oxidation rate at 1400 deg. C when compared with pure MoSi 2 . However, in contrast with the pure MoSi 2 material, oxidation at 1400 deg. C began with a weight loss followed by a weight gain and the formation of the protective silica layer. The Mo 5 Si 3 containing materials experienced substantial initial weight losses followed by regions of small weight changes. Overall, the MoB and Mo 5 Si 3 additions to MoSi 2 tended to be detrimental for the mechanical and oxidative properties
South African Journal of Clinical Nutrition - Vol 29, No 3 (2016)
African Journals Online (AJOL)
South African Journal of Clinical Nutrition - Vol 29, No 3 (2016) ... C Marais, L van Wyk, M Conradie, D Hall, 118-121. Arm-associated measurements as estimates of true height in black and white young adults of both genders: an exploratory study, Pietermaritzburg, KwaZulu-Natal, South Africa · EMAIL FREE FULL TEXT ...
International Nuclear Information System (INIS)
Didier, Ryne A.; Vajtai, Petra L.; Hopkins, Katharine L.
2015-01-01
Iterative reconstruction technique has been proposed as a means of reducing patient radiation dose in pediatric CT. Yet, the effect of such reductions on diagnostic accuracy has not been thoroughly evaluated. This study compares accuracy of diagnosing pediatric acute appendicitis using contrast-enhanced abdominopelvic CT scans performed with traditional pediatric weight-based protocols and filtered back projection reconstruction vs. a filtered back projection/iterative reconstruction technique blend with reduced volume CT dose index (CTDI vol ). Results of pediatric contrast-enhanced abdominopelvic CT scans done for pain and/or suspected appendicitis were reviewed in two groups: A, 192 scans performed with the hospital's established weight-based CT protocols and filtered back projection reconstruction; B, 194 scans performed with iterative reconstruction technique and reduced CTDI vol . Reduced CTDI vol was achieved primarily by reductions in effective tube current-time product (mAs eff ) and tube peak kilovoltage (kVp). CT interpretation was correlated with clinical follow-up and/or surgical pathology. CTDI vol , size-specific dose estimates (SSDE) and performance characteristics of the two CT techniques were then compared. Between groups A and B, mean CTDI vol was reduced by 45%, and mean SSDE was reduced by 46%. Sensitivity, specificity and diagnostic accuracy were 96%, 97% and 96% in group A vs. 100%, 99% and 99% in group B. Accuracy in diagnosing pediatric acute appendicitis was maintained in contrast-enhanced abdominopelvic CT scans that incorporated iterative reconstruction technique, despite reductions in mean CTDI vol and SSDE by nearly half as compared to the hospital's traditional weight-based protocols. (orig.)
1989-03-01
1978. Williams. B.C. Qualitative Analysis of MOS Circuits. Artificial Inteligence . 1984. 24.. Wilson. K. From Association to Structure. Amsterdam:North...D-A208 378 RADC-TR-88-324, Vol II (of nine), Part B Interim Report March 1969 4. NORTHEAST ARTIFICIAL INTELLIGENCE CONSORTIUM ANNUAL REPORT 1987...II (of nine), Part B 6a. NAME OF PERFORMING ORGANIZATION 6b. OFFICE SYMBOL 7a. NAME OF MONITORING ORGANIZATION Northeast Artificial (ff ’aolicbl
Water SA - Vol 30, No 3 (2004)
African Journals Online (AJOL)
Application of a residential end-use model for estimating cold and hot water demand ... of multistage filtration using different filter media against conventional water ... (Germs et al., 2004), published in the April 2004 (Vol 30 No 2) issue of Water ...
International Nuclear Information System (INIS)
1997-12-01
This annual report of the US Nuclear Regulatory Commission's Office for Analysis and Evaluation of Operational Data (AEOD) describes activities conducted during 1996. The report is published in three parts. NUREG-1272, Vol. 10, No. 1, covers power reactors and presents an overview of the operating experience of the nuclear power industry from the NRC perspective, including comments about trends of some key performance measures. The report also includes the principal findings and issues identified in AEOD studies over the past year and summarizes information from such sources as licensee event reports and reports to the NRC's Operations Center. NUREG-1272, Vol. 10, No. 2, covers nuclear materials and presents a review of the events and concerns during 1996 associated with the use of licensed material in nonreactor applications, such as personnel overexposures and medical misadministrations. Both reports also contain a discussion of the Incident Investigation Team program and summarize both the Incident Investigation Team and Augmented Inspection Team reports. Each volume contains a list of the AEOD reports issued from CY 1980 through 1996. NUREG-1272, Vol. 10, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC's mission in 1996
International Nuclear Information System (INIS)
Precht, H.; Kitslaar, P.H.; Broersen, A.; Gerke, O.; Dijkstra, J.; Thygesen, J.; Egstrup, K.; Lambrechtsen, J.
2017-01-01
Purpose: Investigate the influence of adaptive statistical iterative reconstruction (ASIR) and the model-based IR (Veo) reconstruction algorithm in coronary computed tomography angiography (CCTA) images on quantitative measurements in coronary arteries for plaque volumes and intensities. Methods: Three patients had three independent dose reduced CCTA performed and reconstructed with 30% ASIR (CTDI vol at 6.7 mGy), 60% ASIR (CTDI vol 4.3 mGy) and Veo (CTDI vol at 1.9 mGy). Coronary plaque analysis was performed for each measured CCTA volumes, plaque burden and intensities. Results: Plaque volume and plaque burden show a decreasing tendency from ASIR to Veo as median volume for ASIR is 314 mm 3 and 337 mm 3 –252 mm 3 for Veo and plaque burden is 42% and 44% for ASIR to 39% for Veo. The lumen and vessel volume decrease slightly from 30% ASIR to 60% ASIR with 498 mm 3 –391 mm 3 for lumen volume and vessel volume from 939 mm 3 to 830 mm 3 . The intensities did not change overall between the different reconstructions for either lumen or plaque. Conclusion: We found a tendency of decreasing plaque volumes and plaque burden but no change in intensities with the use of low dose Veo CCTA (1.9 mGy) compared to dose reduced ASIR CCTA (6.7 mGy & 4.3 mGy), although more studies are warranted. - Highlights: • Veo decrease plaque volumes and plaque burden using low-dose CCTA. • Moving from ASIR 30%, ASIR 60% to Veo did not appear to influence the plaque intensities. • Studies including larger sample size are needed to investigate the effect on plaque.
Oak Ridge National Laboratory Technology Logic Diagram
International Nuclear Information System (INIS)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision-support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D ampersand D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Part A of Vols. 1 and 2 focuses on D ampersand D. Part B of Vols. 1 and 2 focuses on RA of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the ranking os remedial technologies. Volume 2 (Pts. A, B, and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A, B, and C) contains the TLD data sheets. The focus of Vol. 1, Pt. B, is RA, and it has been divided into six chapters. The first chapter is an introduction, which defines problems specific to the ER Program for ORNL. Chapter 2 provides a general overview of the TLD. Chapters 3 through 5 are organized into necessary subelement categories: RA, characterization, and robotics and automation. The final chapter contains regulatory compliance information concerning RA
Osmosis and Surface Area to Volume Ratio.
Barrett, D. R. B.
1984-01-01
Describes an experiment designed to help students understand the concepts of osmosis and surface area to volume ratio (SA:VOL). The task for students is to compare water uptake in different sizes of potato cubes and relate differences to their SA:VOL ratios. (JN)
Energy Technology Data Exchange (ETDEWEB)
Didier, Ryne A. [Oregon Health and Science University, Department of Diagnostic Radiology, DC7R, Portland, OR (United States); Vajtai, Petra L. [Oregon Health and Science University, Department of Pediatrics, Portland, OR (United States); Oregon Health and Science University, Department of Diagnostic Radiology, DC7R, Portland, OR (United States); Hopkins, Katharine L. [Oregon Health and Science University, Department of Diagnostic Radiology, DC7R, Portland, OR (United States); Oregon Health and Science University, Department of Pediatrics, Portland, OR (United States)
2014-07-05
Iterative reconstruction technique has been proposed as a means of reducing patient radiation dose in pediatric CT. Yet, the effect of such reductions on diagnostic accuracy has not been thoroughly evaluated. This study compares accuracy of diagnosing pediatric acute appendicitis using contrast-enhanced abdominopelvic CT scans performed with traditional pediatric weight-based protocols and filtered back projection reconstruction vs. a filtered back projection/iterative reconstruction technique blend with reduced volume CT dose index (CTDI{sub vol}). Results of pediatric contrast-enhanced abdominopelvic CT scans done for pain and/or suspected appendicitis were reviewed in two groups: A, 192 scans performed with the hospital's established weight-based CT protocols and filtered back projection reconstruction; B, 194 scans performed with iterative reconstruction technique and reduced CTDI{sub vol}. Reduced CTDI{sub vol} was achieved primarily by reductions in effective tube current-time product (mAs{sub eff}) and tube peak kilovoltage (kVp). CT interpretation was correlated with clinical follow-up and/or surgical pathology. CTDI{sub vol}, size-specific dose estimates (SSDE) and performance characteristics of the two CT techniques were then compared. Between groups A and B, mean CTDI{sub vol} was reduced by 45%, and mean SSDE was reduced by 46%. Sensitivity, specificity and diagnostic accuracy were 96%, 97% and 96% in group A vs. 100%, 99% and 99% in group B. Accuracy in diagnosing pediatric acute appendicitis was maintained in contrast-enhanced abdominopelvic CT scans that incorporated iterative reconstruction technique, despite reductions in mean CTDI{sub vol} and SSDE by nearly half as compared to the hospital's traditional weight-based protocols. (orig.)
MANHATTAN DISTRICT HISTORY PROJECT Y THE LOS ALAMOS PROJECT VOL. I INCEPTION UNTIL AUGUST 1945
Energy Technology Data Exchange (ETDEWEB)
Hawkins, D.
1961-12-01
THESE TWO VOLUMES CONSTITUTE A RECORD OF THE TECHNICAL, ADMINISTRATIVE , AND POLICY-MAKING ACTIVITIES OF THE LOS ALAMOS PROJECT (PROJECT Y) FROM ITS INCEPTION UNDER THE MANHATTAN DISTRICT THROUGH THE DEVELOPMENT OF THE ATOMIC BOMB (VOL. I), AND DURING THE PERIOD FOLLOWING THE END OF WORLD WAR II UNTIL THE MANHATTAN DISTRICT RELINQUISHED CONTROL TO THE ATOMIC ENERGY COMMISSION AS OF JANUARY 1947 (VOL. II). ALTHOUGH SECURITY REGULATIONS HAVE REQUIRED SOME DELETIONS IN THE ORIGINAL TEXT OF THE TWO VOLUMES, EVERY EFFORT HAS BEEN MADE TO RETAIN THE ORIGINAL LANGUAGE AND EXPRESSIONS OF THE AUTHORS.
Adaptive B-spline volume representation of measured BRDF data for photorealistic rendering
Directory of Open Access Journals (Sweden)
Hyungjun Park
2015-01-01
Full Text Available Measured bidirectional reflectance distribution function (BRDF data have been used to represent complex interaction between lights and surface materials for photorealistic rendering. However, their massive size makes it hard to adopt them in practical rendering applications. In this paper, we propose an adaptive method for B-spline volume representation of measured BRDF data. It basically performs approximate B-spline volume lofting, which decomposes the problem into three sub-problems of multiple B-spline curve fitting along u-, v-, and w-parametric directions. Especially, it makes the efficient use of knots in the multiple B-spline curve fitting and thereby accomplishes adaptive knot placement along each parametric direction of a resulting B-spline volume. The proposed method is quite useful to realize efficient data reduction while smoothing out the noises and keeping the overall features of BRDF data well. By applying the B-spline volume models of real materials for rendering, we show that the B-spline volume models are effective in preserving the features of material appearance and are suitable for representing BRDF data.
Radiotracers in medical applications, vols 1-2
International Nuclear Information System (INIS)
Rayudu, G.V.S.
1983-01-01
These volumes will serve as a basis for instruction and reference for professionals such as radiopharmaceutical chemists, radiopharmacologists, radiopharmacists, radiobiochemists, and others involved in the medical applications of radiotracers. Vol. I: Topics include radiohalogenated compounds, including radioiodine; Tc-labeled compounds; and in-house prepared radiopharmaceuticals. The charge particle range vs. energy in every element is tabulated for protons for cyclotrons users. Discussions are also provided on nonimaging radiotracer methods; 11 C, 13 N, 15 O, 67 Ga. 111 In, 75 Se, /SUP 123m/ Te compounds; radioactive noble gases; and miscellaneous radiotracers for imaging. Vol. II: Pertinent nuclear science data such as radiation dosimetry, radionuclide production modes, radionuclides for therapy, human experimentation regulations and consent forms, and radiotracer laboratory designs are presented
Journal of EEA, Vol. 30, 2013 SIEVE TRAY EFFICIENCY USING ...
African Journals Online (AJOL)
dell
Journal of EEA, Vol. 30, 2013. SIEVE TRAY EFFICIENCY USING CFD MODELING AND SIMULATION ... ABSTRACT. In this work, computational fluid dynamics (CFD) .... per unit volume, MG is the molecular weight of the gas/vapor, kL and kG ...
Foothills Parkway Section 8B Final Environmental Report, Volume 3, Appendix D
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER inventories the fishes and benthic macroinvertebrates inhabiting the aquatic ecosystems potentially affected by the proposed construction of Section 8B. Stream biological surveys were completed at 31 stream sites during the Fall of 1994. The sampling strategy for both invertebrates and fish was to survey the different taxa from all available habitats. For benthic invertebrates, a standardized qualitative manual collection technique was employed for all 31 stations. For fish
Soil-structure interaction Vol.2. Influence of lift-off
International Nuclear Information System (INIS)
Miller, C.A.
1986-04-01
This study has been performed for the Nuclear Regulatory Commission (NRC) by the Structural Analysis Division of Brookhaven National Laboratory (BNL). The study was conducted during the fiscal year 1985 on the program entitled 'Benchmarking of Structural Engineering Problems' sponsored by NRC. The program considered three separate but complementary problems, each associated with the soil-structure interaction (SSI) phase of the seismic response analysis of nuclear plant facilities. The reports are presented in three separate volumes. The general title for the reports is 'Soil Structure Interaction' with the following subtitles: Vol. 1 Influence of Layering by A.J. Philippacopoulos, Vol. 2 Influence of Lift-Off by C.A. Miller, Vol. 3 Influence of Ground Water by C.J. Costantino. The two problems presented in Volumes 2 and 3 were conducted at the City University of New York (CUNY) under subcontract to BNL. This report, Volume 2 of the report, presents a summary of the work performed defining the influence liftoff has on the seismic response of nuclear power plant structures. The standard lumped parameter analysis method was modified by representing the lumped soil/structure interaction horizontal and rocking dampers with distributed (over the foundation area) springs and dampers. The distributed springs and dampers are then modified so that they can only transmit compressive stresses. Additional interaction damping is included to account for the energy dissipated as a portion of the foundation which has separated comes back into contact with the soil. The validity of the model is evaluated by comparing predictions made with it to data measured during the SIMQUAKE II experiment. The predictions were found to correlate quite well with the measured data except for some discrepancies at the higher frequencies (greater than 10 cps). This discrepancy was attributed to the relatively crude model used for impact effects. Data is presented which identifies the peak
Electromechanical behavior of [001]-textured Pb(Mg1/3Nb2/3)O3-PbTiO3 ceramics
Yan, Yongke; Wang, Yu. U.; Priya, Shashank
2012-05-01
[001]-textured Pb(Mg1/3Nb2/3)O3-PbTiO3 (PMN-PT) ceramics were synthesized by using templated grain growth method. Significantly high [001] texture degree corresponding to 0.98 Lotgering factor was achieved at 1 vol. % BaTiO3 template. Electromechanical properties for [001]-textured PMN-PT ceramics with 1 vol. % BaTiO3 were found to be d33 = 1000 pC/N, d31 = 371 pC/N, ɛr = 2591, and tanδ = ˜0.6%. Elastoelectric composite based modeling results showed that higher volume fraction of template reduces the overall dielectric constant and thus has adverse effect on the piezoelectric response. Clamping effect was modeled by deriving the changes in free energy as a function of applied electric field and microstructural boundary condition.
Directory of Open Access Journals (Sweden)
Juan Pablo Casas
2008-08-01
Full Text Available La fibrosis pulmonar idiopática (FPI es una enfermedad que se caracteriza por presentar un compromiso pulmonar de tipo restrictivo, resultante de una reducción en la complacencia pulmonar secundaria a fibrosis difusa. En el enfisema, la pérdida de elasticidad pulmonar y el colapso de las vías aéreas periféricas generan obstrucción e hiperinflación. El efecto simultáneo que ambas enfermedades producen sobre la fisiología pulmonar no es del todo claro y se han descripto volúmenes pulmonares normales o casi normales. Presentamos 4 pacientes de sexo masculino de 64, 60, 73 y 70 años, con antecedentes de tabaquismo e historia de disnea progresiva, tres de ellos con grave limitación en su calidad de vida al momento de la consulta. En la tomografía de tórax de alta resolución todos los pacientes presentaban signos de enfermedad intersticial pulmonar avanzada, con cambios de tipo fibrótico con predominio basal y subpleural, que coexistían con enfisema centroacinar con predominio en lóbulos superiores. Uno de ellos tuvo confirmación diagnóstica de ambas condicioes por biopsia pulmonar a cielo abierto. En los cuatro pacientes la espirometría y volúmenes pulmonares fueron normales, pero tenían importante compromiso del intercambio gaseoso evaluado mediante el test de caminata de 6 minutos. Tres de los pacientes tenían hipertensión pulmonar grave diagnosticado por ecocardiograma. La presencia de volúmenes pulmonares normales no excluye un diagnóstico de fibrosis pulmonar idiopática en pacientes fumadores si coexisten evidencias tomográficas de enfisema. En estos pacientes el grado de compromiso funcional, determinado por la reducción de los volúmenes pulmonares, no debería ser considerado en la evaluación de la gravedad.Pulmonary function tests in idiopathic pulmonary fibrosis characteristically show a restrictive pattern, resulting from reduction of pulmonary compliance due to diffuse fibrosis. Conversely, an obstructive
Energy Technology Data Exchange (ETDEWEB)
1979-10-01
This book is the third volume of the ISTUM report. The first volume of the report describes the primary model logic and the model's data inputs. The second volume lists and evaluates the results of one model run. This and the fourth volume give supplementary information in two sets of model data - the energy consumption base and technology descriptions. Chapter III of Vol. I, Book 1 describes the ISTUM demand base and explains how that demand base was developed. This volume serves as a set of appendices to that chapter. The chapter on demands in Vol. I describes the assumptions and methodology used in constructing the ISTUM demand base; this volume simply lists tables of data from that demand base. This book divides the demand tables into two appendices. Appendix III-1 contains detailed tables on ISTUM fuel-consumption estimates, service-demand forecasts, and size and load-factor distributions. Appendix III-2 contains tables detailing ISTUM allocations of each industry's fuel consumption to service sectors. The tables show how the ECDB was used to develop the ISTUM demand base.
Energy Technology Data Exchange (ETDEWEB)
Truslow, E. C.; Smith, R. C.
1961-12-01
THESE TWO VOLUMES CONSTITUTE A RECORD OF THE TECHNICAL, ADMINISTRATIVE , AND POLICY-MAKING ACTIVITIES OF THE LOS ALAMOS PROJECT (PROJECT Y) FROM ITS INCEPTION UNDER THE MANHATTAN DISTRICT THROUGH THE DEVELOPMENT OF THE ATOMIC BOMB (VOL. I), AND DURING THE PERIOD FOLLOWING THE END OF WORLD WAR II UNTIL THE MANHATTAN DISTRICT RELINQUISHED CONTROL TO THE ATOMIC ENERGY COMMISSION AS OF JANUARY 1947 (VOL. II). ALTHOUGH SEC URITY REGULATIONS HAVE REQUIRED SOME DELETIONS IN THE ORIGINAL TEXT OF THE TWO VOLUMES, EVERY EFFORT HAS BEEN MADE TO RETAIN THE ORIGINAL LANGUGAGE AND EXPERSSIONS OF THE AUTHORS.
Anestesia volátil e monitorização anestésica.
Alexandre, Nuno; Costa, Margarida; Mascarenhas, Ramiro
2009-01-01
Os autores apresentam um texto de apoio à disciplina de anestesiologia do curso de Medicina Veterinária .Neste texto são abordadas diversas temáticas da anestesia volátil tais como: equipamentos utilizados em anestesia volátil, farmacologia dos anestésicos voláteis. A monitorização dos pacientes é abordada na vertente mecânica ou intrumental e na componente básica.
International Nuclear Information System (INIS)
Belli, Maria Luisa; Broggi, Sara; Scalco, Elisa; Rizzo, Giovanna; Sanguineti, Giuseppe; Fiorino, Claudio; Cattaneo, Giovanni Mauro; Dinapoli, Nicola; Valentini, Vincenzo; Ricchetti, Francesco
2014-01-01
To quantitatively assess the predictive power of early variations of parotid gland volume and density on final changes at the end of therapy and, possibly, on acute xerostomia during IMRT for head-neck cancer. Data of 92 parotids (46 patients) were available. Kinetics of the changes during treatment were described by the daily rate of density (rΔρ) and volume (rΔvol) variation based on weekly diagnostic kVCT images. Correlation between early and final changes was investigated as well as the correlation with prospective toxicity data (CTCAEv3.0) collected weekly during treatment for 24/46 patients. A higher rΔρ was observed during the first compared to last week of treatment (-0,50 vs -0,05HU, p-value = 0.0001). Based on early variations, a good estimation of the final changes may be obtained (Δρ: AUC = 0.82, p = 0.0001; Δvol: AUC = 0.77, p = 0.0001). Both early rΔρ and rΔvol predict a higher ''mean'' acute xerostomia score (≥ median value, 1.57; p-value = 0.01). Median early density rate changes for patients with mean xerostomia score ≥ / 3 /day for rΔρ and rΔvol respectively. Further studies are necessary to definitively assess the potential of early density/volume changes in identifying more sensitive patients at higher risk of experiencing xerostomia. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Watson, J.S.; Wiffen, F.W.; Bishop, J.L.; Breeden, B.K. (eds.)
1976-03-01
Separate abstracts were prepared for the 29 included papers in Vol. I. The topics covered in this volume include swelling and microstructures in thermonuclear reactor materials. Some papers on modeling and damage analysis are included. (MOW)
Pressure dependent elastic and structural (B3-B1) properties of Ga based monopnictides
International Nuclear Information System (INIS)
Varshney, Dinesh; Joshi, Geetanjali; Varshney, Meenu; Shriya, Swarna
2010-01-01
By formulating an effective interionic interaction potential that incorporates the long-range Coulomb, the covalency effects, the charge transfer caused by the deformation of the electron shells of the overlapping ions, the Hafemeister and Flygare type short-range overlap repulsion extended up to the second neighbour ions and the van der Waals (vdW) interaction, the pressure dependent elastic and thermodynamical properties of the III-V semiconductors as GaY (Y = N, P, As) are studied. The estimated values of phase transition pressure of GaY (Y = N, P, As) are in reasonably good agreement with the available data on the phase transition pressures (P t = 41, 22, 17 GPa). The vast volume discontinuity in pressure-volume phase diagram identifies a structural phase transition from zinc-blende (B3) to rock salt (B1) structure. Later on, the Poisson's ratio ν, the ratio R S/B of S (Voigt averaged shear modulus) over B (bulk modulus), elastic anisotropy parameter, elastic wave velocity, average wave velocity and Debye temperature as functions of pressure is calculated. From Poisson's ratio and the ratio R S/B it is inferred that GaY (Y = N, P, As) is brittle [ductile] in zinc-blende (B3) [Sodium Chloride (B1)] phase. To our knowledge this is the first quantitative theoretical prediction of the pressure dependence of ductile (brittle) nature of GaY compounds and still awaits experimental confirmations.
Book review: Vetter, H. 2005. Terralog. Turtles of the World. Vol. 3. Central and South America
Directory of Open Access Journals (Sweden)
2006-12-01
Full Text Available Book review: Vetter, H. 2005. Terralog. Turtles of the World. Vol. 3. Central and South America/Schildkröten der Welt Band 3. Mittel- und Südamerika: 1-128, color pictures 606 + 9. Edition Chimaira, Frankfurt, Germany.ISBN 3-930612-82-8; 29.7 x 20.8 cm
checkCIF/PLATON report Datablock: b3_0m
Indian Academy of Sciences (India)
As a result the full set of tests cannot be run. No syntax errors found. CIF dictionary Interpreting this report. Datablock: b3_0m. Bond precision: C-C = 0.0207 A. Wavelength=0.71073. Cell: a=11.0782(11) b=6.6521(7) c=12.1645(12) alpha=90 beta=101.798(4) gamma=90. Temperature: 296 K. Calculated. Reported. Volume.
Itinerant magnetism in CeRh3B2
DEFF Research Database (Denmark)
Eriksson, Olle; Johansson, Börje; Brooks, M. S. S.
1989-01-01
Spin-polarized energy-band calculations, including spin-orbit coupling in the band Hamiltonian, have been performed on CeRh3B2. Good agreement is obtained between theory and experiment concerning the magnetic moment. It is also found that the magnetic moment varies strongly with volume and from...
Belli, Maria Luisa; Scalco, Elisa; Sanguineti, Giuseppe; Fiorino, Claudio; Broggi, Sara; Dinapoli, Nicola; Ricchetti, Francesco; Valentini, Vincenzo; Rizzo, Giovanna; Cattaneo, Giovanni Mauro
2014-10-01
To quantitatively assess the predictive power of early variations of parotid gland volume and density on final changes at the end of therapy and, possibly, on acute xerostomia during IMRT for head-neck cancer. Data of 92 parotids (46 patients) were available. Kinetics of the changes during treatment were described by the daily rate of density (rΔρ) and volume (rΔvol) variation based on weekly diagnostic kVCT images. Correlation between early and final changes was investigated as well as the correlation with prospective toxicity data (CTCAEv3.0) collected weekly during treatment for 24/46 patients. A higher rΔρ was observed during the first compared to last week of treatment (-0,50 vs -0,05HU, p-value = 0.0001). Based on early variations, a good estimation of the final changes may be obtained (Δρ: AUC = 0.82, p = 0.0001; Δvol: AUC = 0.77, p = 0.0001). Both early rΔρ and rΔvol predict a higher "mean" acute xerostomia score (≥ median value, 1.57; p-value = 0.01). Median early density rate changes for patients with mean xerostomia score ≥ / xerostomia is well predicted by higher rΔρ and rΔvol in the first two weeks of treatment: best cut-off values were -0.50 HU/day and -380 mm(3)/day for rΔρ and rΔvol respectively. Further studies are necessary to definitively assess the potential of early density/volume changes in identifying more sensitive patients at higher risk of experiencing xerostomia.
Studies in Intelligence. Volume 52, Number 3, 2008
2008-09-01
September 2008) Center for the Study of Intelligence In Memory of Thomas Francis Troy, CIA Teacher, Historian, 1919–2008 Amnesia to Anamnesis ...CIA Teacher, Historian, 1919–2008 1 By Hayden Peake and Nicholas Dujmovic Amnesia to Anamnesis Commemoration of the Dead at CIA 3 Nicholas Dujmovic...Intelligence Vol. 52, No. 3 Amnesia to Anamnesis Commemoration of the Dead at CIA Nicholas Dujmovic “History—as it is learned and remembered— ” shapes
Introduction to "Global Tsunami Science: Past and Future, Volume II"
Rabinovich, Alexander B.; Fritz, Hermann M.; Tanioka, Yuichiro; Geist, Eric L.
2017-08-01
Twenty-two papers on the study of tsunamis are included in Volume II of the PAGEOPH topical issue "Global Tsunami Science: Past and Future". Volume I of this topical issue was published as PAGEOPH, vol. 173, No. 12, 2016 (Eds., E. L. Geist, H. M. Fritz, A. B. Rabinovich, and Y. Tanioka). Three papers in Volume II focus on details of the 2011 and 2016 tsunami-generating earthquakes offshore of Tohoku, Japan. The next six papers describe important case studies and observations of recent and historical events. Four papers related to tsunami hazard assessment are followed by three papers on tsunami hydrodynamics and numerical modelling. Three papers discuss problems of tsunami warning and real-time forecasting. The final set of three papers importantly investigates tsunamis generated by non-seismic sources: volcanic explosions, landslides, and meteorological disturbances. Collectively, this volume highlights contemporary trends in global tsunami research, both fundamental and applied toward hazard assessment and mitigation.
Oak Ridge K-25 Site Technology Logic Diagram
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. (ed.)
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration and waste management problems at the Oak Ridge K-25 Site to potential technologies that can remediate these problems. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remedial action, and decontamination and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. This Volume, Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This volume is divided into ten chapters. The first chapter is a brief introduction, and the second chapter details the technical approach of the TLD. These categories are the work activities necessary for successful decontamination and decommissioning, waste management, and remedial action of the K-25 Site. The categories are characterization, decontamination, dismantlement, robotics and automation, remedial action, and waste management. Materials disposition is addressed in Chap. 9. The final chapter contains regulatory compliance information concerning waste management, remedial action, and decontamination and decommissioning.
GPU v. B and W lawsuit review and its effect on TMI-1 (Docket 50-289). Volume 2. Appendices
International Nuclear Information System (INIS)
1983-09-01
Volume II of the GPU v. B and W lawsuit review contains four appendices supporting the review of the GPU v. B and W lawsuit discussed in Volume I of this report. As outlined in the Background section of Volume I under (3) Review Method Utilized by the Staff, the GPU v. B and W lawsuit review was partitioned into 10 categories. The 154 certification items and the 19 long-term actions (hearing items or restart issues) resulting from Commission Orders and the hearing process were each placed in one or more of the 10 categories. These appendices contain the hearing items by category; lawsuit record by category; category location matrix for lawsuit record; and uncategorized lawsuit record
South African Medical Journal - Vol 88, No 3 (1998)
African Journals Online (AJOL)
Tuberculosis and anorexia nervosa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Christopher Paul Szabo, 275-276. Books Advances in Pediatric Pulmonology. Pediatric and Adolescent Medicine Vol. 7 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Table of radionuclides (Vol.3 - Α = 3 to 244)
International Nuclear Information System (INIS)
Be, M.M.; Chiste, V.; Dulieu, Ch.; Browne, E.; Baglin, C.; Chechev, V.; Kuzmenko; Helmer, R.; Kondev, F.; MacMahon, T.D.; Lee, K.B.
2006-01-01
This monograph is one of several published in a series by the Bureau International des Poids et Mesures (BIPM) on behalf of the Comite Consultatif des Rayonnements Ionisants (CCRI), previously known as the Comite Consultatif pour les Etalons de Mesure des Rayonnements Ionisants (CCEMRI). The aim of this series of publications is to review topics that are of importance for the measurement of ionizing radiation and especially of radioactivity, in particular those techniques normally used by participants in international comparisons. It is hoped that these publications will prove to be useful reference volumes both for those who are already engaged in this field and for those who are approaching such measurements for the first time. The purpose of this monograph, number 5 in the series, is to present the recommended values of nuclear and decay data for a wide range of radionuclides. Activity measurements for more than forty of these radionuclides have already been the subject of comparisons under the auspices of Section II of the CCRI. The material for this monograph is now covered in three volumes. The first two volumes contain the primary recommended data relating to half-lives, decay modes, x-rays, gamma-rays, electron emissions; alpha- and beta-particle transitions and emissions, and their uncertainties for a set of sixty-eight radionuclides, Volume 1 for those radionuclides with mass number up to and including 150 and Volume 2 for those radionuclides with mass number over 150. Volume 3 contains the equivalent data for twenty-six additional radionuclides as listed and re-evaluation for 125 Sb and 153 Sm. The data have been collated and evaluated by an international working group (Decay Data Evaluation Project) led by the LNE-LNHB. The evaluators have agreed on the methodologies to be used and the CD-ROM included with this monograph contains the evaluators' comments for each radionuclide in addition to the data tables included in the monograph. The work involved in
Environmental Impact Assessment for the Decommissioning of Nuclear Installations. Vol. 1-3
International Nuclear Information System (INIS)
Bussell, M.J.; Haigh, C.P.; O'Sullivan, P.J.; Mathieson, J.; Braeckeveldt, M.; Deconinck, J.M.; Vidaechea, S.; Beceiro, A.; Ziegenhagen, J.; Biurrun, E.; Codee, H.; Palerm, J.; Bond, A.J.; Warren, L.; Sheate, B.
2001-06-01
This Report presents the results of a study concerned with Environmental Impact Assessment (EIA) for the decommissioning of nuclear installations in European Union Member States and in the Applicant Countries in Central and Eastern Europe. The study, undertaken for the Environment Directorate General of the European Commission, took place between January 2000 and March 2001 under contract number B4-3040/99/136035/MAR/C2 entitled Environmental Impact Assessment for the Decommissioning of nuclear Installations. The study presents an analysis of the current situation in the European Union and in the Applicant Countries, and develops guidance for applying the relevant Directives for EIA to the specific issue of decommissioning nuclear installations although there is also scope for application to other large or controversial projects. The first part of the report (Volume 1) describes the current situation in the EU Member States and Applicant Countries. On the basis of this status, the guidance presented in Volume 2 was developed. Draft versions of these volumes were reviewed by an independent review panel and were then subjected to detailed discussion and debate at a Workshop held in Brussels in January 2001. The Workshop was attended by more than 60 representatives of the nuclear industry, nuclear regulators, public interest groups and EIA experts. Some minor changes were made following the Workshop, a record of which can be found in Volume 3. (author)
Detector production for the R3B Si-tracker
Energy Technology Data Exchange (ETDEWEB)
Borri, M., E-mail: marcello.borri@liverpool.ac.uk [University of Liverpool, Department of Physics, Oxford Street, Liverpool L69 7ZE (United Kingdom); Lemmon, R. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4 CE (United Kingdom); Thornhill, J.; Bate, R.; Chartier, M. [University of Liverpool, Department of Physics, Oxford Street, Liverpool L69 7ZE (United Kingdom); Clague, N. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4 CE (United Kingdom); Herzberg, R.-D. [University of Liverpool, Department of Physics, Oxford Street, Liverpool L69 7ZE (United Kingdom); Labiche, M. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4 CE (United Kingdom); Lindsay, S.; Nolan, P.; Pearce, F.; Powell, W.; Wells, D. [University of Liverpool, Department of Physics, Oxford Street, Liverpool L69 7ZE (United Kingdom)
2016-11-11
R3B is a fixed target experiment which will study reactions with relativistic radioactive beams at FAIR. Its Si-tracker will surround the target volume and it will detect light charged-particles like protons. The detector technology in use consists of double-sided silicon strip sensors wire bonded to the custom made R3B-ASIC. The tracker allows for a maximum of two outer layers and one inner layer. This paper reports on the production of detectors necessary to build the minimum tracking configuration: one inner layer and one outer layer.
Classical and quantum electrodynamics and the B(3) field
Evans, Myron W
2001-01-01
It is well known that classical electrodynamics is riddled with internal inconsistencies springing from the fact that it is a linear, Abelian theory in which the potentials are unphysical. This volume offers a self-consistent hypothesis which removes some of these problems, as well as builds a framework on which linear and nonlinear optics are treated as a non-Abelian gauge field theory based on the emergence of the fundamental magnetizing field of radiation, the B(3) field. Contents: Interaction of Electromagnetic Radiation with One Fermion; The Field Equations of Classical O (3) b Electrodyn
Safety of magnetic fusion facilities: Volume 2, Guidance
International Nuclear Information System (INIS)
1995-01-01
This document provides guidance for the implementation of the requirements identified in Vol. 1 of this Standard. This guidance is intended for the managers, designers, operators, and other personnel with safety responsibilities for facilities designated as magnetic fusion facilities. While Vol. 1 is generally applicable in that requirements there apply to a wide range of fusion facilities, this volume is concerned mainly with large facilities such as the International Thermonuclear Experimental Reactor (ITER). Using a risk-based prioritization, the concepts presented here may also be applied to other magnetic fusion facilities. This volume is oriented toward regulation in the Department of Energy (DOE) environment
International Nuclear Information System (INIS)
Dobos, Ion; Comsa, Olivia
1998-01-01
These proceedings published in two volumes contain materials presented at the National Seminar on Public Information on Peaceful uses of Nuclear Energy - NUCInfo'98 - held on 30th September to 2nd October 1998 at Bucharest, Romania. The first volume was dedicated to Public Information. The second volume containing 56 scientific and technical papers is structured in three parts according to the three sessions entitled: B 1 . Sustainable Development - Energy - Environment; B 2 . Nuclear safety, Radioactive Wastes, Radioprotection and Nuclear Safeguards; B 3 . Scientific Research, Technological Development and Applications of the Nuclear Energy in Economic and Social Life. The great majority of the contributions deal with specific public information technical problems and debates on nuclear issues mainly related to radiation monitoring, waste management, air, water and food contamination from accidental radioactive release or from fuel cycle relating activities. Also, several papers discuss the present status of national nuclear program, program management and legal matters in the nuclear field. A number of papers debate the questions related to radiation protection procedures and the safety problems at the Cernavoda NPP based on CANDU type reactors
Army Communicator. Volume 27, Number 3, Fall 2002
2002-01-01
play in the Army’s transformation to the Objec- tive Force.” Gizmo’s debut in the Beatle Bailey comic strip came July 4. And according to a source close...Approved for public release; distribution is unlimited. Headquarters, Department of the Army ARMY COMMUNICATOR Voice of the Signal Regiment ! PB 11...02-3 Fall 2002 Vol. 27 No. 3 ! Special focus: radio’s resurgence -- its “new” uses in the current and near- future Army, Pgs. 2-18 ! Signal-planning
Evaluation of Capacity on a High Throughput Vol-oxidizer for Operability
International Nuclear Information System (INIS)
Kim, Young Hwan; Park, Geun Il; Lee, Jung Won; Jung, Jae Hoo; Kim, Ki Ho; Lee, Yong Soon; Lee, Do Youn; Kim, Su Sung
2010-01-01
KAERI is developing a pyro-process. As a piece of process equipment, a high throughput vol-oxidizer which can handle a several tens kg HM/batch was developed to supply U 3 O 8 powders to an electrolytic reduction(ER) reactor. To increase the reduction yield, UO 2 pellets should be converted into uniform powders. In this paper, we aim at the evaluation of a high throughput vol-oxidizer for operability. The evaluation consisted of 3 targets, a mechanical motion test, a heating test and hull separation test. In order to test a high throughput vol-oxidizer, By using a control system, mechanical motion tests of the vol-oxidizer were conducted, and heating rates were analyzed. Also the separation tests of hulls for recovery rate were conducted. The test results of the vol-oxidizer are going to be applied for operability. A study on the characteristics of the volatile gas produced during a vol-oxidation process is not included in this study
1987-06-01
1985, PVP-Vol.99, ASME, NY, 1985, p 17-38. (11) C Amzallag and JL Bernard , "Proc, IAEA Specialists Mtg on Sub- critical Crack Growth", Freiburg, May...Amborski, D.J. In Microstructural Science. Edited by J.E. Bennett, L.R. Cornwell , and J.L. McCall, Elsevier, New York, 1978, pp. 143-158. (18) Wright, K
Schrijver, Carolus J.; Siscoe, George L.
2010-11-01
Volume 1: Preface; 1. Prologue Carolus J. Schrijver and George L. Siscoe; 2. Introduction to heliophysics Thomas J. Bogdan; 3. Creation and destruction of magnetic field Matthias Rempel; 4. Magnetic field topology Dana W. Longcope; 5. Magnetic reconnection Terry G. Forbes; 6. Structures of the magnetic field Mark B. Moldwin, George L. Siscoe and Carolus J. Schrijver; 7. Turbulence in space plasmas Charles W. Smith; 8. The solar atmosphere Viggo H. Hansteen; 9. Stellar winds and magnetic fields Viggo H. Hansteen; 10. Fundamentals of planetary magnetospheres Vytenis M. Vasyliūnas; 11. Solar-wind magnetosphere coupling: an MHD perspective Frank R. Toffoletto and George L. Siscoe; 12. On the ionosphere and chromosphere Tim Fuller-Rowell and Carolus J. Schrijver; 13. Comparative planetary environments Frances Bagenal; Bibliography; Index. Volume 2: Preface; 1. Perspective on heliophysics George L. Siscoe and Carolus J. Schrijver; 2. Introduction to space storms and radiation Sten Odenwald; 3. In-situ detection of energetic particles George Gloeckler; 4. Radiative signatures of energetic particles Tim Bastian; 5. Observations of solar and stellar eruptions, flares, and jets Hugh Hudson; 6. Models of coronal mass ejections and flares Terry Forbes; 7. Shocks in heliophysics Merav Opher; 8. Particle acceleration in shocks Dietmar Krauss-Varban; 9. Energetic particle transport Joe Giacalone; 10. Energy conversion in planetary magnetospheres Vytenis Vasyliūnas; 11. Energization of trapped particles Janet Green; 12. Flares, CMEs, and atmospheric responses Tim Fuller-Rowell and Stanley C. Solomon; 13. Energetic particles and manned spaceflight 358 Stephen Guetersloh and Neal Zapp; 14. Energetic particles and technology Alan Tribble; Appendix I. Authors and editors; List of illustrations; List of tables; Bibliography; Index. Volume 3: Preface; 1. Interconnectedness in heliophysics Carolus J. Schrijver and George L. Siscoe; 2. Long-term evolution of magnetic activity of Sun
A superconducting battery material: Lithium gold boride (LiAu3B)
Aydin, Sezgin; Şimşek, Mehmet
2018-04-01
The superconducting and potential cathode material properties of ternary boride of LiAu3B have been investigated by density functional first principles. The Li-concentration effects on the actual electronic and structural properties, namely the properties of LixAu9B3 (x = 0, 1, 2) sub-systems are studied. It is remarkably shown that the existence of Li-atoms has no considerable effect on the structural properties of Au-B skeleton in LiAu3B. Then, it can be offered as a potential cathode material for Li-ion batteries with the very small volume deviation of 0.42%, and the suitable average open circuit voltage of ∼1.30 V. Furthermore, the vibrational and superconducting properties such as electron-phonon coupling constant (λ) and critical temperature (Tc) of LiAu3B are studied. The calculated results suggest that LiAu3B should be a superconductor with Tc ∼5.8 K, also.
African Journals Online (AJOL)
Owner
Die motto van Marius Crous se derde bundel,. Vol draadwerk (2012) is ontleen aan die vader van die psigoanalise, Sigmund Freud, wat lui: “Everywhere I go I find a poet has been there before me.” Vol draadwerk verskyn ses jaar ná sy vorige bundel, Aan 'n beentjie sit en kluif. (2006). Vir sy bundel, Brief uit die kolonies ...
International Nuclear Information System (INIS)
1983-01-01
Following Joyo Reactor Technology Progress Reports (Vol. 1 to Vol. 7), the name was changed to Joyo Progress Report from this volume, and the activities concerning the fast breeder experimental reactor Joyo as a whole are to be reported as quarterly report. In the fast breeder experimental reactor Joyo, the change to the core for irradiation (MK-2) from the core for breeding (MK-1) was carried out since January, 1982, in order to utilize the reactor as an irradiation facility for the development of fuel and materials. The main work was the construction of the core for irradiation by exchanging 290 fuel elements, and the exchange of upper and lower guide pipes for control rods, the reconstruction of the driving mechanism, the installation of standby neutron detector system, the acceptance and inspection of new fuel, and the transfer of spent fuel between pools were carried out. As scheduled, the core for irradiation attained the initial criticality on November 22, and the works of constructing the core were completed on December 23, 1982. Thereafter, the 100 MW performance test was begun. Various experience and valuable data were obtained in the regular inspection and the maintenance and repair works carried out at the same time, regarding the operation and maintenance of the Joyo facilities. (Kako, I.)
African Journals Online (AJOL)
Esem
3 Centre for Primary Care Research. Medical Journal of Zambia, Vol. 41, No. 2: 59 - 64 (2014) ... pollutants by inhaling second-hand tobacco smoke are at risk of adverse health ..... To put the measured PM levels into perspective, a. 2.5. 5.
International Nuclear Information System (INIS)
Altarelli, G.; Sjoestrand, T.; Zwirner, F.
1995-01-01
This is final report of the Workshop on Physics at LEP2, held at CERN during 1995. The first part of vol. 1 is devoted to aspects of machine physics of particular relevance to experiments, including the energy, luminosity and interaction regions, as well as the measurement of beam energy. The second part of vol. 1 is a relatively concise, but fairly complete, handbook on the physics of e + e - annihilation above the WW threshold and up to √s∼200 GeV. It contains discussions on WW cross-sections and distributions, W mass determination, Standard Model processes, QCD and gamma-gamma physics, as well as aspects of discovery physics, such as Higgs, new particle searches, triple gauge boson couplings and Z'. The second volume contains a review of the existing Monte Carlo generators for LEP2 physics. These include generators for WW physics, QCD and gamma-gamma processes, Bhabha scattering and discovery physics. A special effort was made to co-ordinate the different parts, with a view to achieving a systematic and balanced review of the subject, rather than just publishing a collection of separate contributions. (orig.)
International Nuclear Information System (INIS)
Altarelli, G.; Sjoestrand, T.; Zwirner, F.
1996-01-01
This is the final report of the Workshop on Physics at LEP2, held at CERN during 1995. The first part of vol. 1 is devoted to aspects of machine physics of particular relevance to experiments, including the energy, luminosity and interaction regions, as well as the measurement of beam energy. The second part of vol. 1 is a relatively concise, but fairly complete, handbook on the physics of e + e - annihilation above the WW threshold and up to √s∼200 GeV. It contains discussions on WW cross-sections and distributions, W mass determination, Standard Model processes, QCD and gamma-gamma physics, as well as aspects of discovery physics, such as Higgs, new particle searches, triple gauge boson couplings and Z'. The second volume contains a review of the existing Monte Carlo generators for LEP2 physics. These include generators for WW physics, QCD and gamma-gamma processes, Bhabha scattering and discovery physics. A special effort was made to co-ordinate the different parts, with a view to achieving a systematic and balanced review of the subject, rather than just publishing a collection of separate contributions. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Altarelli, G [ed.; Sjoestrand, T [ed.; Zwirner, F [ed.
1995-02-19
This is final report of the Workshop on Physics at LEP2, held at CERN during 1995. The first part of vol. 1 is devoted to aspects of machine physics of particular relevance to experiments, including the energy, luminosity and interaction regions, as well as the measurement of beam energy. The second part of vol. 1 is a relatively concise, but fairly complete, handbook on the physics of e{sup +}e{sup -} annihilation above the WW threshold and up to {radical}s{approx}200 GeV. It contains discussions on WW cross-sections and distributions, W mass determination, Standard Model processes, QCD and gamma-gamma physics, as well as aspects of discovery physics, such as Higgs, new particle searches, triple gauge boson couplings and Z`. The second volume contains a review of the existing Monte Carlo generators for LEP2 physics. These include generators for WW physics, QCD and gamma-gamma processes, Bhabha scattering and discovery physics. A special effort was made to co-ordinate the different parts, with a view to achieving a systematic and balanced review of the subject, rather than just publishing a collection of separate contributions. (orig.).
Volume pinning force and upper critical field of irradiated Nb3Sn
International Nuclear Information System (INIS)
Maier, P.; Seibt, E.
1981-01-01
Irradiation by neutrons and ions in A15 superconductors (Nb 3 Sn, V 3 Ga) exerts a stronger influence on the pinning behavior than in nonordered alloys (NbTi). In this work it is shown for deuteron irradiated Nb 3 /Sn wires prepared by the bronze process that the dose curve of the volume pinning force P/sub V/ can be conveniently described by a sum of two terms, due to the grain boundary pinning and to the radiation pinning, respectively. After deduction of the contribution by the radiation-induced pinning centers, good agreement is obtained between the measured P/sub V/ values and those calculated using the upper critical field B/sub c/2 and the transition temperature T/sub c/ on the basis of the irradiation fluence. The use of a theoretical relationship between B/sub c/2 and T/sub c/ is supported by measured values. Application to multifilamentary superconductors with high current carrying capabilities simplifies the calculation of P/sub V/, since the radiation induced volume pinning force can be neglected
Relaxation volumes of self-interstitial-atoms and vacancies in metals
International Nuclear Information System (INIS)
Ehrhart, P.
1983-01-01
Experimental results for the relaxation volumes of self-interstitial-atoms and vacancies as obtained after low temperature irradiation of different metals are reviewed. For fcc metals the relaxation volumes of the SIA's are very similar: ΔVsup(rel) = 1.6 +- 0.3 atomic volumes. This value is valid as well for the pure fcc metals (Al, Cu, Ni) as for different alloys. Vacancy relaxation volumes are small and vary between: ΔVsup(rel) = -0.05 and -0.25 atomic volumes. For bcc metals (Fe, Mo) the relaxation volume of the SIA is significantly smaller: ΔVsup(rel) = 1.1 +- 0.2 atomic volumes. In spite of the obvious similarity of the close-packed fcc and hcp structures, the SIA parameters for hcp metals are much different: ΔVsup(rel) = 3.5 for Zn, ΔVsup(rel) = 1.5 for Co and ΔVsup(rel) = 0.6 at. vol. for Zr. Vacancy relaxation volumes seem to be small as in cubic metals. The influence of lattice nonharmonicity on the validity of an extrapolation of the values determined at 6 K to higher temperatures is discussed. (author)
Mirror Advanced Reactor Study (MARS). Final report. Volume 1-B. Commercial fusion electric plant
International Nuclear Information System (INIS)
Donohue, M.L.; Price, M.E.
1984-07-01
Volume 1-B contains the following chapters: (1) blanket and reflector; (2) central cell shield; (3) central cell structure; (4) heat transport and energy conversion; (5) tritium systems; (6) cryogenics; (7) maintenance; (8) safety; (9) radioactivity, activation, and waste disposal; (10) instrumentation and control; (11) balance of plant; (12) plant startup and operation; (13) plant availability; (14) plant construction; and (15) economic analysis
Mirror Advanced Reactor Study (MARS). Final report. Volume 1-B. Commercial fusion electric plant
Energy Technology Data Exchange (ETDEWEB)
Donohue, M.L.; Price, M.E. (eds.)
1984-07-01
Volume 1-B contains the following chapters: (1) blanket and reflector; (2) central cell shield; (3) central cell structure; (4) heat transport and energy conversion; (5) tritium systems; (6) cryogenics; (7) maintenance; (8) safety; (9) radioactivity, activation, and waste disposal; (10) instrumentation and control; (11) balance of plant; (12) plant startup and operation; (13) plant availability; (14) plant construction; and (15) economic analysis.
Constituyentes volátiles del mango de azúcar
Bautista., Edgar; Duque, Carmenza; Torres, Rafael
2010-01-01
Empleando Extracción de Volátiles por Espacio de Cabeza Dinámico y Extracción Líquido-Líquido, se estudió el aroma del mango de azúcar (Mangifera indica L), variedad nativa Colombiana apreciada por su exquisito aroma y sabor. Estos dos métodos complementarios permifieron la identificación, por Cromatografía de Gases de Alta resolución y Cromatografía de Gases de Alta Resolución - Espectrometría de Masas, de 52 coinponentes, entre los cuales sobresalieron como mayoritarios el 3-careno, el b...
Directory of Open Access Journals (Sweden)
Yankui Sun
2016-03-01
Full Text Available With the introduction of spectral-domain optical coherence tomography (SD-OCT, much larger image datasets are routinely acquired compared to what was possible using the previous generation of time-domain OCT. Thus, there is a critical need for the development of three-dimensional (3D segmentation methods for processing these data. We present here a novel 3D automatic segmentation method for retinal OCT volume data. Briefly, to segment a boundary surface, two OCT volume datasets are obtained by using a 3D smoothing filter and a 3D differential filter. Their linear combination is then calculated to generate new volume data with an enhanced boundary surface, where pixel intensity, boundary position information, and intensity changes on both sides of the boundary surface are used simultaneously. Next, preliminary discrete boundary points are detected from the A-Scans of the volume data. Finally, surface smoothness constraints and a dynamic threshold are applied to obtain a smoothed boundary surface by correcting a small number of error points. Our method can extract retinal layer boundary surfaces sequentially with a decreasing search region of volume data. We performed automatic segmentation on eight human OCT volume datasets acquired from a commercial Spectralis OCT system, where each volume of datasets contains 97 OCT B-Scan images with a resolution of 496×512 (each B-Scan comprising 512 A-Scans containing 496 pixels; experimental results show that this method can accurately segment seven layer boundary surfaces in normal as well as some abnormal eyes.
1985-03-01
mound builders and their purported mystical society (1882, 1883, 1884a, 1884b, 1884c, 1884d, 1885, 1887a, 1887b, 1889a, 1889b, 1889c , 1889d, 1889e, 1890...Vol. 11: 32-61. 1889b The Animals Known to the Effigy Builders. The American Antiquarian and Oriental Journal. Vol. 11: 139-163. 1889c Burial Mounds
Boron doping induced thermal conductivity enhancement of water-based 3C-Si(B)C nanofluids.
Li, Bin; Jiang, Peng; Zhai, Famin; Chen, Junhong; Bei, Guo-Ping; Hou, Xinmei; Chou, Kuo-Chih
2018-06-04
In this paper, the fabrication and thermal conductivity of water-based nanofluids using boron (B) doped SiC as dispersions are reported. Doping B into β-SiC phase leads to the shrinkage of SiC lattice due to the substitution of Si atoms (radius: 0.134 nm) by smaller B atoms (radius: 0.095 nm). The presence of B in SiC phase also promotes crystallization and grain growth of obtained particles. The tailored crystal structure and morphology of B doped SiC nanoparticles are beneficial for the thermal conductivity improvement of the nanofluids by using them as dispersions. Serving B doped SiC nanoparticles as dispersions for nanofluids, a remarkable improvement of the stability was achieved in SiC-B6 nanofluid at pH 11 by means of the Zeta potential measurement. Dispersing B doped SiC nanoparticles in water based fluids, the thermal conductivity of the as prepared nanofluids containing only 0.3 vol. % SiC-B6 nanoparticles is remarkably raised up to 39.3 % at 30 °C compared to the base fluids and is further enhanced with the increased temperature. The main reasons for the improvement of thermal conductivity of SiC-B6 nanofluids are more stable dispersion and intensive charge ions vibration around the surface of nanoparticles as well as the enhanced thermal conductivity of the SiC-B dispersions. © 2018 IOP Publishing Ltd.
Resource Conservation and Recovery Act, Part B Permit Application
International Nuclear Information System (INIS)
1992-01-01
This report, Part B (Vol. 3) of the permit application for the WIPP facility, contains information related to the site characterization of the facility, including geology, design, rock salt evaluations, maps, drawings, and shaft excavations
Stephens, T. C.; Peacock, J. H.
1977-01-01
The relationship between tumour volume response and cell kill in B16 melanoma following treatment in vivo with cyclophosphamide (CY) and 1-(2-chloroethyl)-3-cyclohexyl-1-nitrosourea (CCNU) was investigated. Tumour volume response, expressed as growth delay, was estimated from measurements of tumour dimensions. Depression of in vitro colony-forming ability of cells from treated tumours was used as the measure of tumour cell kill. The relationship between these parameters was clearly different for the two agents studied. CY produced more growth delay (7.5 days) per decade of tumour cell kill than CCNU (2 to 3.5 days). The possibility that this was due to a technical artefact was rejected in favour of an alternative explanation that different rates of cellular repopulation in tumours treated with CY and CCNU might be responsible. Cellular repopulation was measured directly, by performing cell-survival assays at various times after treatment with doses of CY and CCNU which produced about 3 decades of cell kill. The rate of repopulation by clonogenic cells was much slower after treatment with CY than with CCNU, and this appears to account for the longer duration of the growth delay obtained with CY. PMID:921888
International Nuclear Information System (INIS)
Greco, Carlo; Mazzetta, Chiara; Cattani, Federica; Tosi, Giampiero; Castiglioni, Simona; Fodor, Andrei; Orecchia, Roberto
2003-01-01
Background and purpose: The rectum is known to display a dose-volume effect following high-dose 3D-conformal radiotherapy (3D-CRT). The aim of the study is to search for significant dose-volume combinations with the specific treatment technique and patient set-up currently used in our institution. Patients and methods: We retrospectively analyzed the dose-volume histograms (DVH) of 135 patients with stage T1b-T3b prostate cancer treated consecutively with 3D-CRT between 1996 and 2000 to a total dose of 76 Gy. The median follow-up was 28 months (range 12-62). All late rectal complications were scored using RTOG criteria. Time to late toxicity was assessed using the Kaplan-Meyer method. The association between variables at baseline and ≥2 rectal toxicity was tested using χ 2 test or Fisher's exact test. A multivariate analysis using logistic regression was performed. Results: Late rectal toxicity grade ≥2 was observed in 24 of the 135 patients (17.8%). A 'grey area' of increased risk has been identified. Average DVHs of the bleeding and non-bleeding patients were generated. The area under the percent volume DVH for the rectum of the bleeding patients was significantly higher than that of patients without late rectal toxicity. On multivariate analysis the correlation between the high risk DVHs and late rectal bleeding was confirmed. Conclusions: The present analysis confirms the role of the rectal DVH as a tool to discriminate patients undergoing high-dose 3D-CRT into a low and a high risk of developing late rectal bleeding. Based on our own results and taking into account the data published in the literature, we have been able to establish new dose-volume constraints for treatment planning: if possible, the percentage of rectal volume exposed to 40, 50, 60, 72 and 76 Gy should be limited to 60, 50, 25, 15 and 5%, respectively
International Nuclear Information System (INIS)
Sinha, Biswajit; Roy, Pran Kumar; Sarkar, Bipul Kumar; Brahman, Dhiraj; Roy, Mahendra Nath
2010-01-01
Apparent molar volumes φ V and viscosity B-coefficients for caffeine in (0.00, 0.03, 0.05, and 0.07) mol . dm -3 aqueous thorium nitrate, Th(NO 3 ) 4 , solutions were determined from solution density and viscosity measurements over the temperature range (298.15 to 318.15) K as function of concentration of caffeine and the relation: φ V 0 =a 0 +a 1 T+a 2 T 2 , have been used to describe the temperature dependence of the standard partial molar volumes φ V 0 . These results have been used to deduce the standard volumes of transfer Δφ V 0 and viscosity B-coefficients of transfer ΔB for caffeine from water to aqueous Th(NO 3 ) 4 solutions for rationalizing various interactions in the ternary solutions. The structure-making or breaking ability of caffeine has been discussed in terms of the sign of (δ 2 φ V 0 /δT 2 ) P . The Friedman-Krishnan co-sphere model was used to explain the transfer volume of caffeine with increasing Th(NO 3 ) 4 molarity. The activation parameters of viscous flow for the ternary solutions were also discussed in terms of transition state theory.
Bernhardt, Eduard; Finze, Maik; Willner, Helge
2011-10-17
The fluorination of K[B(CN)(4)] with ClF is studied by millimolar test reactions in aHF and CH(2)Cl(2) solution and by subsequent identification of intermediates such as B-CF═NCl, B-CF(2)-NCl(2), and B-CF(3) species as well as NCl(3) by (19)F, (11)B NMR, and Raman spectroscopy, respectively. At first one cyano group of K[B(CN)(4)] is converted fast into a CF(3) group, and with increasing fluorination the reaction becomes slower and several intermediates could be observed. On the basis of these results, a synthesis was developed for K[B(CF(3))(4)] on a 0.2 molar scale by treatment of K[B(CN)(4)] diluted in aHF with ClF. The course of the reactions was followed by (i) monitoring the vapor pressure inside the reactor, (ii) observing the heat dissipation during ClF uptake, and (iii) measuring the volume of the released nitrogen gas. Since the fluorination of the last cyano group proceeds very slowly, the selective synthesis of K[(CF(3))(3)BCN] on a 0.2 molar scale is possible, as well. The analysis of the mechanisms, thermodynamics, and kinetics of the fluorination reactions is supported by density functional theory (DFT) calculations.
Energy Technology Data Exchange (ETDEWEB)
Belli, Maria Luisa; Broggi, Sara [Ospedale San Raffaele Scientific Institute, Medical Physics, Milano (Italy); Scalco, Elisa; Rizzo, Giovanna [CNR, Istituto di Bioimmagini e Fisiologia Molecolare, Milano (Italy); Sanguineti, Giuseppe [Regina Elena National Cancer Institute, Department of Radiation Oncology, Rome (Italy); Fiorino, Claudio; Cattaneo, Giovanni Mauro [Ospedale San Raffaele Scientific Institute, Medical Physics, Milano (Italy); CNR, Istituto di Bioimmagini e Fisiologia Molecolare, Milano (Italy); Dinapoli, Nicola; Valentini, Vincenzo [Universita Cattolica del Sacro Cuore, Radiotherapy, Rome (Italy); Ricchetti, Francesco [Ospedale Sacro Cuore, Radiotherapy, Negrar (Italy)
2014-11-15
To quantitatively assess the predictive power of early variations of parotid gland volume and density on final changes at the end of therapy and, possibly, on acute xerostomia during IMRT for head-neck cancer. Data of 92 parotids (46 patients) were available. Kinetics of the changes during treatment were described by the daily rate of density (rΔρ) and volume (rΔvol) variation based on weekly diagnostic kVCT images. Correlation between early and final changes was investigated as well as the correlation with prospective toxicity data (CTCAEv3.0) collected weekly during treatment for 24/46 patients. A higher rΔρ was observed during the first compared to last week of treatment (-0,50 vs -0,05HU, p-value = 0.0001). Based on early variations, a good estimation of the final changes may be obtained (Δρ: AUC = 0.82, p = 0.0001; Δvol: AUC = 0.77, p = 0.0001). Both early rΔρ and rΔvol predict a higher ''mean'' acute xerostomia score (≥ median value, 1.57; p-value = 0.01). Median early density rate changes for patients with mean xerostomia score ≥ / < 1.57 were -0.98 vs -0.22 HU/day respectively (p = 0.05). Early density and volume variations accurately predict final changes of parotid glands. A higher longitudinally assessed score of acute xerostomia is well predicted by higher rΔρ and rΔvol in the first two weeks of treatment: best cut-off values were -0.50 HU/day and -380 mm{sup 3}/day for rΔρ and rΔvol respectively. Further studies are necessary to definitively assess the potential of early density/volume changes in identifying more sensitive patients at higher risk of experiencing xerostomia. (orig.) [German] Ziel der Studie ist die Untersuchung der praediktiven Aussagekraft von fruehen Veraenderungen in Volumen und Dichte der Ohrspeicheldruese in Bezug auf die finale Verformung zum Ende der Therapie sowie das Risiko von Xerostomie waehrend der intesitaetsmodulierten Strahlentherapie (IMRT) bei Kopf und Hals Tumoren. Die Studie
Directory of Open Access Journals (Sweden)
Martha Lopes Schuch de Castro
1996-12-01
Full Text Available O presente trabalho teve como objetivo determinar ainfluência do ano e mês de coleta sobre o volume (VOL, motilidade (MOT e doses de sêmen produzidas (DO, as correlações existentes entre as variáveis e as suas repetibilidades. Foram analisadas amostras de sêmen de 96 machos pertencentes as raças Landrace (41, Large White (31 e Duroc (24, durante o período (1981 a 1987 de permanência dos mesmos na Central de Inseminação Artificial de Suínos de Estrela - RS. O número de amostras dês sêmen coletadas foi de 7.264 da raça Landrace, 3.589 da raça Large White e 3.051 da raça Duroc. Os resultados mostraram haver influência (PThe aim of this experiment was to determine the influence of the collection period on volume (VOL, motility (MOT and semen doses (DO, and the correlation among the six variables and their repeatibilities. Semen samples from ninety (96 boars belonging to Landrace (41, Large White (31 and Duroc (24 breeds were analyzed, taken into account the permanence period (1981 to 1987 of the boars at the Artificial Insemination Center -Estrela - RS. The number of semen samples collected were: Landrace 7,264, Large White 3,589 and Duroc, 3,051. Year and month of collection had influence (P<0.01 on the variables analyzed. Minimum and maximum average values, within each breed, were VOL 236.9 and 300.4ml (Landrace, 238.1 and 284.1ml (Large White and 150.0 and 201.1ml (Duroc: MOT 79.2 and 80.3% (Landrace, 76.7 and 78.0% (Large White and 77.8 and 79.1% (Duroc; DO 12.0 and 14.7 (Landrace, 10.1 and 13.0 (Large White and 9.1 and 11.9 (Duroc, respectively. Correlations between VOL and DO were 0.30 (Landrace, 0.36 (Large White and 0.36 (Duroc. Correlations between VOL and MOT were close to zero (Landrace -0.05, Large White 0.03 and Duroc 0.01, and between MOT and DO were 0.08 (Landrace, 0.15 (Large White and 0.13 (Duroc. Repeatibilities were VOL 0.49 (Landrace, 0.59 (Large White and 0.54 (Duroc; MOT 0.18 (Landrace, 0.27 (Large White and
Promoting International Energy Security. Volume 3: Sea-Lanes to Asia
2012-01-01
set off tsunamis, as occurred in the Indian Ocean on December 26, 2004, when an earthquake and tsunami killed over 225,000 people. Natural events...in Somalia, the ability to counter the menagerie of gangs that currently plough the seas off the Horn of Africa will be minimal. Further, the...Promoting International Energy Security: Volume 3, Sea-Lanes to Asia sunk several Vietnamese ships, killing 70 Vietnamese sailors (EIA, 2008b). As states
Heliophysics 3 Volume Paperback Set
Schrijver, Carolus J.; Siscoe, George L.
2013-03-01
Volume 1: Preface; 1. Prologue Carolus J. Schrijver and George L. Siscoe; 2. Introduction to heliophysics Thomas J. Bogdan; 3. Creation and destruction of magnetic field Matthias Rempel; 4. Magnetic field topology Dana W. Longcope; 5. Magnetic reconnection Terry G. Forbes; 6. Structures of the magnetic field Mark B. Moldwin, George L. Siscoe and Carolus J. Schrijver; 7. Turbulence in space plasmas Charles W. Smith; 8. The solar atmosphere Viggo H. Hansteen; 9. Stellar winds and magnetic fields Viggo H. Hansteen; 10. Fundamentals of planetary magnetospheres Vytenis M. Vasyliunas; 11. Solar-wind magnetosphere coupling: an MHD perspective Frank R. Toffoletto and George L. Siscoe; 12. On the ionosphere and chromosphere Tim Fuller-Rowell and Carolus J. Schrijver; 13. Comparative planetary environments Frances Bagenal; Bibliography; Index. Volume 2: Preface; 1. Perspective on heliophysics George L. Siscoe and Carolus J. Schrijver; 2. Introduction to space storms and radiation Sten Odenwald; 3. In-situ detection of energetic particles George Gloeckler; 4. Radiative signatures of energetic particles Tim Bastian; 5. Observations of solar and stellar eruptions, flares, and jets Hugh Hudson; 6. Models of coronal mass ejections and flares Terry Forbes; 7. Shocks in heliophysics Merav Opher; 8. Particle acceleration in shocks Dietmar Krauss-Varban; 9. Energetic particle transport Joe Giacalone; 10. Energy conversion in planetary magnetospheres Vytenis Vasyliunas; 11. Energization of trapped particles Janet Green; 12. Flares, CMEs, and atmospheric responses Tim Fuller-Rowell and Stanley C. Solomon; 13. Energetic particles and manned spaceflight Stephen Guetersloh and Neal Zapp; 14. Energetic particles and technology Alan Tribble; Appendix I. Authors and editors; List of illustrations; List of tables; Bibliography; Index. Volume 3: Preface; 1. Interconnectedness in heliophysics Carolus J. Schrijver and George L. Siscoe; 2. Long-term evolution of magnetic activity of Sun
Metallic Corrosion. Vol. 1, 2 and 3
International Nuclear Information System (INIS)
1981-01-01
The three volumes of the Congress Proceedings form the basis for the discussion of the prevailing problems in all areas of applied and basic research and their application in evera-day life and industry. The sequence of the contents of the three volumes corresponds to the scientific and technical Congress topics. Volume I contains basic and applied research on corrosion processes, testing and prevention Volume II starts with corrosion protection techniques, covers solutions to problems in specific industrial fields, and collects papers on economics, education, information and R and D programmes. Volume III contains all plenary lectures held on various topics. (orig.)
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-09-01
The Y-12 Plant Decontamination and Decommissioning Technology Logic Diagram for Building 9201-4 (TLD) was developed to provide a decision-support tool that relates decontamination and decommissioning (D and D) problems at Bldg. 9201-4 to potential technologies that can remediate these problems. This TLD identifies the research, development, demonstration, testing, and evaluation needed for sufficient development of these technologies to allow for technology transfer and application to D and D and waste management (WM) activities. It is essential that follow-on engineering studies be conducted to build on the output of this project. These studies will begin by selecting the most promising technologies identified in the TLD and by finding an optimum mix of technologies that will provide a socially acceptable balance between cost and risk. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Volume 2 contains the logic linkages among environmental management goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 2 has been divided into five sections: Characterization, Decontamination, Dismantlement, Robotics/Automation, and Waste Management. Each section contains logical breakdowns of the Y-12 D and D problems by subject area and identifies technologies that can be reasonably applied to each D and D challenge.
International Nuclear Information System (INIS)
1994-09-01
The Y-12 Plant Decontamination and Decommissioning Technology Logic Diagram for Building 9201-4 (TLD) was developed to provide a decision-support tool that relates decontamination and decommissioning (D and D) problems at Bldg. 9201-4 to potential technologies that can remediate these problems. This TLD identifies the research, development, demonstration, testing, and evaluation needed for sufficient development of these technologies to allow for technology transfer and application to D and D and waste management (WM) activities. It is essential that follow-on engineering studies be conducted to build on the output of this project. These studies will begin by selecting the most promising technologies identified in the TLD and by finding an optimum mix of technologies that will provide a socially acceptable balance between cost and risk. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Volume 2 contains the logic linkages among environmental management goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 2 has been divided into five sections: Characterization, Decontamination, Dismantlement, Robotics/Automation, and Waste Management. Each section contains logical breakdowns of the Y-12 D and D problems by subject area and identifies technologies that can be reasonably applied to each D and D challenge
Laser Beam Shaping XIII, Proceedings of SPIE Vol. 8490
CSIR Research Space (South Africa)
Forbes, A
2012-09-01
Full Text Available .1117/12.2013615 Proc. of SPIE Vol. 8490 849001-1 Downloaded From: http://proceedings.spiedigitallibrary.org/ on 10/17/2012 Terms of Use: http://spiedl.org/terms The papers included in this volume were part of the technical conference cited on the cover and title..., Bellingham, Washington 98227-0010 USA Telephone +1 360 676 3290 (Pacific Time)? Fax +1 360 647 1445 SPIE.org Copyright ? 2012, Society of Photo-Optical Instrumentation Engineers. Copying of material in this book for internal or personal use...
TiB2/Al2O3 ceramic particle reinforced aluminum fabricated by spray deposition
International Nuclear Information System (INIS)
Chen Xing; Yang Chengxiao; Guan Leding; Yan Biao
2008-01-01
Aluminum matrix ceramic particle reinforced composites (AMCs) is a kind of composite with great importance. Aluminum matrix composite reinforced with TiB 2 /Al 2 O 3 ceramic particles was successfully in situ synthesized in Al-TiO 2 -B 2 O 3 system in this paper, using spray deposition with hot-press treatment technique. Five groups of composites with different reinforcement volume contents were prepared and the comparisons of porosity, ultimate tensile strength (UTS), elongation and Brinell hardness (BH) between the composites with and without hot-press treating were carried out. The composite with 21.0% reinforcement volume content was analyzed by X-ray diffraction (XRD), Environmental Scanning Electron Microscope (ESEM), Transmission Electron Microscope (TEM) and Energy Disperse Spectroscopy (EDS). The results revealed the formation and uniform distribution of fine reinforcements in the matrix after hot-press treating, while a new intermetallic phase Al 3 Ti was found besides TiB 2 /Al 2 O 3 ceramic phase
Trends in laboratory test volumes for Medicare Part B reimbursements, 2000-2010.
Shahangian, Shahram; Alspach, Todd D; Astles, J Rex; Yesupriya, Ajay; Dettwyler, William K
2014-02-01
Changes in reimbursements for clinical laboratory testing may help us assess the effect of various variables, such as testing recommendations, market forces, changes in testing technology, and changes in clinical or laboratory practices, and provide information that can influence health care and public health policy decisions. To date, however, there has been no report, to our knowledge, of longitudinal trends in national laboratory test use. To evaluate Medicare Part B-reimbursed volumes of selected laboratory tests per 10,000 enrollees from 2000 through 2010. Laboratory test reimbursement volumes per 10,000 enrollees in Medicare Part B were obtained from the Centers for Medicare & Medicaid Services (Baltimore, Maryland). The ratio of the most recent (2010) reimbursed test volume per 10,000 Medicare enrollees, divided by the oldest data (usually 2000) during this decade, called the volume ratio, was used to measure trends in test reimbursement. Laboratory tests with a reimbursement claim frequency of at least 10 per 10,000 Medicare enrollees in 2010 were selected, provided there was more than a 50% change in test reimbursement volume during the 2000-2010 decade. We combined the reimbursed test volumes for the few tests that were listed under more than one code in the Current Procedural Terminology (American Medical Association, Chicago, Illinois). A 2-sided Poisson regression, adjusted for potential overdispersion, was used to determine P values for the trend; trends were considered significant at P reimbursement volumes were electrolytes, digoxin, carbamazepine, phenytoin, and lithium, with volume ratios ranging from 0.27 to 0.64 (P reimbursement volumes were meprobamate, opiates, methadone, phencyclidine, amphetamines, cocaine, and vitamin D, with volume ratios ranging from 83 to 1510 (P reimbursement volumes increased for most of the selected tests, other tests exhibited statistically significant downward trends in annual reimbursement volumes. The observed
Egyptian Journal of Medical Human Genetics - Vol 13, No 2 (2012)
African Journals Online (AJOL)
Egyptian Journal of Medical Human Genetics - Vol 13, No 2 (2012) ... as independent indicators for B-CLL: Correlation to response to treatment and disease ... Profile of disorders of sexual differentiation in the Northeast region of Cairo, Egypt ...
An annular BF3 counter of large sensitive volume
International Nuclear Information System (INIS)
Janardhanan, S.; Swaminathan, N.
1975-01-01
An annular neutron counter having a large sensitive volume with inner and outer diameter 31 cms with multiple electrode system fabricated especially to measure the neutron output from fissile region of standard fast reactor fuel of length nearly equivalent to 500 cms is described. The counter efficiency is nearly 0.3% for neutron and sensitivity 0.0018 counts/neutron for (alpha, neutron) and spontaneous fission source. Its other potential applications which are indicated are : (1) quality control of fast reactor fuel pins (2) fuel inventory (3) assessing radioactivity of solid waste packets containing PuO 2 (4) uniformity of fuel loading of a reactor and (5) neutron monitoring in a fuel plant. (M.G.B.)
International Nuclear Model. Volume 3. Program description
International Nuclear Information System (INIS)
Andress, D.
1985-01-01
This is Volume 3 of three volumes of documentation of the International Nuclear Model (INM). This volume presents the Program Description of the International Nuclear Model, which was developed for the Nuclear and Alternate Fuels Division (NAFD), Office of Coal, Nuclear, Electric and Alternate Fuels, Energy Information Administration (EIA), US Department of Energy (DOE). The International Nuclear Model (INM) is a comprehensive model of the commercial nuclear power industry. It simulates economic decisions for reactor deployment and fuel management decision based on an input set of technical economic and scenario parameters. The technical parameters include reactor operating characteristics, fuel cycle timing and mass loss factors, and enrichment tails assays. Economic parameters include fuel cycle costs, financial data, and tax alternatives. INM has a broad range of scenario options covering, for example, process constraints, interregional activities, reprocessing, and fuel management selection. INM reports reactor deployment schedules, electricity generation, and fuel cycle requirements and costs. It also has specialized reports for extended burnup and permanent disposal. Companion volumes to Volume 3 are: Volume 1 - Model Overview, and Volume 2 - Data Base Relationships
Pournara, Lizzy
2017-01-01
Ramón Reichert and Annika Richterich, eds., Digital Material/ism Vol. 1, Issue 1 – Digital Culture and Society Bielefeld: [transcript] Verlag, 2015. ISBN 978-3-8376-3153-1. Lizzy Pournara Aristotle University of Thessaloniki The issue Digital Material/ism edited by Ramón Reichert and Annika Richterich inaugurates the first volume of the journal Digital Culture & Society. The significance of this volume’s work lies in its attempt to redress the concept of materiality in digital environments an...
Attitudes and Awareness Regarding Hepatitis B and Hepatitis C ...
African Journals Online (AJOL)
Annals of Medical and Health Sciences Research | Oct-Dec 2013 | Vol 3 | Issue 4 |. 551. Address for ... and even death.[1] In South‑East Asian Region, there are .... interns, and nursing interns regarding hepatitis B and C and to compare their ...
International Nuclear Information System (INIS)
1983-01-01
Volume II B contains appendices for: flight line maps; geology maps; explanation of geologic legend; flight line/geology maps; radiometric contour maps; magnetic contour maps; and geochemical factor analysis maps
Energy Technology Data Exchange (ETDEWEB)
NONE
1992-12-15
Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Detailed information about the technical basis for the preliminary comparison is contained in Volume 2. The reference data base and values for input parameters used in the modeling system are contained in Volume 3. Uncertainty and sensitivity analyses related to 40 CFR 191B are contained in Volume 4. Volume 5 contains uncertainty and sensitivity analyses of gas and brine migration for undisturbed performance. Finally, guidance derived from the entire 1992 performance assessment is presented in Volume 6. Results of the 1992 performance assessment are preliminary, and are not suitable for final comparison with 40 CFR 191, Subpart B. Portions of the modeling system and the data base remain incomplete, and the level of confidence in the performance estimates is not sufficient for a defensible compliance evaluation. Results are, however, suitable for providing guidance to the WIPP Project. All results are conditional on the models and data used, and are presented for preliminary comparison to the Containment Requirements of 40 CFR 191, Subpart B as mean complementary cumulative distribution functions (CCDFs) displaying estimated probabilistic releases of radionuclides to the accessible environment. Results compare three conceptual models for
International Nuclear Information System (INIS)
1992-12-01
Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Detailed information about the technical basis for the preliminary comparison is contained in Volume 2. The reference data base and values for input parameters used in the modeling system are contained in Volume 3. Uncertainty and sensitivity analyses related to 40 CFR 191B are contained in Volume 4. Volume 5 contains uncertainty and sensitivity analyses of gas and brine migration for undisturbed performance. Finally, guidance derived from the entire 1992 performance assessment is presented in Volume 6. Results of the 1992 performance assessment are preliminary, and are not suitable for final comparison with 40 CFR 191, Subpart B. Portions of the modeling system and the data base remain incomplete, and the level of confidence in the performance estimates is not sufficient for a defensible compliance evaluation. Results are, however, suitable for providing guidance to the WIPP Project. All results are conditional on the models and data used, and are presented for preliminary comparison to the Containment Requirements of 40 CFR 191, Subpart B as mean complementary cumulative distribution functions (CCDFs) displaying estimated probabilistic releases of radionuclides to the accessible environment. Results compare three conceptual models for
1993-09-24
de Quimica Pura y Aplicada, Monterrey N.L., 1990. No. 47. 3.- 8. Valdez, G. Guerra, J. Sampedro, N. Rosas. CORROSION, Vol. 2, No. 3, 1991, pp. 11-15...AISI 304L AND 316L STAINLESS STEELS PREPARED BY POWDER METALLURGY. E. Otero Departamento de Ciencia de Materiales Facultad de Ciencias Quimicas ...Madrid, Spain. V. Utrilla Departamento de Ciencia de Materiales Facultad de Ciencias Quimicas Universidad Complutense 28040-Madrid, Spain. E. Sfienz
Recommendations of the Reactor Safety Commission (RSK) 1975-1977. Vol. 3
International Nuclear Information System (INIS)
Schneider, M.
1978-08-01
After the recommendations are published in the 'Bundesanzeiger' the Office of the RSK publishes them as a closed report, by order of the Federal Minister of the Interior. The reports are devided in two parts: Part I contains the recommendations which are given by the RSK; part II contains the official notices concerning the RSK. There also is a subject index. Three volumes are published by now: Volume 1: IRS-A-9 (December 1975), Recommendations of the RSK 1971 to 1974 (68th to 96th meeting), pages: I-1 to I-116 and II-1 to II-23 appendix a: RSK-guide lines for PWR, edition 04.74; Volume 2: IRS-A-11 (August 1976), Recommendations of the RSK 1974 to 1975, (97th to 105th meeting), pages: I-117 to I-145; Volume 3: GRS-12 (August 1978), Recommendations of the RSK 1975 to 1977 (106th to 129th meeting), pages: I-146 to I-276 and II-24 to II-25. Volume 3 also contains the recommendation on German Fuel Cycle Center which was given by the Reactor Safety Commision (RSK) in community with the Radiological Protection Commission (SSK), in autumn 1977. (orig./HP) 891 HP [de
International Nuclear Information System (INIS)
Ulrich, B.
1989-01-01
In the two lecture volumes of the Proceedings of the International Congress on Forest Decline Research the papers are presented according to the topics of the plenary and poster sessions. The sessions had been devoted to the damage symptoms in forest decline, to the main stressors (atmosphere, climate, soil, biota), to the effects of the stressors (on rhizosphere, on decomposers, and on plants) (see vol. 1), to case studies (in Germany and abroad), to regional comparisons, to critical loads, and to silvicultural measures (see vol. 2). Additionally personal impressions about the forest decline phenomen in Germany and its causes and opinions about the perspective in regard to research needs, to silvicultural practices and to emission control are given. (orig./vhe)
International Nuclear Information System (INIS)
Ulrich, B.
1989-01-01
In the two lecture volumes of the Proceedings of the International Congress on Forest Decline Research the papers are presented according to the topics of the plenary and poster sessions. The sessions had been devoted to the damage symptoms in forest decline, to the main stressors (atmosphere, climate, soil, biota), to the effects of the stressors (on rhizosphere, on decomposers, and on plants) (see vol. 1), to case studies (in Germany and abroad), to regional comparisons, to critical loads, and to silvicultural measures (see vol. 2). Additionally personal impressions about the forest decline phenomen in Germany and its causes and opinions about the perspective in regard to research needs, to silvicultural practices and to emission control are given. (orig./vhe)
International Nuclear Information System (INIS)
Sydoff, Marie; Andersson, Martin; Mattsson, Sören; Leide-Svegborn, Sigrid
2014-01-01
Positron emission tomography (PET) with 18 F-FDG is a valuable tool for staging, planning treatment, and evaluating the treatment response for many different types of tumours. The correct volume estimation is of utmost importance in these situations. To date, the most common types of phantoms used in volume quantification in PET utilize fillable, hollow spheres placed in a circular or elliptical cylinder made of polymethyl methacrylate. However, the presence of a non-radioactive sphere wall between the hotspot and the background activity in images of this type of phantom could cause inaccuracies. To investigate the influence of the non-active walls, we developed a phantom without non-active sphere walls for volume delineation and quantification in PET. Three sizes of gelatin hotspots were moulded and placed in a Jaszczak phantom together with hollow plastic spheres of the same sizes containing the same activity concentration. 18 F PET measurements were made with zero background activity and with tumour-to-background ratios of 12.5, 10, 7.5, and 5. The background-corrected volume reproducing threshold, T vol , was calculated for both the gelatin and the plastic spheres. It was experimentally verified that the apparent background dependence of T vol , i.e., a decreasing T vol with increasing background fraction, was not present for wall-less spheres; the opposite results were seen in plastic, hollow spheres in commercially-available phantoms. For the types of phantoms commonly used in activity quantification, the estimation of T vol using fillable, hollow, plastic spheres with non-active walls would lead to an overestimate of the tumour volume, especially for small volumes in a high activity background. (paper)
HDPE-Al2O3-HAp composites for biomedical applications: processing and characterizations.
Nath, Shekhar; Bodhak, Subhadip; Basu, Bikramjit
2009-01-01
The objective of this work is to demonstrate how the stiffness, hardness, as well as the biocompatibility property, of bioinert high-density polyethylene (HDPE) can be significantly improved by the combined addition of both bioinert and bioactive ceramic fillers. For this purpose, different volume fractions of hydroxyapatite and alumina, limited to a total of 40 vol %, have been incorporated in HDPE matrix. All the hybrid composites and monolithic HDPE were developed under optimized hot pressing condition (130 degrees C, 0.5 h, 92 MPa pressure). The results of the mechanical property characterization reveal that higher elastic modulus (6.2 GPa) and improved hardness (226.5 MPa) could be obtained in the developed HDPE-20 vol %-HAp-20 vol % Al(2)O(3) composite. Under the selected fretting conditions against various counterbody materials (steel, Al(2)O(3), and ZrO(2)), an extremely low COF of (0.07-0.11) and higher wear resistance (order of 10(-6) mm(3)/Nm) are obtained with the HDPE/20 vol % HAp/20 vol % Al(2)O(3) composite in both air and simulated body fluid environment. Importantly, in-vitro cell culture study using L929 fibroblast cells confirms favorable cell adhesion properties in the developed hybrid composite. (c) 2008 Wiley Periodicals, Inc.
Physics Letters B, Volume 716, Issue 1- Cover Page
CERN
2012-01-01
The cover page of the Physics Letters B Journal, Volume 716, Issue 1, dedicated to the observation of a new particle in the search for the Standard Model Higgs boson. To celebrate this historical discovery, Elsevier reprinted the ATLAS and the CMS articles together with a foreword by Peter Higgs and the other scientists that predicted the existence of the so-called Higgs boson and published this in a separate booklet.
Quantifying Standing Dead Tree Volume and Structural Loss with Voxelized Terrestrial Lidar Data
Popescu, S. C.; Putman, E.
2017-12-01
Standing dead trees (SDTs) are an important forest component and impact a variety of ecosystem processes, yet the carbon pool dynamics of SDTs are poorly constrained in terrestrial carbon cycling models. The ability to model wood decay and carbon cycling in relation to detectable changes in tree structure and volume over time would greatly improve such models. The overall objective of this study was to provide automated aboveground volume estimates of SDTs and automated procedures to detect, quantify, and characterize structural losses over time with terrestrial lidar data. The specific objectives of this study were: 1) develop an automated SDT volume estimation algorithm providing accurate volume estimates for trees scanned in dense forests; 2) develop an automated change detection methodology to accurately detect and quantify SDT structural loss between subsequent terrestrial lidar observations; and 3) characterize the structural loss rates of pine and oak SDTs in southeastern Texas. A voxel-based volume estimation algorithm, "TreeVolX", was developed and incorporates several methods designed to robustly process point clouds of varying quality levels. The algorithm operates on horizontal voxel slices by segmenting the slice into distinct branch or stem sections then applying an adaptive contour interpolation and interior filling process to create solid reconstructed tree models (RTMs). TreeVolX estimated large and small branch volume with an RMSE of 7.3% and 13.8%, respectively. A voxel-based change detection methodology was developed to accurately detect and quantify structural losses and incorporated several methods to mitigate the challenges presented by shifting tree and branch positions as SDT decay progresses. The volume and structural loss of 29 SDTs, composed of Pinus taeda and Quercus stellata, were successfully estimated using multitemporal terrestrial lidar observations over elapsed times ranging from 71 - 753 days. Pine and oak structural loss rates
Rodriguez-Borja, Enrique; Corchon-Peyrallo, Africa; Barba-Serrano, Esther; Villalba Martínez, Celia; Carratala Calvo, Arturo
2018-02-03
We assessed the impact of several "send & hold" clinical decision support rules (CDSRs) within the electronical request system for vitamins A, E, K, B1, B2, B3, B6 and C for all outpatients at a large health department. When ordered through electronical request, providers (except for all our primary care physicians who worked as a non-intervention control group) were always asked to answer several compulsory questions regarding main indication, symptomatology, suspected diagnosis, vitamin active treatments, etc., for each vitamin test using a drop-down list format. After samples arrival, tests were later put on hold internally by our laboratory information system (LIS) until review for their appropriateness was made by two staff pathologists according to the provided answers and LIS records (i.e. "send & hold"). The number of tests for each analyte was compared between the 10-month period before and after CDSRs implementation in both groups. After implementation, vitamins test volumes decreased by 40% for vitamin A, 29% for vitamin E, 42% for vitamin K, 37% for vitamin B1, 85% for vitamin B2, 68% for vitamin B3, 65% for vitamin B6 and 59% for vitamin C (all p values 0.03 or lower except for vitamin B3), whereas in control group, the majority increased or remained stable. In patients with rejected vitamins, no new requests and/or adverse clinical outcome comments due to this fact were identified. "Send & hold" CDSRs are a promising informatics tool that can support in utilization management and enhance the pathologist's leadership role as tests specialist.
Characterization of Class A low-level radioactive waste 1986--1990. Volume 3: Main report -- Part B
Energy Technology Data Exchange (ETDEWEB)
Dehmel, J.C.; Loomis, D.; Mauro, J. [S. Cohen & Associates, Inc., McLean, VA (United States); Kaplan, M. [Eastern Research Group, Inc., Lexington, MA (United States)
1994-01-01
Under contract to the US Nuclear Regulatory Commission, Office of Nuclear Regulatory Research, the firms of S. Cohen & Associates, Inc. (SC&A) and Eastern Research Group (ERG) have compiled a report that describes the physical, chemical, and radiological properties of Class-A low-level radioactive waste. The report also presents information characterizing various methods and facilities used to treat and dispose non-radioactive waste. A database management program was developed for use in accessing, sorting, analyzing, and displaying the electronic data provided by EG&G. The program was used to present and aggregate data characterizing the radiological, physical, and chemical properties of the waste from descriptions contained in shipping manifests. The data thus retrieved are summarized in tables, histograms, and cumulative distribution curves presenting radionuclide concentration distributions in Class-A waste as a function of waste streams, by category of waste generators, and regions of the United States. The report also provides information characterizing methods and facilities used to treat and dispose non-radioactive waste, including industrial, municipal, and hazardous waste regulated under Subparts C and D of the Resource Conservation and Recovery Act (RCRA). The information includes a list of disposal options, the geographical locations of the processing and disposal facilities, and a description of the characteristics of such processing and disposal facilities. Volume 1 contains the Executive Summary, Volume 2 presents the Class-A waste database, Volume 3 presents the information characterizing non-radioactive waste management practices and facilities, and Volumes 4 to 7 contain Appendices A to P with supporting information.
European utility requirements (EUR) volume 3 assessment for AP1000
International Nuclear Information System (INIS)
Saiu, G.; Demetri, K.J.
2005-01-01
The EUR (European Utility Requirements) Volume 3 is intended to report the Plant Description, the Compliance Assessment to EUR Volumes 1 and 2, and finally, the Specific Requirements for each specific Nuclear Power Plant Design considered by the EUR. Five subsets of EUR Volume 3, based on EUR Revision B, are already published; all of which are next generation plant designs being developed for Europe beyond 2000. They include : 1) EP1000 - Passive Pressurized Light Water Reactor (3-Loop, 1000 MWe) 2) EPR - Evolutionary Pressurized Light Water Reactor (1500 MWe) 3) BWR90/90+ - Evolutionary Boiling Water Reactor (1400 MWe) 4) ABWR - Evolutionary Boiling Water Reactor (1400 MWe) 5) SWR 1000 - Boiling Water Reactor With Passive Features (1000 MWe) In addition, the following subsets are currently being developed: 1) AP1000 - Passive Pressurized Light Water Reactor (2-Loop, 1117 MWe) 2) VVER AES 92 - Pressurized Water Reactor With Passive Features (1000 MWe) The purpose of this paper is to provide an overview of the program, which started in January 2004 with the EUR group to prepare an EUR Volume 3 Subset for the AP1000 nuclear plant design. The AP1000 EUR compliance assessment, to be performed against EUR Revision C requirements, is an important step for the evaluation of the AP1000 design for application in Europe. The AP1000 compliance assessment is making full use of AP1000 licensing documentation, EPP Phase 2 design activities and EP1000 EUR detailed compliance assessment. As of today, nearly all of the EUR Chapters have been discussed within the EUR Coordination Group. Based on the results of the compliance assessment, it can be stated that the AP1000 design shows a good level of compliance with the EUR Revision C requirements. Nevertheless, the compliance assessment has highlighted areas for where the AP1000 plant deviates from the EUR. The EPP design group has selected the most significant ones for performing detailed studies to quantify the degree of compliance
A general multiblock Euler code for propulsion integration. Volume 1: Theory document
Chen, H. C.; Su, T. Y.; Kao, T. J.
1991-01-01
A general multiblock Euler solver was developed for the analysis of flow fields over geometrically complex configurations either in free air or in a wind tunnel. In this approach, the external space around a complex configuration was divided into a number of topologically simple blocks, so that surface-fitted grids and an efficient flow solution algorithm could be easily applied in each block. The computational grid in each block is generated using a combination of algebraic and elliptic methods. A grid generation/flow solver interface program was developed to facilitate the establishment of block-to-block relations and the boundary conditions for each block. The flow solver utilizes a finite volume formulation and an explicit time stepping scheme to solve the Euler equations. A multiblock version of the multigrid method was developed to accelerate the convergence of the calculations. The generality of the method was demonstrated through the analysis of two complex configurations at various flow conditions. Results were compared to available test data. Two accompanying volumes, user manuals for the preparation of multi-block grids (vol. 2) and for the Euler flow solver (vol. 3), provide information on input data format and program execution.
Characterization of microstructure and properties of Al–Al3Zr–Al2O3 ...
Indian Academy of Sciences (India)
2016-08-26
Aug 26, 2016 ... Bulletin of Materials Science. Current Issue : Vol. 39, Issue 6. Current Issue Volume 39 | Issue 6. October 2016. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
Plasma diagnostics package. Volume 2: Spacelab 2 section. Part B: Thesis projects
Pickett, Jolene S. (Compiler); Frank, L. A. (Compiler); Kurth, W. S. (Compiler)
1988-01-01
This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, 1985, through June 30, 1988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). Three Master's and three Ph.D. theses were written using PDP instrumentation data. These theses are listed in Volume 2, Part B.
Human immunodeficiency virus and hepatitus B virus co-infection ...
African Journals Online (AJOL)
Human immunodeficiency virus and hepatitus B virus co-infection amog patients in Kano Nigeria. EE Nwokedi, MA Emokpae, AI Dutse. Abstract. No Abstract. Nigerian Journal of Medicine Vol. 15(3) July-September 2006: 227-229. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...
International Nuclear Information System (INIS)
Zhang Jianfeng; Wang Lianjun; Jiang Wan; Chen Lidong
2008-01-01
Spark plasma sintering technique was used to in situ fabricate high dense Ti 3 SiC 2 -TiC composites. The calculated TiC volume content from X-ray diffraction (XRD) is close to the theoretical one. It is found from fracture surface observation that TiC is about 1 μm, and Ti 3 SiC 2 is about 2-10 μm in grain size. The fracture modes consist of intergranular mainly for Ti 3 SiC 2 and transgranular fracture mainly for TiC. With the increasing of TiC volume content, Vickers hardness increases to the maximum value of 13 GPa for Ti 3 SiC 2 -40 vol.%TiC. Fracture toughness and flexural strength of the composites are also improved compared with those of monolithic Ti 3 SiC 2 except for Ti 3 SiC 2 -40 vol.%TiC composite. The main reasons for the sudden decrease of fracture toughness and flexural strength of Ti 3 SiC 2 -40 vol.%TiC composite can be attributed to the relatively lower density, some clusters of TiC in the composite and the transition of fracture mode from intergranular to transgranular. The thermal conductivities decreased with the addition of TiC. The minimum thermal conductivity is 22 W m deg. C -1 for Ti 3 SiC 2 -40 vol.%TiC composite
Ito, Miwako; Maruyama-Funatsuki, Wakako; Ikeda, Tatsuya M; Nishio, Zenta; Nagasawa, Koichi; Tabiki, Tadashi
2015-06-01
We investigated the relationships of three allelic variations in Glu-B3 (ab, g, and h) with dough properties and bread-making quality-related characteristics using near-isogenic lines (NILs) of 'Yumechikara' that commonly carry Glu-A1a, Glu-B1b, Glu-D1d, Glu-A3f, Glu-B3ab and Glu-D3a. Measurement of peak time (PT) in a 2-g mixograph indicated that Glu-B3g was the most effective for a strong dough property, followed by Glu-B3ab, with Glu-B3h being the least effective. The results of measurement of mixing time during bread-making were similar to those for PTs, i.e., the lines carrying Glu-B3g showed the longest mixing time, followed by those of Glu-B3ab, and those of Glu-B3h showed the shortest mixing time. Since two parameters of bread-making quality, loaf volume (LV) and specific loaf volume (SLV), were affected by flour protein contents in all groups of the Glu-B3 genotype, we compared the effects of the three Glu-B3 alleles on those parameters using analysis of covariance (ANCOVA) to remove the effect of protein content. The results indicated that the Glu-B3h group showed the largest SLV, followed by the Glu-B3ab group, and the Glu-B3g group showed the smallest SLV. These results suggest that the introduction of Glu-B3h into 'Yumechikara' makes it possible to breed varieties with good bread-making quality-related characteristics.
Serum levels of INSL3, AMH, Inhibin B and Testosterone during pubertal transition in healthy boys
DEFF Research Database (Denmark)
Lindhardt Johansen, Marie; Anand-Ivell, Ravinder; Mouritsen, Annette
2014-01-01
to luteinizing hormone (LH), follicle-stimulating hormone (FSH), testosterone, inhibin B, and anti-Müllerian hormone (AMH) during puberty in healthy boys.MethodsTen boys were included from the longitudinal part of the COPENHAGEN Puberty Study. Pubertal evaluation, including testicular volume, was performed...... and blood samples drawn every 6 months for 5 years. Serum concentrations of testosterone were determined by a newly developed LC-MS/MS method, and serum concentrations of INSL3, AMH, inhibin B, FSH and LH, respectively, were determined by validated immunoassays.ResultsSerum INSL3 levels increased...... progressively with increasing age, pubertal onset and testicular volume. In six of ten boys, LH increased prior to the first observed increase in INSL3. In the remaining four boys, the increase in LH and INSL3 was observed at the same examination. The increases in serum concentrations of LH, testosterone...
Performance of diesel engine using diesel B3 mixed with crude palm oil.
Namliwan, Nattapong; Wongwuttanasatian, Tanakorn
2014-01-01
The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5-17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7-33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6-52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NO X ) emissions when using mixed fuels were 10-39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine).
Electrification Beyond Light Duty: Class 2b-3 Commercial Vehicles
Energy Technology Data Exchange (ETDEWEB)
Birky, Alicia [Energetics Incorporated; Laughlin, Michael [Energetics Incorporated; Tartaglia, Katie [Energetics Incorporated; Price, Rebecca [Energetics Incorporated; Lim, Brandon [Energetics Incorporated; Lin, Zhenhong [ORNL
2018-01-01
The class 2b-3 truck market covers a wide range of commercial truck applications across a half-million vehicle sales annually. This report collected public information and stakeholder input to assess the opportunity for electrification in this market. Although class 2b-3 pickup truck and van bodies are very similar to personal light vehicles, their functional requirements are quite different due to the demands of the commercial market. These demands vary by application and often vary from day to day for a single application. Fleet customers purchase these vehicles to perform a particular job for their business and are concerned about the overall cost of doing that job. Therefore, the vehicles must meet the job requirements cost effectively. Customers also are sensitive to initial cost. Electrification offers the potential to reduce vehicle operating costs and possibly improve vehicle functionality. However, the current market for class 2b-3 electrified trucks is very small, and the trucks are costly. Increased production volumes are key to cost reductions and may be assisted by sharing components with larger or smaller truck classes. Expanding demand is also crucial and stakeholders identified several niche markets with duty cycles that are likely well-suited to electrified class 2b-3 trucks. To expand beyond these niches, class 2b-3 electric solutions must be robust, flexible, and adaptable in order to cover a wide range of vocations, applications, and duty cycles.
MRI Volume Fusion Based on 3D Shearlet Decompositions.
Duan, Chang; Wang, Shuai; Wang, Xue Gang; Huang, Qi Hong
2014-01-01
Nowadays many MRI scans can give 3D volume data with different contrasts, but the observers may want to view various contrasts in the same 3D volume. The conventional 2D medical fusion methods can only fuse the 3D volume data layer by layer, which may lead to the loss of interframe correlative information. In this paper, a novel 3D medical volume fusion method based on 3D band limited shearlet transform (3D BLST) is proposed. And this method is evaluated upon MRI T2* and quantitative susceptibility mapping data of 4 human brains. Both the perspective impression and the quality indices indicate that the proposed method has a better performance than conventional 2D wavelet, DT CWT, and 3D wavelet, DT CWT based fusion methods.
MRI Volume Fusion Based on 3D Shearlet Decompositions
Directory of Open Access Journals (Sweden)
Chang Duan
2014-01-01
Full Text Available Nowadays many MRI scans can give 3D volume data with different contrasts, but the observers may want to view various contrasts in the same 3D volume. The conventional 2D medical fusion methods can only fuse the 3D volume data layer by layer, which may lead to the loss of interframe correlative information. In this paper, a novel 3D medical volume fusion method based on 3D band limited shearlet transform (3D BLST is proposed. And this method is evaluated upon MRI T2* and quantitative susceptibility mapping data of 4 human brains. Both the perspective impression and the quality indices indicate that the proposed method has a better performance than conventional 2D wavelet, DT CWT, and 3D wavelet, DT CWT based fusion methods.
International Nuclear Information System (INIS)
Krige, J.
1996-01-01
The present volume continues the story of the history of the European Organization for Nuclear Research (CERN) in Geneva, Switzerland, concentrating on the years between the mid 1960s and the late 1970s. Whereas the first two volumes were the product of a team of historians, this book is rather a collection of studies by authors with very different professional backgrounds and institutional locations. It also differs from the predecessor volumes in the fact that it consists of distinct case studies dealing with a number of issues deemed important. The first part of this volume, containing contributions by historians of science, perceives the laboratory as being at the node of a complex of interconnected relationships between scientists and science managers on the staff, the users in the member states, and the governments which were called upon to finance the laboratory. In part 2 the physical results, obtained at CERN, are surveyed, while in part 3 two chapters are presented, one on engineering and technology, and the other on the research and development of electronic position detectors
1995-01-01
Ammunition for cannon with illu- to fight fires minating projectile started by Ammunition for cannon with incen- explosion. diary projectile...OSNABURG Ozu Aya JEAN 146 DoD 4100.39-M Volume 3 APPENDIX 3-3-B SAMPLE OF NEW CONCEPT FIIG FIIG SAMPLE INC 00000 APPENDIX C Table 32 Palm Beach PLAIN
Search for anomalous W t b couplings in single top quark production ...
Indian Academy of Sciences (India)
Pramana – Journal of Physics. Current Issue : Vol. 90, Issue 4 · Current Issue Volume 90 | Issue 4. April 2018. Home · Volumes & Issues · Special Issues · Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
International and Domestic Market Opportunities for Biomass Power: Volumes I and II
Energy Technology Data Exchange (ETDEWEB)
1998-09-01
This report examines the domestic and international markets for biopower. Domestic and foreign markets present fundamentally different challenges to private power developers. Volume I focuses on the domestic market for biopower. The domestic challenge lies in finding economically viable opportunities for biopower. Vol. I outlines the current state of the U.S. biomass industry, discusses policies affecting biomass development, describes some demonstration projects currently underway, and discusses the future direction of the industry. Volume II focuses on the international market for biopower. Recent literature states that the electricity investment and policy climate in foreign markets are the key elements in successful private project development. Vol. II discusses the financing issues, policy climate, and business incentives and barriers to biopower development. As India and China are the largest future markets for biopower, they are the focus of this volume. Three other top markets- -Brazil, Indonesia, and the Philippines--are also discussed. Potential financial resources wrap up the discussion.
Directory of Open Access Journals (Sweden)
Sobol O.V.
2006-01-01
Full Text Available In order to create high-durable, wear-resistant materials for a wide range of functional applications, comparative investigations of the structure and mechanical characteristics of ion-plasma Ti-W-B nano-crystalline condensates were carried out. The range of condensation rates 0.11÷0.25nm/s was found to be critical for the coatings obtained from the target with 80 vol% W2B5-20 vol% TiB2. Below this, a phase with a cubic lattice (W,TiB0.7…1.2(O,N,C0.3…0.2 formed, while over this range, a solid solution (W,TiB2 with a hexagonal lattice and element composition close to the sputtered target was observed. The structure state of the material changed from cluster-crystalline (under low sputter potentials U=0.6…1.0 kV to textured- crystalline (under U>2.2 kV. Structure perfection improvement with U increase results in higher hardness and elastic modulus of condensates. The conditions of cluster component formation and its effect on hardness and elastic modulus of condensates are discussed. .
Egyptian Journal of Medical Human Genetics - Vol 12, No 2 (2011)
African Journals Online (AJOL)
Egyptian Journal of Medical Human Genetics - Vol 12, No 2 (2011) ... Serum interferon-alpha level in first degree relatives of systemic lupus erythematosus patients: Correlation with autoantibodies titers · EMAIL FREE FULL TEXT EMAIL FREE FULL ... LB Salah, CB Salem, F B'Chir, K Bouraoui, F Broly, S Saguem, 183-186.
Gamma-ray shielding properties of CaO–SrO–B2O3 glasses
DEFF Research Database (Denmark)
Singh, K; Singh, H; Sharma, G
2005-01-01
, the molar volume of the glasses has been derived from density measurements, and the excess volume has been determined as a function of composition. The reported data should be useful for potential applications of these glasses in radiation shielding. (C) 2004 Elsevier Ltd. All rights reserved.......Mass attenuation coefficients, effective atomic numbers and effective electron densities have been determined experimentally for the glass system xCaO . (0.3-x)SrO . 0.7B(2)O(3) at photon energies 511, 662, 1173, and 1332KeV. The results are compared with theoretical calculations. In addition...
Vol. 3: Statistical Physics and Phase Transitions
International Nuclear Information System (INIS)
Sitenko, A.
1993-01-01
Problems of modern physics and the situation with physical research in Ukraine are considered. Programme of the conference includes scientific and general problems. Its proceedings are published in 6 volumes. The papers presented in this volume refer to statistical physics and phase transition theory
Tribological properties of AC44200 based composites strenghead with AlB2BOB3 Bparticles
J.W. Kaczmar; A. Janus; E. Grodzka; A. Kurzawa
2011-01-01
The paper presents a research on abrasion resistance of aluminium-based composites consisting of EN AC-44200 matrix reinforcedwith AlB2BOB3B particles. The examinations revealed that wear intensity of the composites decreased with increasing volume fraction of the particles. Much more intensive abrasive wear was observed on the first kilometre in comparison to the wear on the subsequent distances, i.e. from 1 to 3.5 km and from 3.5 to 8.5 km of the wear distance. Microscopic examinations perm...
Corrosion behaviour of Mg-Cu and Mg-Mo composites in 3.5% NaCl
International Nuclear Information System (INIS)
Budruk Abhijeet, S.; Balasubramaniam, R.; Gupta, M.
2008-01-01
The corrosion behaviour of pure magnesium, Mg-Cu (0.3, 0.6, and 1 vol.%) and Mg-Mo (0.1, 0.3, and 0.6 vol.%) composites has been studied in 3.5% NaCl solution by weight loss and polarisation methods. Corrosion rates determined by weight loss method were considerably higher than that determined by polarisation method. The corrosion rate increased with increasing volume fraction of reinforcement in Mg-Cu and Mg-Mo composites. At the same volume fraction of reinforcement, molybdenum reinforced composite corroded faster than copper reinforced composite. The galvanic current density between Mg-Cu and Mg-Mo couples has been experimentally measured using zero resistance ammeter technique. The experimentally observed galvanic current densities were in close agreement with those obtained using mixed potential theory analysis. SEM observation of corroded samples confirmed microgalvanic activity at the matrix/reinforcement interfaces. The poor corrosion resistance of composites has been attributed to microgalvanic effects between the matrix and reinforcements and inferior quality of surface films
International Nuclear Information System (INIS)
Li, X.T.; Yue, M.; Liu, W.Q.; Li, X.L.; Yi, X.F.; Huang, X.L.; Zhang, D.T.; Chen, J.W.
2015-01-01
The waste Nd–Fe–B sintered magnets up to 500 kg per batch were recycled to manufacture anisotropic sintered magnets by combination of hydrogen decrepitation (HD) and alloying technique. Magnetic properties and thermal stability of both the waste magnets and recycled magnets were investigated. The recycled magnet exhibits magnetic properties with remanence (B r ) of 12.38 kGs, coercivity (H ci ) of 24.89 kOe, and maximum energy product [(BH) max ] of 36.51 MGOe, respectively, which restores 99.20% of B r , 105.65% of H ci , and 98.65% of (BH) max of the waste magnets, respectively. The volume fraction of Nd-rich phase in the recycled magnets is about 10.1 vol.%, which is bigger than that of the waste magnets due to the additive of Nd 3 PrFe 14 B alloy containing more rare earth. The remanence temperature coefficient (α) and coercivity temperature coefficient (β) of the recycled magnets are −0.1155%/K and −0.5099%/K in the range of 288–423 K, respectively, which are comparative to those of the waste magnets. - Highlights: • Large batch recycling of waste Nd–Fe–B sintered magnets were performed. • The recycled magnet restores 99.20% of B r , 105.65% of H ci and 98.65% of (BH) max of the magnet. • The recycled magnets bears bigger volume fraction and better distribution of Nd-rich phase. • The recycled magnets exhibit similar temperature coefficients and maximum working temperature
Oak Ridge Reservation environmental report for 1992. Volume 1: Narrative
Energy Technology Data Exchange (ETDEWEB)
Koncinski, W.S. [ed.
1993-09-01
The two volumes of this report present data and supporting narratives regarding the impact of the US Department of Energy`s (DOE`s) Oak Ridge Reservation (ORR) on its environs and the public during 1992. This Volume (Volume 1) includes all narrative descriptions, summaries, and conclusions and is intended to be a ``stand-alone`` report for the reader who does not want to review in detail all of the 1992 data for the ORR. Volume 2 includes the detailed data in formats that ensure all the environmental data are represented. Narratives are not included in Vol. 2.
A background to risk analysis. Vol. 4
International Nuclear Information System (INIS)
Taylor, J.R.
1979-01-01
This 4-volumes report gives a background of ideas, principles, and examples which might be of use in developing practical methods for risk analysis. Some of the risk analysis techniques described are somewhat experimental. The report is written in an introductory style, but where some point needs further justification or evaluation, this is given in the form of a chapter appendix. In this way, it is hoped that the report can serve two purposes, - as a basis for starting risk analysis work and as a basis for discussing effectiveness of risk analysis procedures. The report should be seen as a preliminary stage, prior to a program of industrial trials of risk analysis methods. Vol. 4 treats human error in plant operation. (BP)
A background to risk analysis. Vol. 2
International Nuclear Information System (INIS)
Taylor, J.R.
1979-01-01
This 4-volumes report gives a background of ideas, principles and examples which might be of use in developing practical methods for risk analysis. Some of the risk analysis techniques described are somewhat experimental. The report is written in an introductory style, but where some point needs further justification or evaluation, this is given in the form of a chapter appendix. In this way, it is hoped that the report can serve two purposes, - as a basis for starting risk analysis work and as a basis for discussing effectiveness of risk analysis procedures. The report should be seen as a preliminary stage, prior to a program of industrial trials of risk analysis methods. Vol. 2 treats generic methods of qualitative failure analysis. (BP)
2015-01-01
95 B.2. Percentage of members who experienced sexual quid pro quo in the past year...Volume 3 B.2. Percentage of members who experienced sexual quid pro quo in the past year Table B.2 Percentage of members who experienced sexual quid ... SEXUAL ASSAULT AND SEXUAL HARASSMENT IN THE U.S. MILITARY Annex to Volume 3. Tabular Results from the 2014 RAND Military Workplace Study for
Preliminary evaluation of rotational Vol-oxidizer for hot cell operation - 5320
International Nuclear Information System (INIS)
Kim, Y.H.; Lee, J.W.; Cho, Y.Z.; Ahn, D.H.; Song, K.C.
2015-01-01
KAERI is developing a mechanical head-end process for pyro-processing. As a piece of the processing equipment, a vol-oxidizer that can handle several tens of kg of HM/batch is under development to supply U 3 O 8 powders to an electrolytic reduction (ER) reactor. To operate a vol-oxidizer in a hot cell, the reactor should be optimized by the mechanical design, and the vol-oxidizer should have a high hull recovery rate. In addition, a vol-oxidizer for hot cell demonstrations that handles the spent fuel of high radiation virulence in a limited space should have a small size and not scatter in its outlet. In this paper, we aim at a preliminary evaluation of a rotational vol-oxidizer for hot cell operation. To evaluate the preliminary situation, we produced a theoretical equation of an optimum reactor size, and verification tests were conducted using an acryl vessel and zircaloy-4 tube according to various weights and lengths. In addition, we predicted the terminal velocity of U 3 O 8 using the terminal velocity of SiO 2 , which will determine the optimum air flux, and through an oxidation experiment, we verified the theory form to detect the existence of U 3 O 8 powder in a discharge filter. In addition, hull separation tests were conducted using a reactor and hulls with a 50 kg HM/batch for the recovery rate of the hulls. The results indicate that we obtained an appropriate air flux so as to not cause U 3 O 8 powder dispersion from using a Stokes equation and density ratio equation prior to the demonstration. The optimum flow and experimental results of the hull separation test have been applied for the design of the demonstration oxidizer, and the operation conditions of the oxidizer were produced. (authors)
The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)
Jacobson, Nathan S.; Myers, Dwight L.
2011-01-01
The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.
Performance of Diesel Engine Using Diesel B3 Mixed with Crude Palm Oil
Namliwan, Nattapong; Wongwuttanasatian, Tanakorn
2014-01-01
The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5–17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7–33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6–52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NOX) emissions when using mixed fuels were 10–39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine). PMID:24688402
African Journals Online (AJOL)
Copyright 1AARR 2012-2016: www.afrrevjo.net
STECH VOL 5 (1) FEBRUARY, 2016. Vol. 5 (1), S/No11, February, 2016: 1-13 ..... Knowledge produce is an act of discovery which involves exploring, analyzing .... Architectural Research, Elsevier: Higher Education Press Limited Company.
A background risk analysis. Vol. 1
International Nuclear Information System (INIS)
Taylor, J.R.
1979-01-01
This 4-volumes report gives a background of ideas, principles, and examples which might be of use in developing practical methods for risk analysis. Some of the risk analysis techniques, described are somewhat experimental. The report is written in an introductory style, but where some point needs further justification or evaluation, this is given in the form of a chapter appendix. In this way, it is hoped that the report can serve two purposes, - as a basis for starting risk analysis work and as a basis for discussing effectiveness of risk analysis procedures. The report should be seen as a preliminary stage, prior to a program of industrial trials of risk analysis methods. Vol. 1 contains a short history of risk analysis, and chapters on risk, failures, errors and accidents, and general procedures for risk analysis. (BP)
Pressure effect on the mechanical and electronic properties of B3N3: A first-principle study
Bagheri, Mohammad; Faez, Rahim
2018-05-01
In this paper, we perform Self-Consistent Field (SCF) energy calculation of Tetragonal B3N3 in the homogenous pressure range of -30 GPa to +160 GPa. Also, we study mechanical and electronic properties of this compound as a potential candidate for a conventional phonon-mediated superconductor with a high transition temperature. To do this, the volume changes of B3N3, and its bulk modulus, due to applying pressure in the range of -30 GPa to +160 GPa are calculated and analyzed. The calculated Bulk modulus of B3N3 at 230 GPa in the relaxed condition indicates the strength of bonds and its low compressibility. We calculated and analyzed the electronic effective mass in both XM and MA directions and anisotropy parameter in these two directions in the relaxed condition and under pressure in the range of -30 GPa to +160 GPa. It is shown that in overall, the direction in which the transport of electrons is parallel to the two perpendicular honeycomb planes has less effective mass and better conductivity than the other direction, in which the electronic transport is perpendicular to at least one of the hexagonal structure planes.
Evaluation of right ventricular volume and function by 2D and 3D echocardiography compared to MRI
DEFF Research Database (Denmark)
Kjaergaard, Jesper; Petersen, Claus Leth; Kjaer, Andreas
2005-01-01
: Thirty-four subjects with (a) prior inferior ST-elevation myocardial infarction (n=17), (b) a history of pulmonary embolism and persistent dyspnea (n=7) or (c) normal subjects (n=10) had 2D and 3D echocardiography, SPECT and MRI within 24h. End-diastolic volume and peak tricuspid regurgitation velocity...... were increased in patients with a history of pulmonary embolism compared to healthy subjects, 130+/-26 ml vs. 94+/-26 ml, P... volume showed significant correlation to RV volumes by MRI. Tricuspid annular plane systolic excursion (TAPSE) had the better correlation to RVEF by MRI, r=0.48, P
International Nuclear Information System (INIS)
1993-01-01
This report in three volumes substantiates the contents of the programme survey published in September 1989. The progress reports cover the following research areas: Vol. I, (1). Atomic and molecular physics - free atoms, molecules, macromolecules, clusters, matrix-isolated atoms and molecules. (2) Physics and chemistry of surfaces and interfaces - epitaxy, surface structure, adsorption, electrical, magnetic, and optical properties, thin films, synthetic layer structure. Vol. II, (3). Solid-state physics, and materials science -structural research, lattice dynamics, magnetic structure and dynamics, electronic states; load; spin and pulse density fluctuations; diffusion and internal motion, defects, unordered systems and liquids. Vol. III, (4). Chemistry - bonding and structure, kinetics and reaction mechanisms, polymer research, analysis and synthesis. (5). Biology, - structure and dynamics of biological macromolecules, membrane and cell biology. (6) Development of methods and instruments - neutron sources, synchrotron sources, special accelerators, research with interlinked systems and devices. (orig.) [de
International Nuclear Information System (INIS)
Zhang, X.Q.; Wang, L.; Xue, Y.F.; Cheng, X.W.; Wang, Y.D.; Nie, Z.H.; Zhang, H.F.; Fu, H.M.; Ma, L.L.; Ren, Y.
2013-01-01
The mechanical properties of both as-cast and as-extruded Zr-based metallic glass reinforced with tungsten composites with 33, 28, and 21 vol. % of metallic glass were investigated under quasi-static compression at strain rates from 10 −4 s −1 to 10 −1 s −1 . These two types of composites exhibited a strain rate sensitivity exponent that increased with the increase of the tungsten volume fraction. Compared to the composites with 33 and 21 vol. % of the metallic glass, the two types of composites with 28 vol. % of the metallic glass phase exhibited superior fracture energies. The in-situ compression test on the as-cast composites using high-energy synchrotron X-ray diffraction (HEXRD) revealed that the yield stress of the tungsten phase increased with a decrease in the metallic glass volume fraction. The as-cast composite with 28 vol. % of the metallic glass exhibited relatively great mechanical properties compared to the composites that contained 33 and 21 vol. % of the metallic glass. This result was attributed to the great coupling of the load distribution between the two phases and the high lattice strain in the tungsten phase.
Sol-gel syntheses, luminescence, and energy transfer properties of α-GdB5O9:Ce(3+)/Tb(3+) phosphors.
Sun, Xiaorui; Gao, Wenliang; Yang, Tao; Cong, Rihong
2015-02-07
Sol-gel method was applied to prepare homogenous and highly crystalline phosphors with the formulas α-GdB5O9:xTb(3+) (0 ≤ x ≤ 1), α-Gd1-xCexB5O9 (0 ≤ x ≤ 0.40), α-GdB5O9:xCe(3+), 0.30Tb(3+) (0 ≤ x ≤ 0.15) and α-GdB5O9:0.20Ce(3+), xTb(3+) (0 ≤ x ≤ 0.10). The success of the syntheses was proved by the linear shrinkage or expansion of the cell volumes against the substitution contents. In α-GdB5O9:xTb(3+), an efficient energy transfer from Gd(3+) to Tb(3+) was observed and there was no luminescence quenching. The exceptionally high efficiency of the f-f excitations of Tb(3+) implies that these phosphors may be good green-emitting UV-LED phosphors. For α-Gd1-xCexB5O9, Ce(3+) absorbs the majority of the energy and transfers it to Gd(3+). Therefore, the co-doping of Ce(3+) and Tb(3+) leads to a significant enhancement in the green emission of Tb(3+). Our current results together with the study on α-GdB5O9:xEu(3+) in the literature indicate that α-GdB5O9 is a good phosphor host with advantages including controllable preparation, diverse cationic doping, the absence of concentration quenching, and effective energy transfer.
Large hadron collider workshop. Proceedings. Vol. 2
International Nuclear Information System (INIS)
Jarlskog, G.; Rein, D.
1990-01-01
The aim of the LHC workshop at Aachen was to discuss the 'discovery potential' of a high-luminosity hadron collider (the Large Hadron Collider) and to define the requirements of the detectors. Of central interest was whether a Higgs particle with mass below 1 TeV could be seen using detectors potentially available within a few years from now. Other topics included supersymmetry, heavy quarks, excited gauge bosons, and exotica in proton-proton collisions, as well as physics to be observed in electron-proton and heavy-ion collisions. A large part of the workshop was devoted to the discussion of instrumental and detector concepts, including simulation, signal processing, data acquisition, tracking, calorimetry, lepton identification and radiation hardness. The workshop began with parallel sessions of working groups on physics and instrumentation and continued, in the second half, with plenary talks giving overviews of the LHC project and the SSC, RHIC, and HERA programmes, summaries of the working groups, presentations from industry, and conclusions. Vol.1 of these proceedings contains the papers presented at the plenary sessions, Vol.2 the individual contributions to the physics sessions, and Vol.3 those to the instrumentation sessions. (orig.)
Large hadron collider workshop. Proceedings. Vol. 1
International Nuclear Information System (INIS)
Jarlskog, G.; Rein, D.
1990-01-01
The aim of the LCH workshop at Aachen was to discuss the 'discovery potential' of a high-luminosity hadron collider (the Large Hadron Collider) and to define the requirements of the detectors. Of central interest was whether a Higgs particle with mass below 1 TeV could be seen using detectors potentially available within a few years from now. Other topics included supersymmetry, heavy quarks, excited gauge bosons, and exotica in proton-proton collisions, as well as physics to be observed in electron-proton and heavy-ion collisions. A large part of the workshop was devoted to the discussion of instrumental and detector concepts, including simulation, signal processing, data acquisition, tracking, calorimetry, lepton identification and radiation hardness. The workshop began with parallel sessions of working groups on physics and instrumentation and continued, in the second half, with plenary talks giving overviews of the LHC project and the SSC, RHIC, and HERA programmes, summaries of the working groups, presentations from industry, and conclusions. Vol. 1 of these proceedings contains the papers presented at the plenary sessions, Vol. 2 the individual contributions to the physics sessions, and Vol. 3 those to the instrumentation sessions. (orig.)
International Nuclear Information System (INIS)
Hakin, Andrew W.; Liu Jinlian; Erickson, Kristy; Munoz, Julie-Vanessa; Rard, Joseph A.
2005-01-01
Relative densities and relative massic heat capacities have been measured for acidified solutions of Y(NO 3 ) 3 (aq), Pr(NO 3 ) 3 (aq), and Gd(NO 3 ) 3 (aq) at T = (288.15, 298.15, 313.15, and 328.15) K and p = 0.1 MPa. In addition, relative densities and massic heat capacities have been measured at the same temperatures and pressure for Y(NO 3 ) 3 (aq) and Ho(NO 3 ) 3 (aq) solutions without excess acid (n.b. measurements at T = 328.15 K for Ho(NO 3 ) 3 (aq) were not performed due to the limited volume of solution available). Apparent molar volumes and apparent molar heat capacities for the aqueous salt solutions have been calculated from the experimental apparent molar properties of the acidified solutions using Young's rule, whereas the apparent molar properties of the solutions without excess acid were calculated directly from the measured densities and massic heat capacities. The two sets of data for the Y(NO 3 ) 3 (aq) systems provide a check of the internal consistency of the Young's rule approach we have utilised. The concentration dependences of the apparent molar volumes and heat capacities of the aqueous salt solutions have been modelled at each investigated temperature using the Pitzer ion interaction equations to yield apparent molar properties at infinite dilution. Complex formation within the aqueous rare earth nitrate systems is discussed qualitatively by probing the concentration dependence of apparent molar volumes and heat capacities. In spite of the complex formation in the aqueous rare earth nitrate systems, there is a high degree of self-consistency between the apparent molar volumes and heat capacities at infinite dilution reported in this manuscript and those previously reported for aqueous rare earth perchlorates
International Nuclear Information System (INIS)
Altarelli, G.; Kleiss, R.; Verzegnassi, C.
1989-01-01
The contents of this final report from the Workshop on Z Physics at LEP can be divided into two parts. The first part, comprising Vols. 1 and 2, is a relatively concise but fairly complete handbook on the physics of e + e - annihilation near the Z peak (with normal LEP luminosity and unpolarized beams, appropriate for the first phase of LEP operation). The second part (Vol. 3) is devoted to a review of the existing Monte Carlo event generators for LEP physics. A special effort has been made to co-ordinate the different parts of this report, with the aim of achieving a systematic and balanced review of the subject, rather than having simply a collection of separate contributions. (orig.)
Guidance and Control Software Project Data - Volume 3: Verification Documents
Hayhurst, Kelly J. (Editor)
2008-01-01
The Guidance and Control Software (GCS) project was the last in a series of software reliability studies conducted at Langley Research Center between 1977 and 1994. The technical results of the GCS project were recorded after the experiment was completed. Some of the support documentation produced as part of the experiment, however, is serving an unexpected role far beyond its original project context. Some of the software used as part of the GCS project was developed to conform to the RTCA/DO-178B software standard, "Software Considerations in Airborne Systems and Equipment Certification," used in the civil aviation industry. That standard requires extensive documentation throughout the software development life cycle, including plans, software requirements, design and source code, verification cases and results, and configuration management and quality control data. The project documentation that includes this information is open for public scrutiny without the legal or safety implications associated with comparable data from an avionics manufacturer. This public availability has afforded an opportunity to use the GCS project documents for DO-178B training. This report provides a brief overview of the GCS project, describes the 4-volume set of documents and the role they are playing in training, and includes the verification documents from the GCS project. Volume 3 contains four appendices: A. Software Verification Cases and Procedures for the Guidance and Control Software Project; B. Software Verification Results for the Pluto Implementation of the Guidance and Control Software; C. Review Records for the Pluto Implementation of the Guidance and Control Software; and D. Test Results Logs for the Pluto Implementation of the Guidance and Control Software.
The Mechanisms of Dispersion Strengthening and Fracture in Al-based XD (TM) Alloys
Aiken, R. M., Jr.
1990-01-01
The influence of reinforcement size, volume fraction, and matrix deformation behavior on room and elevated temperature strength, and the fracture toughness of metal matrix composites of both pure aluminum and Al(4 percent)Cu(1.5 percent)Mg with 0 to 15 vol percent TiB2 were examined. Higher TiB2 volume fractions increased the tensile yield strength both at room and elevated temperatures, and reduced the elongation to fracture. Tensile tests also indicate that small particles provided a greater increase in strength for a given volume fraction than larger particles, whereas elongation to fracture appeared to be insensitive to reinforcement size. The fracture toughness of the Al(4 percent)Cu(1.5 percent)Mg alloys decreased rapidly with TiB2 additions of 0 to 5 vol percent and more slowly with TiB2 additions of 5 to 15 vol percent. Fracture toughness appears to be independent of TiB2 particle size. The isothermal-aging response of the precipitation strengthened Al(4 percent)Cu(1.5 percent)Mg alloys was not altered by the presence of TiB2.
International Nuclear Information System (INIS)
Uher, M.; Benes, P.; Carsky, J.; Ctrnactova, H.; Fecenko, J.; Fellner, P.; Hodul, P.; Koprda, V.; Kratochvil, B.; Krkoska, P.; Kuruc, J.; Lehotay, J.; Matousek, J.; Milichovsky, P.; Omastova, M.; Petrus, L. jr.; Petrus, L. sr.; Schwendt, P.; Silny, P.; Sevcik, P.; Toma, S.; Uherova, R.; Zachar, P.
1999-09-01
The publication has been set up as an abstracts of the meeting dealing with different chemical problems. The book (Vol. 3) consists of the sections: (E) Wood, pulp, paper (15 papers); (G) Macromolecular chemistry (42 papers); (H) Organic chemistry, bio-organic chemistry and pharmaceutical chemistry (96 Papers); (I) Food chemistry and biochemistry; (J) Textile, fibres and foil materials
International Nuclear Information System (INIS)
Toelgyessy, J.
2001-09-01
The publication has been set up as the abstracts of the meeting dealing with different chemical problems. The book (Vol. 3) consists of the sections: (F) Chemistry of polymers, organic materials, textile, fibres, foil materials (63 papers); (I) Organic and pharmaceutical chemistry (59 papers); (J) Food chemistry and biotechnology (26 papers); (M) Environment, Toxicology (51 papers)
Energy Technology Data Exchange (ETDEWEB)
Sinha, Biswajit, E-mail: biswachem@gmail.co [Department of Chemistry, University of North Bengal, Darjeeling 734013 (India); Roy, Pran Kumar; Sarkar, Bipul Kumar; Brahman, Dhiraj [Department of Chemistry, University of North Bengal, Darjeeling 734013 (India); Roy, Mahendra Nath, E-mail: mahendraroy2002@yahoo.co.i [Department of Chemistry, University of North Bengal, Darjeeling 734013 (India)
2010-03-15
Apparent molar volumes phi{sub V} and viscosity B-coefficients for caffeine in (0.00, 0.03, 0.05, and 0.07) mol . dm{sup -3} aqueous thorium nitrate, Th(NO{sub 3}){sub 4}, solutions were determined from solution density and viscosity measurements over the temperature range (298.15 to 318.15) K as function of concentration of caffeine and the relation: phi{sub V}{sup 0}=a{sub 0}+a{sub 1}T+a{sub 2}T{sup 2}, have been used to describe the temperature dependence of the standard partial molar volumes phi{sub V}{sup 0}. These results have been used to deduce the standard volumes of transfer DELTAphi{sub V}{sup 0} and viscosity B-coefficients of transfer DELTAB for caffeine from water to aqueous Th(NO{sub 3}){sub 4} solutions for rationalizing various interactions in the ternary solutions. The structure-making or breaking ability of caffeine has been discussed in terms of the sign of (delta{sup 2}phi{sub V}{sup 0}/deltaT{sup 2}){sub P}. The Friedman-Krishnan co-sphere model was used to explain the transfer volume of caffeine with increasing Th(NO{sub 3}){sub 4} molarity. The activation parameters of viscous flow for the ternary solutions were also discussed in terms of transition state theory.
Studies in Intelligence. Volume 58, Number 3 (Unclassified Articles from September 2014)
2014-09-01
boarded two Catalina fl ying boats for Tawi Tawi, an island province separating the Sulu Sea and Celebes Sea between Sabah, Malaysia and Zamboanga...Operations and Campaigns Exposed Throughout the Civil War, the northern press, which fi ercely op- posed censorship and had among its core more than...which fi ercely opposed censorship , was responsible for several serious disclosures. The “Unfettered Press” 23Studies in Intelligence Vol 58, No. 3
AJESMS Vol 9 2011 October 23 2012 final
African Journals Online (AJOL)
Owner
2011-10-23
Oct 23, 2011 ... African Journal of Educational Studies in Mathematics and Sciences Vol. ... alveolar re-circulation and gravity orientation are key factors in determining the ..... Comp. Biomed. Res. 3, pp 675-689. Pich, J. (1972). Theory of ...
International Nuclear Information System (INIS)
Okamoto, S; Ito, S; Ando, K; Mouri, M; Ikeda, A; Hasegawa, H; Koshikawa, N
2010-01-01
Well-ordered microdomain structures were obtained in semi-dilute solutions and successfully stabilized by gelation. We used polystyrene-b-polybutadiene (PS-b-PB) diblock copolymer with the weight-averaged molecular weight varying from several hundred thousands to millions g/mol. The solutions had iridescent colors because the domain spacing is on the order of the wavelength of visible light. As the structures are susceptible to distortion by flow or vibration, structural fixation was carried out by gelation. The polybutadiene used has the microstructure of 1,2-linkage and hence the chains can be cross-linkable. The Small-Angle X-ray Scattering and the UV-vis spectroscopic measurements showed that in the case of PS-b-PBs with the PB volume fraction, φ PB , greater than about 50 vol % the microdomain structures were successfully fixed by gelation, while largely distorted in the case of those with φ PB < ca. 50 vol %. The SAXS scattering intensities were quantitatively analyzed by the scattering functions numerically calculated based on the one- and two-dimensional paracrystal theories and on the concentration fluctuation between the polymers and the solvent molecules.
International Nuclear Information System (INIS)
1995-04-01
This report documents the results of the combined effort of the NRC and the industry to produce improved Standard Technical Specifications (STS), Revision 1 for Combustion Engineering Plants. The changes reflected in Revision 1 resulted from the experience gained from license amendment applications to convert to these improved STS or to adopt partial improvements to existing technical specifications. This NUREG is the result of extensive public technical meetings and discussions between the Nuclear Regulatory Commission (NRC) staff and various nuclear power plant licensees, Nuclear Steam Supply System (NSSS) Owners Groups, NSSS vendors, and the Nuclear Energy Institute (NEI). The improved STS were developed based on the criteria in the Final Commission Policy Statement on Technical Specifications Improvements for Nuclear Power Reactors, dated July 22, 1993. The improved STS will be used as the basis for individual nuclear power plant licensees to develop improved plant-specific technical specifications. This report contains three volumes. Volume 1 contains the Specifications for all chapters and sections of the improved STS. Volume 2 contains the Bases for Chapters 2.0 and 3.0, and Sections 3.1--3.3 of the improved STS Volume 3 contains the Bases for Sections 3.4--3.9 of the improved STS
Energy-efficient buildings program evaluations. Volume 2: Evaluation summaries
Energy Technology Data Exchange (ETDEWEB)
Lee, A.D.; Mayi, D.; Edgemon, S.D.
1997-04-01
This document presents summaries of code and utility building program evaluations reviewed as the basis for the information presented in Energy-Efficient Buildings Program Evaluations, Volume 1: Findings and Recommendations, DOE/EE/OBT-11569, Vol. 1. The main purpose of this volume is to summarize information from prior evaluations of similar programs that may be useful background for designing and conducting an evaluation of the BSGP. Another purpose is to summarize an extensive set of relevant evaluations and provide a resource for program designers, mangers, and evaluators.
Directory of Open Access Journals (Sweden)
Edwin Widodo
2010-06-01
Full Text Available Zonna pellucidae can be develop as antigen potential candidates based on reversible immunocontraceptive vaccines. Immunogenic sites of bovine zonna pellucidae 3 (bZP3 could stimulated the presence of anti-bZP3 which be located on rabbit ZP and inhibit sperm-egg interaction on fertilization process. Purpose of this research is to detect spesific binding anti-bZP3 to rabbit oocytes using dot blotting and ELISA method. Sub cutan induction of bZP3 with Freund's adjuvant, CFA (Complete Freund's Adjuvant for initial immunization and following by IFA (Incomplete Freund's Adjuvant at the 14th day and 39th day. Control female rabbit injected by Tris-Cl buffer diluted in Freund's adjuvant without bZP3 antigen. Rabbit serum injected to rat for producing Rat Anti Rabbit Anti-bZP3. This research concludes spesific binding of anti-bZP3 with increasing purple colour on dot blotting methods. Anti-bZP3 increasing on 24th day and 31th day and still until 48th day. Measurement with ELISA methods showed increased titer on OD405. Highest titer showed on 31th day post immunization. Anti-bZP3 synthetized by bZP3 induced on rabbit detectable by immunohistochemistry methods on late primary oocytes, early secondary oocytes, growing secondary oocytes, and oocytes on de Graaf folicular phase. Keywords: Dot blotting, ELISA, bZP3, anti-bZP3
Afican Health Sciences Vol 9 No 2.pmd
African Journals Online (AJOL)
Administrator
African Health Sciences Vol 9 No 2 June 2009 ... Background:The under five mortality rate (U5MR) is measure of wellbeing and decreasing the U5MR by two .... under three scenarios 1-3. ... Negative indicates increase in childhood mortalities.
Mangine, Gerald T; Hoffman, Jay R; Wang, Ran; Gonzalez, Adam M; Townsend, Jeremy R; Wells, Adam J; Jajtner, Adam R; Beyer, Kyle S; Boone, Carleigh H; Miramonti, Amelia A; LaMonica, Michael B; Fukuda, David H; Ratamess, Nicholas A; Stout, Jeffrey R
2016-12-01
To compare the effects of two different resistance training programs, high intensity (INT) and high volume (VOL), on changes in isometric force (FRC), rate of force development (RFD), and barbell velocity during dynamic strength testing. Twenty-nine resistance-trained men were randomly assigned to either the INT (n = 15, 3-5 RM, 3-min rest interval) or VOL (n = 14, 10-12 RM, 1-min rest interval) training group for 8 weeks. All participants completed a 2-week preparatory phase prior to randomization. Measures of barbell velocity, FRC, and RFD were performed before (PRE) and following (POST) the 8-week training program. Barbell velocity was determined during one-repetition maximum (1RM) testing of the squat (SQ) and bench press (BP) exercises. The isometric mid-thigh pull was used to assess FRC and RFD at specific time bands ranging from 0 to 30, 50, 90, 100, 150, 200, and 250 ms. Analysis of covariance revealed significant (p velocity. Results indicate that INT is more advantageous than VOL for improving FRC and RFD, while changes in barbell velocity during dynamic strength testing are similarly improved by both protocols in resistance-trained men.
African Journals Online (AJOL)
OLUWOLE
Fourteen (14) crop residues and eleven (11) agro-industrial by- products were identified. .... 7. 2. 7. 5.38. Adaka. 4. 6. 6. 12. 3. 10. 2. 3. 5.75. Akile. 27. 50. 22. 4. 3. 7. 23. 12. 18.5. Wurukum. -. 3. 5. 18. 2 ..... Inc. New York. Tegbe, T.S.B. (1981).
Cell Volume Regulation and Signaling in 3T3-L1 Pre-adipocytes and Adipocytes
DEFF Research Database (Denmark)
Eduardsen, Kathrine; Larsen, Susanne; Novak, Ivana
2011-01-01
Caveolae have been implicated in sensing of cell volume perturbations, yet evidence is still limited and findings contradictory. Here, we investigated the possible role of caveolae in cell volume regulation and volume sensitive signaling in an adipocyte system with high (3T3-L1 adipocytes......); intermediate (3T3-L1 pre-adipocytes); and low (cholesterol-depleted 3T3-L1 pre-adipocytes) caveolae levels. Using large-angle light scattering, we show that compared to pre-adipocytes, differentiated adipocytes exhibit several-fold increased rates of volume restoration following osmotic cell swelling (RVD......) and osmotic cell shrinkage (RVI), accompanied by increased swelling-activated taurine efflux. However, caveolin-1 distribution was not detectably altered after osmotic swelling or shrinkage, and caveolae integrity, as studied by cholesterol depletion or expression of dominant negative Cav-1, was not required...
Ground water impact assessment report for the 216-B-3 Pond system
International Nuclear Information System (INIS)
Johnson, V.G.; Law, A.G.; Reidel, S.P.; Evelo, S.D.; Barnett, D.B.; Sweeney, M.D.
1995-01-01
Ground water impact assessments were required for a number of liquid effluent receiving sites according to the Hanford Federal Facility Agreement and Consent Order Milestones M-17-00A and M-17-00B, as agreed upon by the US Department of Energy. This report is one of the last three assessments required and addresses the impact of continued discharge of uncontaminated wastewater to the 216-B-3C expansion lobe of the B Pond system in the 200 East Area until June 1997. Evaluation of past and projected effluent volumes and composition, geohydrology of the receiving site, and contaminant plume distribution patterns, combined with ground water modeling, were used to assess both changes in ground water flow regime and contaminant-related impacts
The Influence of Oxidation on the Quality of U3O8 Kernels
International Nuclear Information System (INIS)
Damunir; Sukarsono; Indra Suryawan
2002-01-01
The influence of oxidation on quality of U 3 O 8 kernels have been studied. The investigated the influence was changed of time and temperature oxidation of Uranyl-4(ammonia)-2(polyvinyl alcohol) gel on surface area, pore radius, pore volume, porosity and diameter size of U 3 O 8 kernel. The spherical of uranyl-4(ammonia)-2(polyvinyl alcohol) containing 150g U/l were oxidized at 200-800 o C temperature for 2-24 hours, formed U 3 O 8 kernel. After that, the quality of U 3 O 8 kernel were measured by their physical properties i.e. the surface area and pore radius using Surface areameter with N 2 gas as absorbent. The pore volume and porosity using pycnometer with aquabidest of water as a solvent, diameter size using a optical microscope. The experiment results, showed that the time and temperature oxidation of uranyl-4(ammonia)-2(polyvinyl alcohol) grain the influence to quality of U 3 O 8 in formed the surface area of specific, pore radius, pore volume of specific, porosity, and diameter size of U 3 O 8 kernel. The best accurred at 600-800 o C oxidation temperature and oxidation time was 2-5 hours. The resulted quality of U 3 O 8 kernel i.e surface area of specific was 10.84 - 5.99 m 2 /g, pore volume of specific was 10.35x10 -2 - 3.23x10 -2 cc/g, pore radius was 21.05 - 24.62 Angstrom, diameter size was 1264 - 1456 μm and porosity was 49.49 - 21.36 % Vol with Cumulative analysis error was 8.55 % Vol. (author)
Qatar Exoplanet Survey : Qatar-3b, Qatar-4b, and Qatar-5b
Alsubai, Khalid; Mislis, Dimitris; Tsvetanov, Zlatan I.; Latham, David W.; Bieryla, Allyson; Buchhave, Lars A.; Esquerdo, Gilbert A.; Bramich, D. M.; Pyrzas, Stylianos; Vilchez, Nicolas P. E.; Mancini, Luigi; Southworth, John; Evans, Daniel F.; Henning, Thomas; Ciceri, Simona
2017-04-01
We report the discovery of Qatar-3b, Qatar-4b, and Qatar-5b, three new transiting planets identified by the Qatar Exoplanet Survey. The three planets belong to the hot Jupiter family, with orbital periods of {P}{{Q}3{{b}}} = 2.50792 days, {P}{{Q}4{{b}}} = 1.80539 days, and {P}{{Q}5{{b}}} = 2.87923 days. Follow-up spectroscopic observations reveal the masses of the planets to be {M}{{Q}3{{b}}} = 4.31 ± 0.47 {M}{{J}}, {M}{{Q}4{{b}}} = 6.10 ± 0.54 {M}{{J}}, and {M}{{Q}5{{b}}} = 4.32 ± 0.18 {M}{{J}}, while model fits to the transit light curves yield radii of {R}{{Q}3{{b}}} = 1.096 ± 0.14 {R}{{J}}, {R}{{Q}4{{b}}} = 1.135 ± 0.11 {R}{{J}}, and {R}{{Q}5{{b}}} = 1.107 ± 0.064 {R}{{J}}. The host stars are low-mass main sequence stars with masses and radii M Q3 = 1.145 ± 0.064 M ⊙, M Q4 = 0.896 ± 0.048 M ⊙, M Q5 = 1.128 ± 0.056 M ⊙ and R Q3 = 1.272 ± 0.14 R ⊙, R Q4 = 0.849 ± 0.063 R ⊙, and R Q5 = 1.076 ± 0.051 R ⊙ for Qatar-3, 4, and 5 respectively. The V magnitudes of the three host stars are V Q3 = 12.88, V Q4 = 13.60, and V Q5 = 12.82. All three new planets can be classified as heavy hot Jupiters (M > 4 M J).
Meng, Ge; Zheng, Meilin; Wang, Mei; Tong, Jing; Ge, Weijuan; Zhang, Jiehe; Zheng, Aqun; Li, Jingya; Gao, Lixin; Li, Jia
2016-10-21
A new series of 2-substituted imino-3-substituted-5- heteroarylidene-1,3-thiazolidine-4-ones as the potent bidentate PTP1B inhibitors were designed and synthesized in this paper. All of the new compounds were characterized and identified by spectra analysis. The biological screening test against PTP1B showed that some of these compounds have the positive inhibitory activity against PTP1B. The activity of the compounds with 5-substituted pyrrole on 5-postion of 1,3-thiazolidine-4-one are more potent than that of those compounds with 5-substituted pyridine group. Compound 14b, 14h and 14i showed IC50 values of 8.66 μM, 6.83 μM and 6.09 μM against PTP1B, respectively. Docking analysis of these active compounds with PTP1B showed the possible interaction modes of these biheterocyclic compounds with the active sites of PTP1B. The inhibition tests against oncogenetic CDC25B were also conducted on this set of compounds to evaluate the selectivity and possible anti-neoplastic activity. Compound 14b also showed the lowest IC50 of 1.66 μM against CDC25B among all the possible inhibitors, including 14g, 14h, 14i and 15c. Some pharmacological parameters including VolSurf, steric and electric descriptors of all the compounds were calculated to give some hints about the relative relationship with the biological activity. The result of this study might give some light on designing the possible anti-cancer drugs targeting at phosphatases. The most active compound 14i might be used as the lead compound for further structure modification of the new low molecular weight PTP1B inhibitors with the N-containing heterocyclic skeleton. Copyright © 2016. Published by Elsevier Masson SAS.
Malaysian B5 Implementation and Its Quality
International Nuclear Information System (INIS)
Liang, Y.C.; Loh, S.K.; Soon, L.W.; May, C.Y.
2016-01-01
A quality survey of 80 samples of diesel fuels (B5) from 80 retail stations throughout Peninsular Malaysia was performed. The bio diesel contents in these B5 samples were in the range of 4.61 vol. % to 5.33 vol. %. The water contents of the samples were < 200 mg kg -1 , meeting the stringent water requirements recommended by the car manufacturers. In addition, all the samples exhibited superior lubricity as indicated by a much shorter wear scar diameter compared to neat diesel. More importantly, 98 % of the samples passed the oxidation stability test (PetroOXY) with an induction period of > 65 min. Overall, the B5 diesel fuel sold was in full compliance with the Malaysian diesel fuel standard specification. (author)
Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B)
Energy Technology Data Exchange (ETDEWEB)
Duangtum, Natapol [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Junking, Mutita; Sawasdee, Nunghathai [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Cheunsuchon, Boonyarit [Department of Pathology, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Limjindaporn, Thawornchai, E-mail: limjindaporn@yahoo.com [Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Yenchitsomanus, Pa-thai, E-mail: grpye@mahidol.ac.th [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand)
2011-09-16
Highlights: {yields} Impaired trafficking of kAE1 causes distal renal tubular acidosis (dRTA). {yields} The interaction between kAE1 and kinesin family member 3B (KIF3B) is reported. {yields} The co-localization between kAE and KIF3B was detected in human kidney tissues. {yields} A marked reduction of kAE1 on the cell membrane was observed when KIF3B was knockdown. {yields} KFI3B plays an important role in trafficking of kAE1 to the plasma membrane. -- Abstract: Impaired trafficking of human kidney anion exchanger 1 (kAE1) to the basolateral membrane of {alpha}-intercalated cells of the kidney collecting duct leads to the defect of the Cl{sup -}/HCO{sub 3}{sup -} exchange and the failure of proton (H{sup +}) secretion at the apical membrane of these cells, causing distal renal tubular acidosis (dRTA). In the sorting process, kAE1 interacts with AP-1 mu1A, a subunit of AP-1A adaptor complex. However, it is not known whether kAE1 interacts with motor proteins in its trafficking process to the plasma membrane or not. We report here that kAE1 interacts with kinesin family member 3B (KIF3B) in kidney cells and a dileucine motif at the carboxyl terminus of kAE1 contributes to this interaction. We have also demonstrated that kAE1 co-localizes with KIF3B in human kidney tissues and the suppression of endogenous KIF3B in HEK293T cells by small interfering RNA (siRNA) decreases membrane localization of kAE1 but increases its intracellular accumulation. All results suggest that KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney {alpha}-intercalated cells.
Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B)
International Nuclear Information System (INIS)
Duangtum, Natapol; Junking, Mutita; Sawasdee, Nunghathai; Cheunsuchon, Boonyarit; Limjindaporn, Thawornchai; Yenchitsomanus, Pa-thai
2011-01-01
Highlights: → Impaired trafficking of kAE1 causes distal renal tubular acidosis (dRTA). → The interaction between kAE1 and kinesin family member 3B (KIF3B) is reported. → The co-localization between kAE and KIF3B was detected in human kidney tissues. → A marked reduction of kAE1 on the cell membrane was observed when KIF3B was knockdown. → KFI3B plays an important role in trafficking of kAE1 to the plasma membrane. -- Abstract: Impaired trafficking of human kidney anion exchanger 1 (kAE1) to the basolateral membrane of α-intercalated cells of the kidney collecting duct leads to the defect of the Cl - /HCO 3 - exchange and the failure of proton (H + ) secretion at the apical membrane of these cells, causing distal renal tubular acidosis (dRTA). In the sorting process, kAE1 interacts with AP-1 mu1A, a subunit of AP-1A adaptor complex. However, it is not known whether kAE1 interacts with motor proteins in its trafficking process to the plasma membrane or not. We report here that kAE1 interacts with kinesin family member 3B (KIF3B) in kidney cells and a dileucine motif at the carboxyl terminus of kAE1 contributes to this interaction. We have also demonstrated that kAE1 co-localizes with KIF3B in human kidney tissues and the suppression of endogenous KIF3B in HEK293T cells by small interfering RNA (siRNA) decreases membrane localization of kAE1 but increases its intracellular accumulation. All results suggest that KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney α-intercalated cells.
International Nuclear Information System (INIS)
1990-09-01
The Directorate-General for Environment, Nuclear Safety and Civil Protection of the Commission of the European Communities is responsible for the effective and harmonized implementation of the Directive 82/501/EEC on the major-accident hazards of certain industrial activities. To this end, the Commission, in collaboration with the Committee of Competent Authorities responsible for the implementation of this Directive in the twelve Member States, carries out a whole range of activities. One of the most essential areas for action identified was the need for a systematic diffusion of information concerning the practical implementation of the Directive in the Member States, including the technical rules and guidelines applied, the safety practices and the lessons learnt from major accidents. Therefore, the Commission decided to set up a Community Documentation Centre on Industrial Risks (CDCIR). This Documentation Centre is run by the European Commission, Joint Research Centre, Institute for Systems Engineering and Informatics (ISEI), at Ispra, Italy, among its support activities on the implementation of the Directive. The Documentation Centre will collect, classify and review technical rules, guidelines and documents concerning the requirements of the Directive, as well as the safety of industrial installations produced by governments, administrative, scientific or technical bodies, national or international organizations and industrial or professional associations. Documents on major accidents in the form of reports, videotapes will also be collected and reviewed. The Centre is accessible to interested visitors, documents which are not covered by copyright and are not restricted can be obtained from the Documentation Centre on request. Periodical volumes which will feature the inventory, including abstracts, of the collected material will be published and made available to all interested parties. The Centre will also publish documents devoted to compare existing
Forced volume magnetostriction in Mn3.3Sn0.7C compound at room temperature
International Nuclear Information System (INIS)
Wen Yongchun; Wang Cong; Sun Ying; Nie Man; Chu Lihua
2010-01-01
The negative volume magnetostriction in the external magnetic field for antiperovskite Mn 3.3 Sn 0.7 C compound is discovered. Its magnetic transition temperature from paramagnetism to ferrimagnetism is 348 K. The linear and volume magnetostrictions were investigated by measuring the change in length along the three-dimensional directions of the square samples at room temperature. Volume contraction was observed along all of the three directions throughout the whole magnetization. The value of volume magnetostriction is -44x10 -6 at 1.5 T. The magnetization saturates basically at 1.5 T, however the volume magnetostriction should be higher with further increase in magnetic field.
Annual Conference on Manual Control (20th) Held in California on June 12 - 14, 1984. Volume 1
1984-06-14
Semisupine Pilot", Avimtion Space and Environmental Medicine , vol. 49, No. 1, pp. 304-317, January, 1978. [5] Levison, W.H., "Model For Human Controller...Performance in Vibration Environment", Aviation Space and Environmental Medicine , vol. 49, No. 1, pp. 321-327, January, 1978. [6] Repperger, D. W...Schwartz, Anthony C. Stein, Raymond E. Magdaleno, and Jeffrey R. Hogue, Effects of Alcohol and Marihuana on Driver Control Behavior. Volume I: Laboratory
Short syntheses of enantiopure calystegine B-2, B-3, and B-4
DEFF Research Database (Denmark)
Skaanderup, Philip Robert; Madsen, Robert
2001-01-01
Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....
1985-02-01
Then it follows that H2 (fl,-f 2) (-flf Thus, the total amplitude of the intermodulation signal at fre- quency fAF is given by6 V = V +I mA2 III(fl 1-f...RFI suppression in the manner described. 229 . * . ... ..... 4 -*.-., ,e ’ - ."..~ REFERENCES 1. G. Kaplan , "Computer Aided Design," IEEE Spectrum, Vol
Brain tumor locating in 3D MR volume using symmetry
Dvorak, Pavel; Bartusek, Karel
2014-03-01
This work deals with the automatic determination of a brain tumor location in 3D magnetic resonance volumes. The aim of this work is not the precise segmentation of the tumor and its parts but only the detection of its location. This work is the first step in the tumor segmentation process, an important topic in neuro-image processing. The algorithm expects 3D magnetic resonance volumes of brain containing a tumor. The detection is based on locating the area that breaks the left-right symmetry of the brain. This is done by multi-resolution comparing of corresponding regions in left and right hemisphere. The output of the computation is the probabilistic map of the tumor location. The created algorithm was tested on 80 volumes from publicly available BRATS databases containing 3D brain volumes afflicted by a brain tumor. These pathological structures had various sizes and shapes and were located in various parts of the brain. The locating performance of the algorithm was 85% for T1-weighted volumes, 91% for T1-weighted contrast enhanced volumes, 96% for FLAIR and T2-wieghted volumes and 95% for their combinations.
Real-time interpolation for true 3-dimensional ultrasound image volumes.
Ji, Songbai; Roberts, David W; Hartov, Alex; Paulsen, Keith D
2011-02-01
We compared trilinear interpolation to voxel nearest neighbor and distance-weighted algorithms for fast and accurate processing of true 3-dimensional ultrasound (3DUS) image volumes. In this study, the computational efficiency and interpolation accuracy of the 3 methods were compared on the basis of a simulated 3DUS image volume, 34 clinical 3DUS image volumes from 5 patients, and 2 experimental phantom image volumes. We show that trilinear interpolation improves interpolation accuracy over both the voxel nearest neighbor and distance-weighted algorithms yet achieves real-time computational performance that is comparable to the voxel nearest neighbor algrorithm (1-2 orders of magnitude faster than the distance-weighted algorithm) as well as the fastest pixel-based algorithms for processing tracked 2-dimensional ultrasound images (0.035 seconds per 2-dimesional cross-sectional image [76,800 pixels interpolated, or 0.46 ms/1000 pixels] and 1.05 seconds per full volume with a 1-mm(3) voxel size [4.6 million voxels interpolated, or 0.23 ms/1000 voxels]). On the basis of these results, trilinear interpolation is recommended as a fast and accurate interpolation method for rectilinear sampling of 3DUS image acquisitions, which is required to facilitate subsequent processing and display during operating room procedures such as image-guided neurosurgery.
Measurement of CSF volume with 3D-FASE MRI
International Nuclear Information System (INIS)
Kanayama, Shoichi; Calderon, A.; Makita, Jun-ichi; Ohara, Yukou; Tsunoda, Akira; Sato, Kiyoshi.
1997-01-01
A noninvasive and fast cerebrospinal fluid (CSF) volume measurement method has been developed using 3D-FASE MRI and a semi-automatic segmentation process. Images with a high CSF/(gray and white matter) ratio (about 10-20) were obtained with a heavily T 2 weighted 3D-FASE sequence. The CSF region was segmented with a region growing method and the volume was calculated from the number of segmented voxels with a signal intensity weighted summation. Total measurement time was about 30 minutes for each study. The errors of the measured volumes were within 10% for the phantom experiments. Intracranial CSF volumes of normal volunteers ranged between about 100 and 200 cc and the ventricle/intracranial CSF ratio was about 10%. 3D display of the segmented intracranial and ventricle CSF regions was also carried out and proved to be useful to understand the anatomy. Increased intracranial and/or ventricle CSF volumes were obtained for a hydrocephalic patient and one patient with probable cerebral atrophy. The results suggest that the developed method could be used for the diagnosis of patients with neurological diseases. (author)
Energy Technology Data Exchange (ETDEWEB)
Newkirk, H.W. (comp.)
1976-05-01
Volume I deals with sources (what the emissions are and where they come from), trends (quantities of emissions and their dispersion with time), and costs of control (what it takes in time, energy, and money to meet minimum standards). Volume II concerns itself with the public health effects of energy production and utilization. Volume III summarizes the various techniques for controlling emissions, technological as well as economic, social, and political. (For abstracts of Vols. II and III, see ERDA Energy Research Abstracts, Vol. 2, Absts. 5764 and 5670, respectively) Each volume is divided into sections dealing with the atmosphere, water, land, and social activities--each division indicating a particular sphere of man's environment affected by energy production and use. The sources of information that were used in this study included textbooks, journal articles, technical reports, memoranda, letters, and personal communications. These are cited in the text at the end of each subsection and on the applicable tables and figures.
Introduction to "Global Tsunami Science: Past and Future, Volume III"
Rabinovich, Alexander B.; Fritz, Hermann M.; Tanioka, Yuichiro; Geist, Eric L.
2018-04-01
Twenty papers on the study of tsunamis are included in Volume III of the PAGEOPH topical issue "Global Tsunami Science: Past and Future". Volume I of this topical issue was published as PAGEOPH, vol. 173, No. 12, 2016 and Volume II as PAGEOPH, vol. 174, No. 8, 2017. Two papers in Volume III focus on specific details of the 2009 Samoa and the 1923 northern Kamchatka tsunamis; they are followed by three papers related to tsunami hazard assessment for three different regions of the world oceans: South Africa, Pacific coast of Mexico and the northwestern part of the Indian Ocean. The next six papers are on various aspects of tsunami hydrodynamics and numerical modelling, including tsunami edge waves, resonant behaviour of compressible water layer during tsunamigenic earthquakes, dispersive properties of seismic and volcanically generated tsunami waves, tsunami runup on a vertical wall and influence of earthquake rupture velocity on maximum tsunami runup. Four papers discuss problems of tsunami warning and real-time forecasting for Central America, the Mediterranean coast of France, the coast of Peru, and some general problems regarding the optimum use of the DART buoy network for effective real-time tsunami warning in the Pacific Ocean. Two papers describe historical and paleotsunami studies in the Russian Far East. The final set of three papers importantly investigates tsunamis generated by non-seismic sources: asteroid airburst and meteorological disturbances. Collectively, this volume highlights contemporary trends in global tsunami research, both fundamental and applied toward hazard assessment and mitigation.
International Nuclear Information System (INIS)
Beck, Christian
2012-01-01
Following the pioneering discovery of alpha clustering and of molecular resonances, the field of nuclear clustering is today one of those domains of heavy-ion nuclear physics that faces the greatest challenges, yet also contains the greatest opportunities. After many summer schools and workshops, in particular over the last decade, the community of nuclear molecular physicists has decided to collaborate in producing a comprehensive collection of lectures and tutorial reviews covering the field. This second volume follows the successful Lect. Notes Phys. 818 (Vol.1), and comprises six extensive lectures covering the following topics: - Microscopic cluster models - Neutron halo and break-up reactions - Break-up reaction models for two- and three-cluster projectiles - Clustering effects within the di-nuclear model - Nuclear alpha-particle condensates - Clusters in nuclei: experimental perspectives By promoting new ideas and developments while retaining a pedagogical style of presentation throughout, these lectures will serve as both a reference and an advanced teaching manual for future courses and schools in the fields of nuclear physics and nuclear astrophysics. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Beck, Christian (ed.) [Strasbourg Univ. (France). Inst. Pluridiciplinaire Hubert Curien
2012-07-01
Following the pioneering discovery of alpha clustering and of molecular resonances, the field of nuclear clustering is today one of those domains of heavy-ion nuclear physics that faces the greatest challenges, yet also contains the greatest opportunities. After many summer schools and workshops, in particular over the last decade, the community of nuclear molecular physicists has decided to collaborate in producing a comprehensive collection of lectures and tutorial reviews covering the field. This second volume follows the successful Lect. Notes Phys. 818 (Vol.1), and comprises six extensive lectures covering the following topics: - Microscopic cluster models - Neutron halo and break-up reactions - Break-up reaction models for two- and three-cluster projectiles - Clustering effects within the di-nuclear model - Nuclear alpha-particle condensates - Clusters in nuclei: experimental perspectives By promoting new ideas and developments while retaining a pedagogical style of presentation throughout, these lectures will serve as both a reference and an advanced teaching manual for future courses and schools in the fields of nuclear physics and nuclear astrophysics. (orig.)
International Nuclear Information System (INIS)
1995-04-01
This report documents the results of the combined effort of the NRC and the industry to produce improved Standard Technical Specifications (STS), Revision 1 for Babcock and Wilcox Plants. The changes reflected in Revision 1 resulted from the experience gained from license amendment applications to convert to these improved STS or to adopt partial improvements to existing technical specifications. This NUREG is the result of extensive public technical meetings and discussions between the Nuclear Regulatory Commission (NRC) staff and various nuclear power plant licensees, Nuclear Steam Supply System (NSSS) Owners Groups, NSSS vendors, and the Nuclear Energy Institute (NEI). The improved STS were developed based on the criteria in the Final Commission Policy Statement on Technical Specifications Improvements for Nuclear Power Reactors, dated July 22, 1993. The improved STS will be used as the basis for individual nuclear power plant licensees to develop improved plant-specific technical specifications. This report contains three volumes. Volume 1 contains the Specifications for all chapters and sections of the improved STS. Volume 2 contains the Bases for Chapters 2.0 and 3.0, and Sections 3.1--3.3 of the improved STS. Volume 3 contains the Bases for Sections 3.4--3.9 of the improved STS
Al-Seraih, Alaa; Belguesmia, Yanath; Baah, John; Szunerits, Sabine; Boukherroub, Rabah; Drider, Djamel
2017-02-01
Enterococcus faecalis B3A-B3B produces the bacteriocin B3A-B3B with activity against Listeria monocytogenes, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, but apparently not against fungi or Gram-negative bacteria, except for Salmonella Newport. B3A-B3B enterocin has two different nucleotides but similar amino acid composition to the class IIb MR10A-MR10B enterocin. B3A-B3B consists of two peptides of predicted molecular mass of 5176.31 Da (B3A) and 5182.21 Da (B3B). Importantly, B3A-B3B impeded biofilm formation of the foodborne pathogen L. monocytogenes 162 grown on stainless steel. The antimicrobial treatment of stainless steel with nisin (1 or 16 mg ml -1 ) decreased the cell numbers by about 2 log CFU ml -1 , thereby impeding the biofilm formation by L. monocytogenes 162 or its nisin-resistant derivative strain L. monocytogenes 162R. Furthermore, the combination of nisin and B3A-B3B enterocin reduced the MIC required to inhibit this pathogen grown in planktonic or biofilm cultures.
SEM and TEM characterization of the microstructure of post-compressed TiB2/2024Al composite.
Guo, Q; Jiang, L T; Chen, G Q; Feng, D; Sun, D L; Wu, G H
2012-02-01
In the present work, 55 vol.% TiB(2)/2024Al composites were obtained by pressure infiltration method. Compressive properties of 55 vol.% TiB(2)/2024Al composite under the strain rates of 10(-3) and 1S(-1) at different temperature were measured and microstructure of post-compressed TiB(2)/2024Al composite was characterized by scanning electron microscope (SEM) and transmission electron microscope (TEM). No trace of Al(3)Ti compound flake was found. TiB(2)-Al interface was smooth without significant reaction products, and orientation relationships ( [Formula: see text] and [Formula: see text] ) were revealed by HRTEM. Compressive strength of TiB(2)/2024Al composites decreased with temperature regardless of strain rates. The strain-rate-sensitivity of TiB(2)/2024Al composites increased with the increasing temperature. Fracture surface of specimens compressed at 25 and 250°C under 10(-3)S(-1) were characterized by furrow. Under 10(-3)S(-1), high density dislocations were formed in Al matrix when compressed at 25°C and dynamic recrystallization occurred at 250°C. Segregation of Mg and Cu on the subgrain boundary was also revealed at 550°C. Dislocations, whose density increased with temperature, were formed in TiB(2) particles under 1S(-1). Deformation of composites is affected by matrix, reinforcement and strain rate. Copyright © 2011 Elsevier Ltd. All rights reserved.
Highway Safety Program Manual: Volume 3: Motorcycle Safety.
National Highway Traffic Safety Administration (DOT), Washington, DC.
Volume 3 of the 19-volume Highway Safety Program Manual (which provides guidance to State and local governments on preferred highway safety practices) concentrates on aspects of motorcycle safety. The purpose and specific objectives of a State motorcycle safety program are outlined. Federal authority in the highway safety area and general policies…
Directory of Open Access Journals (Sweden)
Slapa Rafal
2011-01-01
Full Text Available Abstract Background The purpose of this study was to assess the advantages and disadvantages of 3D gray-scale and power Doppler ultrasound, including thin slice volume rendering (TSVR, applied for evaluation of thyroid nodules. Methods The retrospective evaluation by two observers of volumes of 71 thyroid nodules (55 benign, 16 cancers was performed using a new TSVR technique. Dedicated 4D ultrasound scanner with an automatic 6-12 MHz 4D probe was used. Statistical analysis was performed with Stata v. 8.2. Results Multiple logistic regression analysis demonstrated that independent risk factors of thyroid cancers identified by 3D ultrasound include: (a ill-defined borders of the nodule on MPR presentation, (b a lobulated shape of the nodule in the c-plane and (c a density of central vessels in the nodule within the minimal or maximal ranges. Combination of features provided sensitivity 100% and specificity 60-69% for thyroid cancer. Calcification/microcalcification-like echogenic foci on 3D ultrasound proved not to be a risk factor of thyroid cancer. Storage of the 3D data of the whole nodules enabled subsequent evaluation of new parameters and with new rendering algorithms. Conclusions Our results indicate that 3D ultrasound is a practical and reproducible method for the evaluation of thyroid nodules. 3D ultrasound stores volumes comprising the whole lesion or organ. Future detailed evaluations of the data are possible, looking for features that were not fully appreciated at the time of collection or applying new algorithms for volume rendering in order to gain important information. Three-dimensional ultrasound data could be included in thyroid cancer databases. Further multicenter large scale studies are warranted.
Assessment of Drug Binding Potential of Pockets in the NS2B/NS3 Dengue Virus Protein
Amelia, F.; Iryani; Sari, P. Y.; Parikesit, A. A.; Bakri, R.; Toepak, E. P.; Tambunan, U. S. F.
2018-04-01
Every year an endemic dengue fever estimated to affect over 390 million cases in over 128 countries occurs. However, the antigen types which stimulate the human immune response are variable, as a result, neither effective vaccines nor antiviral treatments have been successfully developed for this disease. The NS2B/NS3 protease of the dengue virus (DENV) responsible for viral replication is a potential drug target. The ligand-enzyme binding site determination is a key role in the success of virtual screening of new inhibitors. The NS2B/NS3 protease of DENV (PDB ID: 2FOM) has two pockets consisting of 37 (Pocket 1) and 27 (Pocket 2) amino acid residues in each pocket. In this research, we characterized the amino acid residues for binding sites in NS3/NS2B based on the hydrophobicity, the percentage of charged residues, volume, depth, ΔGbinding, hydrogen bonding and bond length. The hydrophobic percentages of both pockets are high, 59 % (Pocket 1) and 41% (Pocket 2) and the percentage of charged residues in Pocket 1 and 2 are 22% and 48%, and the pocket volume is less than 700 Å3. An interaction analysis using molecular docking showed that interaction between the ligand complex and protein in Pocket 1 is more negative than Pocket 2. As a result, Pocket 1 is the better potential target for a ligand to inhibit the action of NS2B/NS3 DENV.
Circular Cationic Compounds B3Rgn+ of Triangular Ion B3 Trapping Rare Gases
Institute of Scientific and Technical Information of China (English)
ZHANG Ruiwen; LI Anyong; LI Zhuozhe
2017-01-01
The circular cationic compounds B3Rgn+(n=1-3,Rg=He-Rn) formed by the electron-deficient aromatic ion B3+ trapping rare gases were studied theoretically.The formed B-Rg bond has large bonding energy in the range of 60--209 kJ/mol,its length is close to the stun of covalent radii of B and Rg,for Ar-Rn.The analyses based on the natural bond orbitals and electron density topology show that the B-Rg bonds for Ar-Rn have strong covalent character.The geometric structures,binding energy,bond nature and thermodynamic stability of the boron-rare gas compounds show that these species for Ar-Rn may be experimentally available.Several different theoretical studies have demonstrated that these triangular cations are aromatic.
Determination of pulmonary volume by CT
International Nuclear Information System (INIS)
Kakinuma, Ryutaro
1984-01-01
The pulmonary volume overlapping the shadows of the mediastinum and the hilus pulmonis in frontal chest films was determined by means of CT. The pulmonary volume, between the levels of the aortic arch and just above the right diaphragm, overlapping the shadows of the mediastinum and the hilus, was one fourth of the entire pulmonary volume between the same levels. When the lungs overlapping the mediastinum and the hilus were divided into a region overlapping the spine and the aorta (region A) and another region (region B), the ratio of the volume of region A to that of region B was 1:3. CT is useful for quantitative roentgenological anatomy of the lungs. (author)
49 CFR 545.7 - Reporting requirements for vehicles listed in § 541.3(b)(2).
2010-10-01
... VEHICLE THEFT PREVENTION STANDARD PHASE-IN AND SMALL-VOLUME LINE REPORTING REQUIREMENTS § 545.7 Reporting requirements for vehicles listed in § 541.3(b)(2). (a) General reporting requirements. Within 60 days after the... 49 Transportation 6 2010-10-01 2010-10-01 false Reporting requirements for vehicles listed in Â...
Yan, Yongke; Cho, Kyung-Hoon; Priya, Shashank
2012-03-01
In this letter, we report the electromechanical properties of textured 0.4Pb(Mg1/3Nb2/3)O3-0.25PbZrO3-0.35PbTiO3 (PMN-PZT) composition which has relatively high rhombohedral to tetragonal (R-T) transition temperature (TR-T of 160 °C) and Curie temperature (TC of 234 °C) and explore the effect of Mn-doping on this composition. It was found that MnO2-doped textured PMN-PZT ceramics with 5 vol. % BaTiO3 template (T-5BT) exhibited inferior temperature stability. The coupling factor (k31) of T-5BT ceramic started to degrade from 75 °C while the random counterpart showed a very stable tendency up to 180 °C. This degradation was associated with the "interface region" formed in the vicinity of BT template. MnO2 doped PMN-PZT ceramics textured with 3 vol. % BT and subsequently poled at 140 °C (T-3BT140) exhibited very stable and high k31 (>0.53) in a wide temperature range from room temperature to 130 °C through reduction in the interface region volume. Further, the T-3BT140 ceramic exhibited excellent hard and soft combinatory piezoelectric properties of d33 = 720 pC/N, k31 = 0.53, Qm = 403, tan δ = 0.3% which are very promising for high power and magnetoelectric applications.
Crisis Communication (Handbooks of Communication Science Vol. 23)
DEFF Research Database (Denmark)
Johansen, Winni
Vol. 23 - The Handbook of Communication Science General editors: Peter J. Schultz and Paul Cobley......Vol. 23 - The Handbook of Communication Science General editors: Peter J. Schultz and Paul Cobley...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. B Saha. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 11 November 1999 pp 65-71 Classroom. Inadequacy of Water Band Movement Technique for Kinetic Interpretation of RCOOH–NaHCO3 Reaction · P Sahoo B Saha.
Medical Surveillance Monthly Report (MSMR). Volume 15, Number 1, January 2008
2008-01-01
108.8 138.3 1.26 22.34 Idaho 60 99.8 51.9 1.16 13.40 Montana 69 119.5 49.9 1.38 33.13 New Mexico 72 78.6 79.1 0.91 -7.78 Nevada 96 142.3...May 2004. Note: Completeness and timeliness of reporting vary by facility. Shigella Hepatitis B Varicella Reporting locations Number of reports all... Varicella Reporting locations Number of reports all events† Food-borne Vaccine preventable Campylo- bacter Giardia Salmonella 24 VOL. 15 / NO. 1
Map of calculated radioactivity of fission product, 3
International Nuclear Information System (INIS)
Takeda, Tsuneo
1977-02-01
In this work, the radioactivities of fission products were calculated and summarized in contour maps and tables depending on irradiation and cooling times. The irradiation condition and other parameters used for the present calculation are shown in the followings. Neutron flux (N sub(th)): 3x10 13 n/sec/cm 2 Atom number of uranium: 1 mole (6x10 23 , ca. 271 gUO 2 ) Enrichment of U-235: 2.7% Range of irradiation time: 60-6x10 7 sec (ca. 1.9 y) Range of cooling time: 60-6x10 7 sec (ca. 1.9 y). Values of the neutron flux and the enrichment treated here are representative for common LWRs. The maps and tables of 560 nuclides are divided and compiled into the following three volumes. Vol. I: Maps of radioactivity of overall total, element total and each nuclide (Ni - Zr), Vol. II: Maps of radioactivity of each nuclide (Nb - Sb), Vol. III: Maps of radioactivity of each nuclide (Te - Tm). (auth.)
Equilibrium states of the systems B-Cl-H and B-Cl-H-O at elevated temperatures
International Nuclear Information System (INIS)
Wagner, W.; Bochmann, G.
1982-01-01
By means of the computer program EHMSYS the equilibrium compositions are calculated in the reaction systems H 2 /BCl 3 and H 2 /BCl 3 /H 2 O with initial mixtures of 50, 25, 10, 5, 2, and 1 volume percent BCl 3 as well as initial volume portions of 0, 0.02, 0.05, 0.10, 0.25, and 0.50 volume percent gaseous water at temperatures of 800, 1000, 1200, and 1400 K. The results confirm the great complexity of the reaction system. The presence of oxygen causes the formation of gaseous B 3 H 3 O 3 and B 3 Cl 3 O 3 and in general a total suppression or at least a drastic decrease of the deposition of solid boron. Coincidentally, the amounts of gaseous haloboranes at the eqiulibrium are increased
DEFF Research Database (Denmark)
Kávai, M; Rasmussen, J M; Baatrup, G
1988-01-01
, but the binding was low (2-3%) when compared to the binding of the corresponding IgG-IC (50-60%). Solid phase IC were prepared by coating microwells with heat-aggregated bovine serum albumin (BSA) followed by incubation with rabbit IgM anti-BSA antibody. The IC were reacted with human serum at 37 degrees C....... The binding of C3b-iC3b was determined by use of biotinylated F(ab')2 antibodies to C3b-C3c and avidin-coupled alkaline phosphatase. The incorporation of C3b-iC3b into solid-phase IgM-IC increased when increasing amounts of IgM antibody were reacted with the antigen. The binding reaction was slow, reaching...
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. B Talukdar. Articles written in Pramana – Journal of Physics. Volume 58 Issue 3 March 2002 pp 443-448 Research Articles. Korteweg–de Vries hierarchy using the method of base equations · Subhendu Chakrabarti J Pal B Talukdar · More Details Abstract Fulltext PDF.
African Journal of Clinical and Experimental Microbiology - Vol 5, No ...
African Journals Online (AJOL)
African Journal of Clinical and Experimental Microbiology - Vol 5, No 3 (2004) ... In Peripheral Leukocyte And Body Fluids Of Onchocerciasis Patients Treated With ... A Study Of Asymptomatic Bacteriuria In Pregnancy In Ile - Ife, Southwestern ...
Introduction to “Global tsunami science: Past and future, Volume III”
Rabinovich, Alexander B.; Fritz, Hermann M.; Tanioka, Yuichiro; Geist, Eric L.
2018-01-01
Twenty papers on the study of tsunamis are included in Volume III of the PAGEOPH topical issue “Global Tsunami Science: Past and Future”. Volume I of this topical issue was published as PAGEOPH, vol. 173, No. 12, 2016 and Volume II as PAGEOPH, vol. 174, No. 8, 2017. Two papers in Volume III focus on specific details of the 2009 Samoa and the 1923 northern Kamchatka tsunamis; they are followed by three papers related to tsunami hazard assessment for three different regions of the world oceans: South Africa, Pacific coast of Mexico and the northwestern part of the Indian Ocean. The next six papers are on various aspects of tsunami hydrodynamics and numerical modelling, including tsunami edge waves, resonant behaviour of compressible water layer during tsunamigenic earthquakes, dispersive properties of seismic and volcanically generated tsunami waves, tsunami runup on a vertical wall and influence of earthquake rupture velocity on maximum tsunami runup. Four papers discuss problems of tsunami warning and real-time forecasting for Central America, the Mediterranean coast of France, the coast of Peru, and some general problems regarding the optimum use of the DART buoy network for effective real-time tsunami warning in the Pacific Ocean. Two papers describe historical and paleotsunami studies in the Russian Far East. The final set of three papers importantly investigates tsunamis generated by non-seismic sources: asteroid airburst and meteorological disturbances. Collectively, this volume highlights contemporary trends in global tsunami research, both fundamental and applied toward hazard assessment and mitigation.
GfW-handbook for data compilation of irradiation tested electronic components. Vol. 3
International Nuclear Information System (INIS)
Wulf, F.; Braeunig, D.; Boden, A.
1984-05-01
The 2nd edition is a continuation of the 1st edition and is published as a loose-leaf handbook. The 1st edition contained 190 test reports. In the volume 1 and volume 2 of the 2nd edition 120 test reports have been published so far. The present volume 3 of the 2nd edition provides further 53 test reports. These test reports of currently in space projects used electronic components have a standardized format. The results are given in a comprehensive but easily to handle graphical and tabular presentation. Statistical values are given in order to facilitate the components life time evaluation in a radiative environment. (orig./HP) [de
Energy Technology Data Exchange (ETDEWEB)
Sasanelli, Myriam; Meignan, Michel; Haioun, Corinne; Itti, Emmanuel [Paris-Est University, Nuclear Medicine and Lymphoid Malignancies Unit, Henri Mondor Hospital, Creteil (France); Berriolo-Riedinger, Alina; Casasnovas, Rene-Olivier [Nuclear Medicine and Hematology, Georges-Francois Leclerc Center, Le Bocage Hospital, Dijon (France); Biggi, Alberto; Gallamini, Andrea [Nuclear Medicine and Hematology, Santa Croce e Carle Hospital, Cuneo (Italy); Siegel, Barry A.; Cashen, Amanda F. [Washington University School of Medicine, Nuclear Medicine and Oncology, Siteman Cancer Center, St. Louis, MO (United States); Vera, Pierre; Tilly, Herve [Nuclear Medicine and Hematology, Henri Becquerel Center, Rouen (France); Versari, Annibale [Nuclear Medicine, Santa Maria Nuova Hospital-IRCCS, Reggio Emilia (Italy)
2014-11-15
We investigated the prognostic value of total metabolic tumour volume (TMTV) in diffuse large B-cell lymphoma (DLBCL). TMTV was measured in 114 patients with newly diagnosed DLBCL who underwent {sup 18}F-FDG PET/CT at baseline before immunochemotherapy. TMTV was computed by summing the volumes of all lymphomatous lesions after applying the local SUVmax threshold of 41 % using semiautomatic software. Prognostic value was assessed by Kaplan-Meier estimates of progression-free survival (PFS) and overall survival (OS). Median follow-up was 39 months. Average pretherapy TMTV was 509 ± 568 cm{sup 3}. The 3-year estimates of PFS were 77 % in the low metabolic burden group (TMTV ≤550 cm{sup 3}) and 60 % in the high metabolic burden group (TMTV >550 cm{sup 3}, p = 0.04), and prediction of OS was even better (87 % vs. 60 %, p = 0.0003). Cox regression showed independence of TMTV for OS prediction (p = 0.002) compared with other pretherapy indices of tumour burden, such as tumour bulk and the International Prognostic Index. Pretherapy TMTV is an independent predictor of outcome in patients with DLBCL. (orig.)
International Nuclear Information System (INIS)
1995-04-01
This report documents the results of the combined effort of the NRC and the industry to produce improved Standard Technical Specifications (STS), Revision 1 for General Electric BWR/4 Plants. The changes reflected in Revision 1 resulted from the experience gained from license amendment applications to convert to these improved STS or to adopt partial improvements to existing technical specifications. This NUREG is the result of extensive public technical meetings and discussions between the Nuclear Regulatory Commission (NRC) staff and various nuclear power plant licensees, Nuclear Steam Supply System (NSSS) Owners Groups, NSSS vendors, and the Nuclear Energy Institute (NEI). The improved STS were developed based on the criteria in the Final Commission Policy Statement on Technical Specifications Improvements for Nuclear Power Reactors, dated July 22, 1993. The improved STS will be used as the basis for individual nuclear power plant licensees to develop improved plant-specific technical specifications. This report contains three volumes. Volume 1 contains the specifications for all chapters and sections of the improved STS. Volume 2 contains he Bases for Chapters 2.0 and 3.0, and Sections 3.1-3.3 of the improved STS. This document, Volume 3, contains the Bases for Sections 3.4-3.10 of the improved STS
Energy Technology Data Exchange (ETDEWEB)
Hakin, Andrew W. [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada)]. E-mail: hakin@uleth.ca; Liu Jinlian [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada); Erickson, Kristy [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada); Munoz, Julie-Vanessa [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada); Rard, Joseph A. [Energy and Environment Directorate, Lawrence Livermore National Laboratory, University of California, Livermore, CA 94550 (United States)
2005-02-01
Relative densities and relative massic heat capacities have been measured for acidified solutions of Y(NO{sub 3}){sub 3}(aq), Pr(NO{sub 3}){sub 3}(aq), and Gd(NO{sub 3}){sub 3}(aq) at T = (288.15, 298.15, 313.15, and 328.15) K and p = 0.1 MPa. In addition, relative densities and massic heat capacities have been measured at the same temperatures and pressure for Y(NO{sub 3}){sub 3}(aq) and Ho(NO{sub 3}){sub 3}(aq) solutions without excess acid (n.b. measurements at T = 328.15 K for Ho(NO{sub 3}){sub 3}(aq) were not performed due to the limited volume of solution available). Apparent molar volumes and apparent molar heat capacities for the aqueous salt solutions have been calculated from the experimental apparent molar properties of the acidified solutions using Young's rule, whereas the apparent molar properties of the solutions without excess acid were calculated directly from the measured densities and massic heat capacities. The two sets of data for the Y(NO{sub 3}){sub 3}(aq) systems provide a check of the internal consistency of the Young's rule approach we have utilised. The concentration dependences of the apparent molar volumes and heat capacities of the aqueous salt solutions have been modelled at each investigated temperature using the Pitzer ion interaction equations to yield apparent molar properties at infinite dilution. Complex formation within the aqueous rare earth nitrate systems is discussed qualitatively by probing the concentration dependence of apparent molar volumes and heat capacities. In spite of the complex formation in the aqueous rare earth nitrate systems, there is a high degree of self-consistency between the apparent molar volumes and heat capacities at infinite dilution reported in this manuscript and those previously reported for aqueous rare earth perchlorates.
International Nuclear Information System (INIS)
Pickett, J.S.; Frank, L.A.; Kurth, W.S.
1988-06-01
This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, 1985, through June 30, 1988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). Three Master's and three Ph.D. theses were written using PDP instrumentation data. These theses are listed in Volume 2, Part B
Image quality and volume computed tomography air kerma index (Cvol) evaluation in Recife
International Nuclear Information System (INIS)
Andrade, Marcos Ely Almeida
2008-01-01
The Computed Tomography (CT) is an important diagnostic imaging method, widely used. However, in spite of all the advantages and technologic advances within the CT scanners, the tomographic procedures result in high absorbed doses to patients. The main objective of this work was to perform a dosimetric study of CT scanners located at Recife and to evaluate the image quality on CT examinations in these equipment. The volume CT air kerma index (C VOL ) and air kerma length product (P KL,CT ) were estimated. These values were calculated using normalized weighted air kerma indexes in CT standard dosimetry phantoms ( n C W ), supplied by ImPACT group for several CT scanners, and the scan parameters of routine head, routine chest and hi-resolution chest CT exams performed at 20 institutions. The irradiation parameters of 15 adult patients for each CT procedure were registered at six participating centres, at which the phantom from the American College of Radiology (ACR) CT accreditation protocol was used for the image quality measurements. For routine head exams, the C VOL values varied between 12 and 58 mGy (at the posterior fossa) and 15 to 58 mGy (at the cerebrum) and the P KL,CT , from 150 to 750 mGy·cm. The C VOL values for routine chest procedures varied from 3 to 26 mGy and the P KL,CT , between 120 and 460 mGy·cm. In relation to Hi-resolution chest exams, C VOL values were from 1.0 to 2.7 mGy and the P KL,CT values varied between 24 and 67 mGy·cm. The image quality evaluations results showed that almost all scanners presented at least one inadequacy. One of the equipment presented faults at 70% of the tests. With regard to the image noise, only two scanners presented acceptable results. From these results, it is possible to conclude that the volume CT air kerma index values are lower than the European reference levels. However, the image quality of these CT scanners does not attend the ACR requirements, suggesting the need to implement quality assurance
Altitude Acclimatization and Blood Volume: Effects of Exogenous Erythrocyte Volume Expansion
National Research Council Canada - National Science Library
Sawka, M
1996-01-01
...: (a) altitude acclimatization effects on erythrocyte volume and plasma volume; (b) if exogenous erythrocyte volume expansion alters subsequent erythrocyte volume and plasma volume adaptations; (c...
Compressive Strength of EN AC-44200 Based Composite Materials Strengthened with α-Al2O3 Particles
Directory of Open Access Journals (Sweden)
Kurzawa A.
2017-06-01
Full Text Available The paper presents results of compressive strength investigations of EN AC-44200 based aluminum alloy composite materials reinforced with aluminum oxide particles at ambient and at temperatures of 100, 200 and 250°C. They were manufactured by squeeze casting of the porous preforms made of α-Al2O3 particles with liquid aluminum alloy EN AC-44200. The composite materials were reinforced with preforms characterized by the porosities of 90, 80, 70 and 60 vol. %, thus the alumina content in the composite materials was 10, 20, 30 and 40 vol.%. The results of the compressive strength of manufactured materials were presented and basing on the microscopic observations the effect of the volume content of strengthening alumina particles on the cracking mechanisms during compression at indicated temperatures were shown and discussed. The highest compressive strength of 470 MPa at ambient temperature showed composite materials strengthened with 40 vol.% of α-Al2O3 particles.
No-migration variance petition. Volume 3, Revision 1: Appendix B, Attachments A through D
Energy Technology Data Exchange (ETDEWEB)
1990-03-01
Volume III contains the following attachments: TRUPACT-II content codes (TRUCON); TRUPACT-II chemical list; chemical compatibility analysis for Rocky Flats Plant waste forms (Appendix 2.10.12 of TRUPACT-II safety analysis report); and chemical compatibility analyses for waste forms across all sites.
African Journal for Physical Activity and Health Sciences - Vol 21 ...
African Journals Online (AJOL)
African Journal for Physical Activity and Health Sciences - Vol 21, No 3 (2015) ... Factors Influencing the Health of Men in Polygynous Relationship · EMAIL FULL ... Views of HIV Positive Pregnant Women on Accessibility of the Prevention of ...
An open source workflow for 3D printouts of scientific data volumes
Loewe, P.; Klump, J. F.; Wickert, J.; Ludwig, M.; Frigeri, A.
2013-12-01
As the amount of scientific data continues to grow, researchers need new tools to help them visualize complex data. Immersive data-visualisations are helpful, yet fail to provide tactile feedback and sensory feedback on spatial orientation, as provided from tangible objects. The gap in sensory feedback from virtual objects leads to the development of tangible representations of geospatial information to solve real world problems. Examples are animated globes [1], interactive environments like tangible GIS [2], and on demand 3D prints. The production of a tangible representation of a scientific data set is one step in a line of scientific thinking, leading from the physical world into scientific reasoning and back: The process starts with a physical observation, or from a data stream generated by an environmental sensor. This data stream is turned into a geo-referenced data set. This data is turned into a volume representation which is converted into command sequences for the printing device, leading to the creation of a 3D printout. As a last, but crucial step, this new object has to be documented and linked to the associated metadata, and curated in long term repositories to preserve its scientific meaning and context. The workflow to produce tangible 3D data-prints from science data at the German Research Centre for Geosciences (GFZ) was implemented as a software based on the Free and Open Source Geoinformatics tools GRASS GIS and Paraview. The workflow was successfully validated in various application scenarios at GFZ using a RapMan printer to create 3D specimens of elevation models, geological underground models, ice penetrating radar soundings for planetology, and space time stacks for Tsunami model quality assessment. While these first pilot applications have demonstrated the feasibility of the overall approach [3], current research focuses on the provision of the workflow as Software as a Service (SAAS), thematic generalisation of information content and
Fitrina, Sofia; Kristiawan, Budi; Surojo, Eko; Wijayanta, Agung Tri; Miyazaki, Takahiko; Koyama, Shigeru
2018-02-01
Machining is one of the largest and most widely used methods of production segments in industries. In this way, cutting fluids play an important role in minimizing production time, cost, and energy in various machining operations. This paper presents an experimental investigation into minimum quantity lubrication (MQL) with Al2O3 nanoparticles in drilling process of common rail as work material with DPSCM 435H code to analyze its influence on cutting parameters. Al2O3 has been selected for nanoparticles in this study due to its non-toxicity and spherical shapes for enhanced tribological attributes. Experiments were carried out for two different conditions; MQL + nanofluids (250 ml/h) and conventional cutting fluid (15 liters/min). In this work, nanofluid was prepared by adding Al2O3 nanoparticles (13 nm size) into the conventional cutting fluid in the specific proportion of 1.2 vol.%. The experiment results reveal that the performance of Al2O3 nanofluid in term surface roughness is better compared to the conventional cutting fluid, but the result of cutting temperature and chip morphology does not match with the previous experiment because volume fraction of nanofluid is too high. It means the specific proportion of 1.2 vol.% nanofluid is not best volume fraction for getting best cooling properties. This experiment does not focus on variations of volume fraction but on cooling conditions.
CRADA/NFE-15-05761 Report: Additive Manufacturing of Isotropic NdFeB Bonded Permanent Magnets
Energy Technology Data Exchange (ETDEWEB)
Paranthaman, M Parans [ORNL
2016-07-18
The technical objective of this technical collaboration phase I proposal is to fabricate net shape isotropic NdFeB bonded magnets utilizing additive manufacturing technologies at the ORNL MDF. The goal is to form complex shapes of thermoplastic and/or thermoset bonded magnets without expensive tooling and with minimal wasted material. Two additive manufacturing methods; the binder jet process; and big area additive manufacturing (BAAM) were used. Binder jetting produced magnets with the measured density of the magnet of 3.47 g/cm3, close to 46% relative to the NdFeB single crystal density of 7.6 g/cm3 were demonstrated. Magnetic measurements indicate that there is no degradation in the magnetic properties. In addition, BAAM was used to fabricate isotropic near-net-shape NdFeB bonded magnets with magnetic and mechanical properties comparable or better than those of traditional injection molded magnets. The starting polymer magnet composite pellets consist of 65 vol% isotropic NdFeB powder and 35 vol% polyamide (Nylon-12). The density of the final BAAM magnet product reached 4.8 g/cm3, and the room temperature magnetic properties are: Intrinsic coercivity Hci = 8.65 kOe, Remanence Br = 5.07 kG, and energy product (BH)max = 5.47 MGOe (43.50 kJ/m3). This study provides a new pathway for preparing near-net shape bonded magnets for various magnetic applications.
Magnetic and Moessbauer studies on GdCo3B2 and DyCo3B2
International Nuclear Information System (INIS)
Malik, S.K.; Umarji, A.M.; Shenoy, G.K.
1984-10-01
Magnetization and Moessbauer studies have been carried out on GdCo 3 B 2 and DyCo 3 B 2 . These compounds are magnetically ordered with Curie temperatures of 56 0 and 21 0 K respectively. The Co atoms are either nonmagnetic or carry a small moment in these compounds. The saturation moment of DyCo 3 B 2 at 5 0 K is smaller than the Dy 3+ free-ion value. From 161 Dy Moessbauer studies, the measured hyperfine magnetic field at the Dy site is also observed to be smaller than the free-ion value. 155 Gd Moessbauer measurements in GdCo 3 B 2 reveal the presence of large crystalline electric fields at the rare earth site. This causes the moment and the hyperfine field at the Dy site in DyCo 3 B 2 to be reduced from its free-ion value
International Nuclear Information System (INIS)
Haug, H.O.
1982-01-01
This volume of the uranium series of the Gmelin handbook deals with the anion exchange of uranium. Compounds of the valence states of III, IV, V and VI of uranium in halide, nitrate, sulfate, phosphate, and carbonate media as well as in media containing organic complexing agents are treated. The literature cited covers the period from about 1947 to the end of 1980. (RB) [de
International Nuclear Information System (INIS)
Levashov, E.A.; Akulinin, P.V.; Sorokin, M.N.; Sviridova, T.A.; Khosomi, S.; Okh'yanagi, M.; Koizumi, S.
2004-01-01
For the first time a study is made into specific features of phase- and structure formation in diamond-bearing functionally gradient materials (FGM) with a ceramic binder on the basis of titanium diboride and nitride TiB 2 -TiN as well as titanium silicide and nitride Ti 5 Si 3 -TiN. For a titanium diboride and nitride base binder the maximum residual strength of diamond grains is 24 N for a specimen with 12.5 vol. % of diamond and 29 N for a specimen with 25 vol. % of diamond in a charge layer when an initial strength of diamond grains is equal to 37 N. For a titanium silicide and nitride base binder the residual strength of diamond in synthesized products is 32.5 and 28.7 N for specimens with 12.5 and 25 vol. % of diamond respectively, the initial strength of diamond grains being the same. A positive effect is shown for a 5% additive of titanium hydride in a charge diamond-bearing layer on the preservation of diamond in a tita nium diboride and nitride binder. Optimal conditions are determined to provide the possibility of obtaining high-quality products with a high degree of preservation and strength of diamond grains [ru
Energy Technology Data Exchange (ETDEWEB)
Cline, S.R.; Denton, D.L.; Giaquinto, J.M.; McCracken, M.K.; Starr, R.C.
1999-04-01
These appendices support the results and discussion of the laboratory work performed to evaluate the feasibility of in situ chemical oxidation for Idaho National Environmental and Engineering Laboratory's (INEEL) Test Area North (TAN) which is contained in ORNL/TM-1371 l/Vol. This volume contains Appendices C-E. Appendix C is a compilation of all recorded data and mathematical calculations made to interpret the data. For the Task 3 and Task 4 work, the spreadsheet column definitions are included immediately before the actual spreadsheet pages and are listed as ''Sample Calculations/Column Definitions'' in the table of contents. Appendix D includes the chronological order in which the experiments were conducted and the final project costs through October 1998. Appendix E is a compilation of the monthly progress reports submitted to INEEL during the course of the project.
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. K B Sinha. Articles written in Resonance – Journal of Science Education. Volume 3 Issue 6 June 1998 pp 80-81 Book Review. Algebra in Ancient and Modern Times · K B Sinha · More Details Fulltext PDF ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...
AFRREV IJAH, Vol.3 (1) January, 2014
African Journals Online (AJOL)
Toshiba
2014-01-09
Jan 9, 2014 ... capital, controlled large territories and a corresponding volume of trade. However ... Today, entrenched poverty, inequality, and political strife in ... The population of Ogoni in Central Africa increased greatly with the social and.
Energy Technology Data Exchange (ETDEWEB)
None
1988-05-01
This appendix is one of nine volumes, and presents data describing wells completed at the Hanford Site during the fourth quarter of calendar year 1987 (October through December). The data in this volume of Appendix B cover the following wells: 299-W6-2; 299-W7-1; 299-W7-2; 299-W7-3; 299-W7-4. The data are presented in the following order: Well Completion Report/Title III Inspection List, Inspection Plan, As-Built Diagram, Logging Charts, and Drill Logs.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
This annual report of the US Nuclear Regulatory Commission`s Office for Analysis and Evaluation of Operational Data (AEOD) describes activities conducted during 1996. The report is published in three parts. NUREG-1272, Vol. 10, No. 1, covers power reactors and presents an overview of the operating experience of the nuclear power industry from the NRC perspective, including comments about trends of some key performance measures. The report also includes the principal findings and issues identified in AEOD studies over the past year and summarizes information from such sources as licensee event reports and reports to the NRC`s Operations Center. NUREG-1272, Vol. 10, No. 2, covers nuclear materials and presents a review of the events and concerns during 1996 associated with the use of licensed material in nonreactor applications, such as personnel overexposures and medical misadministrations. Both reports also contain a discussion of the Incident Investigation Team program and summarize both the Incident Investigation Team and Augmented Inspection Team reports. Each volume contains a list of the AEOD reports issued from CY 1980 through 1996. NUREG-1272, Vol. 10, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC`s mission in 1996.
International Nuclear Information System (INIS)
1997-12-01
This annual report of the US Nuclear Regulatory Commission's Office for Analysis and Evaluation of Operational Data (AEOD) describes activities conducted during 1996. The report is published in three parts. NUREG-1272, Vol. 10, No. 1, covers power reactors and presents an overview of the operating experience of the nuclear power industry from the NRC perspective, including comments about trends of some key performance measures. The report also includes the principal findings and issues identified in AEOD studies over the past year and summarizes information from such sources as licensee event reports and reports to the NRC's Operations Center. NUREG-1272, Vol. 10, No. 2, covers nuclear materials and presents a review of the events and concerns during 1996 associated with the use of licensed material in nonreactor applications, such as personnel overexposures and medical misadministrations. Both reports also contain a discussion of the Incident Investigation Team program and summarize both the Incident Investigation Team and Augmented Inspection Team reports. Each volume contains a list of the AEOD reports issued from CY 1980 through 1996. NUREG-1272, Vol. 10, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC's mission in 1996
Editor's welcome, PORTAL, Vol. 3, No. 1, January 2006
Directory of Open Access Journals (Sweden)
Paul Allatson
2006-02-01
Full Text Available Welcome to the first appearance of PORTAL for 2006 (vol. 3, no. 1, a special issue entitled ‘Other Worlds’ guest edited by James Goodman and Christina Ho from the Faculty of Humanities and Social Sciences, University of Technology Sydney (UTS. The papers collected in this special issue focus on what the guest editors call “the transformative power of social movements” that respond to the processes and discourses of globalization and globalism by generating alternative sites and spaces of agency, or ‘other worlds.’ The contributors to the issue originally presented papers at a conference held in April 2005 in Sydney, with the title ‘Other Worlds: Social Movements and the Making of Alternatives.’ That conference was organized by the Research Initiative on International Activism at UTS, and supported by the Research Committee on Social Movements and Collective Action of the International Sociological Association. The Editorial Committee of PORTAL would like to thank both institutions for their support of the event that led to this special issue. I would also like to thank Wayne Peake, Kate Barclay, and Murray Pratt for their editorial efforts in seeing this issue through to publication. The Editorial Committee is pleased to showcase in the Cultural Works Section a short meditative piece by local writer Joel Scott, who is currently undertaking studies in Pamplona, Spain. When considered in the context of the special issue’s discussions of ‘other worlds’ that precede it, Scott’s ‘God, We’re Not Immigrants! A Reflection on Moving and Staying,’ provides an evocative insight into the sociocultural and imaginative limits that may preclude the construction of alternative ‘worlds.’
1988 DOE model conference proceedings: Volume 3
International Nuclear Information System (INIS)
1988-01-01
These Proceedings of the October 3 - 7, 1988, DOE Model Conference are a compilation of the papers that were presented in the technical or poster sessions at the conference. Papers and posters not submitted for publication are not included in the Proceedings. The Table of Contents lists the titles of papers as well as the names of the presenters. These individuals are not, in all cases, the primary authors of the papers published. The actual title pages, appearing later with the papers, show the primary author(s) and all co-authors. The papers in all three volumes of the proceedings appear as they were originally submitted for publication and have not been edited or changed in any way. Topics included in Volume 3 include treatment of soils, waste characterization and certification, waste minimization site remediation management plans and programs, and training programs
Serial Changes in 3-Dimensional Supraspinatus Muscle Volume After Rotator Cuff Repair.
Chung, Seok Won; Oh, Kyung-Soo; Moon, Sung Gyu; Kim, Na Ra; Lee, Ji Whan; Shim, Eungjune; Park, Sehyung; Kim, Youngjun
2017-08-01
There is considerable debate on the recovery of rotator cuff muscle atrophy after rotator cuff repair. To evaluate the serial changes in supraspinatus muscle volume after rotator cuff repair by using semiautomatic segmentation software and to determine the relationship with functional outcomes. Case series; Level of evidence, 4. Seventy-four patients (mean age, 62.8 ± 8.8 years) who underwent arthroscopic rotator cuff repair and obtained 3 consecutive (preoperatively, immediately postoperatively, and later postoperatively [≥1 year postoperatively]) magnetic resonance imaging (MRI) scans having complete Y-views were included. We generated a 3-dimensional (3D) reconstructed model of the supraspinatus muscle by using in-house semiautomatic segmentation software (ITK-SNAP) and calculated both the 2-dimensional (2D) cross-sectional area and 3D volume of the muscle in 3 different views (Y-view, 1 cm medial to the Y-view [Y+1 view], and 2 cm medial to the Y-view [Y+2 view]) at the 3 time points. The area and volume changes at each time point were evaluated according to repair integrity. Later postoperative volumes were compared with immediately postoperative volumes, and their relationship with various clinical factors and the effect of higher volume increases on range of motion, muscle power, and visual analog scale pain and American Shoulder and Elbow Surgeons scores were evaluated. The interrater reliabilities were excellent for all measurements. Areas and volumes increased immediately postoperatively as compared with preoperatively; however, only volumes on the Y+1 view and Y+2 view significantly increased later postoperatively as compared with immediately postoperatively ( P < .05). There were 9 patients with healing failure, and area and volume changes were significantly less later postoperatively compared with immediately postoperatively at all measurement points in these patients ( P < .05). After omitting the patients with healing failure, volume increases
Energy Technology Data Exchange (ETDEWEB)
None
1977-01-17
Results are presented of an 8-month study to develop alternative non-site-specific OTEC facilities/platform requirements for an integrated OTEC test program which may include land and floating test facilities. Volume II--Appendixes is bound in three parts (A, B, and C) which together comprise a compendium of the most significant detailed data developed during the study. Part B provides an annotated test list and describes component tests and system tests.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. N B SHIRSATH. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 44. 3D Architectured polyazomethine gel synthesis: its self-assembled intercalating complexation with nitro aromatic acceptor · D S RAGHUVANSHI N B SHIRSATH P P ...
Trans-Caspian gas pipeline feasibility study. Volume 3
International Nuclear Information System (INIS)
1999-01-01
This study, conducted by Enron Engineering and Construction Company, was funded by the US Trade and Development Agency. The study provides detailed information concerning natural gas demand in Turkey and Southern Europe. The purpose of the study is to estimate the rate at which new gas can be absorbed in the Turkish market and be re-exported to the markets in Europe, as well as to forecast Turkish natural gas demand for the period up to 2020. The study also evaluates gas demand and pricing for the market in the 2002--2005 time frame. This is Volume 3 of a 3-volume report, and it is divided into the following sections: (1) Executive Summary; (2) Task C: Technical Feasibility and Preliminary Design; (3) Task F: Project Implementation Strategy
Review of energy policy. Vol. 1. A discussion paper; Vol. 2. Appendices
Energy Technology Data Exchange (ETDEWEB)
1986-01-01
Following the accident at the Chernobyl reactor in April 1986, the 1986 Annual Delegate Conference of the Institution of Professional Civil Servants set up a Working Party to review the Institution's energy policy, including safety and environmental factors. The review is presented in two volumes as the basis for discussion by the members. Volume I is the main report. Section A, the introduction, includes a summary of the detailed conclusions and recommendations of the Working Party. Section B (chapters 4-12) concerns all aspects of nuclear power including fuel reprocessing and waste management. Section C (chapters 13-16) considers the alternatives to nuclear power and Section D (chapters 17-24) looks at the economic and social aspects of energy policy. The appendices, which contain the detailed technical and source information used by the Working Party in reaching its conclusions, are printed separately in Volume II.
Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN
Continuing Medical Education - Vol 27, No 1 (2009)
African Journals Online (AJOL)
Continuing Medical Education - Vol 27, No 1 (2009). Journal Home > Archives > Vol 27, No 1 (2009). Log in or Register to get access to full text downloads. ... Addiction treatment · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Meyer ...
Ada (Trade Name) Bibliography. Volume 1.
1983-05-01
GLENN DOCUMENT NUMBER: 3268 TYPE: JOURNAL ARTICLE .5-., SCIENCE VOL 215 ISSUE 34 PP. 775-779S In this article, two principal themes are observed in...AINST LANAN RD NAY 83 ND9S-8-C-936 UNCLASSIFIED F/6 12/5 ML -4.4 ’-4-4----" ’°p..l i . d N N L. 131 t ’ll /II~ Ada Bibliography Volume I 95 - This...BUDAPEST,HUNGARY 4102 -01 ON THE TYPE CONCEPT OF ADA 6224 -03 UNORTHOGONALITIES IN THE IDENTIFICATION RULES IN ADA BACON, GLENN , IBM SANTA TERESA LABS
Activation volume of martensitic ODS steel
Energy Technology Data Exchange (ETDEWEB)
Kim, D. W.; Noh, S.; Kim, T. K. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
Apparent activation volume as a function of temperature is 86b{sup 3}-42b{sup 3}. Activation volume decreases with increasing temperature. Activation volume changes scarcely with decreasing strain rate. Strain rate sensitivity increases with increasing temperature and decreasing strain rate. Nano-sized oxide dispersion strengthened (ODS) martensitic steel has a high strength, low thermal expansion coefficient, high thermal conductivity, and a good swelling resistance. Martensitic ODS steel is a candidate material for fuel cladding of sodium cooled fast breeder reactor (SFR). The plastic flow stress is determined through the interaction of dislocations with the obstacles encountered inside lattice. Dislocation movement through the lattice or past an obstacle requires surmounting of the energy barrier by a combination of applied stress and thermal activation. The plastic deformation of materials is a thermally activated process dependent upon time, temperature, and strain rate. Characterization of the rate controlling mechanism for plastic deformation due to dislocation motion in crystalline materials is done by the assessment of activation volume based on thermal activation analysis.
Foothills Parkway Section 8B Final Environmental Report, Volume 6, Appendix N
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER documents the results of the architectural, historical, and cultural resources assessment for the entire Section 8B ROW that was completed in May 1995 to document the architectural, historical, and cultural resources located within the project area. The assessment included evaluation of the potential for cultural (i.e., rural historic) landscapes in the area of the ROW. The assessment showed that one National Register-listed property is located 0.3 mile south of the ROW
1990-05-01
rates. A 4D RNAV capability is most easily achieved by "wrapping" a time-navigation capability around a 3D FMS. It is estimated that fifty percent of...U.S. jet transports will have been delivered with a full 3D FMS by 1995 without any special effort to implement 4D RNAV ATC operations. Inclusion of...Mechanics, Vol. 84, No. 3, pp. 247-257, 1962 EICHENBERGER W. "Flugwetterkunde", Schweizer Druck - und Verlagshaus AG, ZUrich, 2. Auflage, 1962 KELLEY H.J
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interrogation. 343b.3 Section 343b.3 Aliens... NATURALIZATION FOR RECOGNITION BY A FOREIGN STATE § 343b.3 Interrogation. When Form N-565 presents a prima facie... issuance of the certificate. Interrogation of the applicant shall be conducted before the application is...
International Nuclear Information System (INIS)
Tian Wubian; Sun Zhengming; Hashimoto, Hitoshi; Du Yulei
2009-01-01
Ti 3 SiC 2 -TiC composites with the volume fractions of TiC from 0 to 90% were fabricated by pulse discharge sintering (PDS) technique using Ti-Si-TiC as starting powders in the sintering temperature range of 1250-1400 deg. C. Phase content and microstructure of the synthesized samples were analyzed by X-ray diffraction (XRD) and scanning electron microscopy (SEM). The samples sintered at 1400 deg. C are almost fully dense for all compositions with relative density higher than 98%. The phase distribution in the synthesized samples is non-uniform. The Vickers hardness increases almost linearly with the volume fraction of TiC up to a value of 20.1 ± 1.4 GPa at 90 vol.% TiC. The flexural strength increases with the volume fraction of TiC to a maximum value of 655 ± 10 MPa at 50 vol.% TiC. The relationship between microstructure and mechanical properties is discussed.
3D Volume Rendering and 3D Printing (Additive Manufacturing).
Katkar, Rujuta A; Taft, Robert M; Grant, Gerald T
2018-07-01
Three-dimensional (3D) volume-rendered images allow 3D insight into the anatomy, facilitating surgical treatment planning and teaching. 3D printing, additive manufacturing, and rapid prototyping techniques are being used with satisfactory accuracy, mostly for diagnosis and surgical planning, followed by direct manufacture of implantable devices. The major limitation is the time and money spent generating 3D objects. Printer type, material, and build thickness are known to influence the accuracy of printed models. In implant dentistry, the use of 3D-printed surgical guides is strongly recommended to facilitate planning and reduce risk of operative complications. Copyright © 2018 Elsevier Inc. All rights reserved.
Pestel, Gunther J; Hiltebrand, Luzius B; Fukui, Kimiko; Cohen, Delphine; Hager, Helmut; Kurz, Andrea M
2006-10-01
We assessed changes in intravascular volume monitored by difference in pulse pressure (dPP%) after stepwise hemorrhage in an experimental pig model. Six pigs (23-25 kg) were anesthetized (isoflurane 1.5 vol%) and mechanically ventilated to keep end-tidal CO2 (etCO2) at 35 mmHg. A PA-catheter and an arterial catheter were placed via femoral access. During and after surgery, animals received lactated Ringer's solution as long as they were considered volume responders (dPP>13%). Then animals were allowed to stabilize from the induction of anesthesia and insertion of catheters for 30 min. After stabilization, baseline measurements were taken. Five percent of blood volume was withdrawn, followed by another 5%, and then in 10%-increments until death from exsanguination occurred. After withdrawal of 5% of blood volume, all pigs were considered volume responders (dPP>13%); dPP rose significantly from 6.1+/-3.3% to 19.4+/-4.2%. The regression analysis of stepwise hemorrhage revealed a linear relation between blood loss (hemorrhage in %) and dPP (y=0.99*x+14; R2=0.7764; P<.0001). In addition, dPP was the only parameter that changed significantly between baseline and a blood loss of 5% (P<0.01), whereas cardiac output, stroke volume, heart rate, MAP, central venous pressure, pulmonary artery occlusion pressure, and systemic vascular resistance, respectively, remained unchanged. We conclude that in an experimental hypovolemic pig model, dPP correlates well with blood loss.
International Nuclear Information System (INIS)
Zhang Lirong; Wang Dongqing; Wei Chuanshe; Ma Cong; Wang Dehang
2010-01-01
Objective: To investigate the accuracy and reproducibility of multi echo data imagine combination (MEDIC) sequence with water excitation at 3.0 T in swine knee cartilage. Methods: Sagittal MEDIC sequences (0.6 mm slice thickness, isotropic) were acquired twice at 3.0 T MRI in 30 swine knees. The knee cartilage was then removed and the volume was directly measured with water substitution method. The cartilage volume was also determined with a validated open source image software OsiriX by two observers (A and B). The cartilage volumes obtained by two methods were compared. The reproducibility of MEDIC for quantitative measurement was accessed by the root-mean-square (RMS) of variation coefficient. Interobserver and intraobserver precision errors were compared using a paired students t-test. The accuracy of MEDIC for quantitative measurement was determined by the random pairwise differences, systematic pairwise differences and the Pearson, correlation coefficients. Time of semiautomatic and manual segmentation were recorded. Results: Time was saved about 75% by using semiautomatic segmentation methods [(4.0± 1.5) min] versus manual segmentation [(16.0±0.9) min]. Interobserver precision errors (RMS CV% for paired analysis) between A and B for cartilage volume measurement were (2.66±0.82) ml and(2.61± 0.81) ml, t=0.24, P=0.81 (patella); (2.40±0.69) ml and (2.49±0.85) ml, t=-0.45, P=0.65 (medial femoral condyle); (2.28±0.74) ml and(2.41±0.78) ml, t=-0.66, P=0.51 (lateral femoral condyle); (3.43±1.28) ml and (3.51±1.08) ml, t=-0.26, P=0.79 (femora trochlea) with sagittal MEDIC. Intraobserver precision errors (RMS CV% for paired analysis) of observer A for the first and second cartilage volume measurement were (2.64±0.62) ml and (2.67±0.60) ml, t=-0.19, P=0.85 (patella); (2.43±0.60) ml and (2.39±0.59) ml, t=0.26, P=0.80 (medial femoral condyle); (2.26±0.56) ml and (2.30±0.57) ml, t=-0.27, P=0.78 (lateral femoral condyle); (3.40± 1.20) ml and (3.47±1
ZnO-PbO-B2O3 glasses as gamma-ray shielding materials
DEFF Research Database (Denmark)
Singh, H.; Singh, K.; Gerward, Leif
2003-01-01
Values of the gamma-ray mass-attenuation coefficient, the photon mean free path (MFP), the effective atomic number and the effective electron density have been determined experimentally for xZnO.2xPbO.(1-3x)B2O3 (x = 0.1-0.26) glasses at photon energies 511, 662, 1173 and 1332 keV and compared wi...... with theoretical data. The specific volume of the glasses has been derived from density measurements and studied as a function of composition. It is pointed out that these glasses have potential applications in radiation shielding.......Values of the gamma-ray mass-attenuation coefficient, the photon mean free path (MFP), the effective atomic number and the effective electron density have been determined experimentally for xZnO.2xPbO.(1-3x)B2O3 (x = 0.1-0.26) glasses at photon energies 511, 662, 1173 and 1332 keV and compared...
The Role of Semaphorin 3B (SEMA3B) in the Pathogenesis of Breast Cancer
2006-04-01
apoptotic and anti-proliferative effect on cancer lines it is in part by the inhibition of Akt pathway. In conclusion, we hypothesize that VEGF165...autocrine activity and by inhibiting the Akt pathway. 15. SUBJECT TERMS tumor suppressor gene, breast cancer and apoptosis 16. SECURITY...TGFβ TGFR2 Smad4 M D A M B A 54 9 H 12 99 H el a H 46 0 M C F7 ZR -7 5 H 15 7 2 31 GAPDH TGFR1 B. C 2H 24H 48H 72H SEMA3B SEMA3B
Waste Receiving and Processing Facility Module 2A: Advanced Conceptual Design Report. Volume 3B
Energy Technology Data Exchange (ETDEWEB)
1994-03-01
This volume consists of the following sections: WRAP 2A value engineering assessment, resolution of value engineering assessment actions (white paper), HAZOP studies for identifying major safety and operability problems, and time and motion simulation.
Office for Analysis and Evaluation of Operational Data 1994-FY 95 annual report. Volume 9, Number 2
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-09-01
This annual report of the US Nuclear Regulatory Commission`s Office for Analysis and Evaluation of Operational Data (AEOD) describes activities conducted during CY 1994 and FY 1995. The report is published in three parts. NUREG-1272, Vol. 9, No. 1, covers power reactors and presents an overview of the operating experience of the nuclear power industry from the NRC perspective, including comments about the trends of some key performance measures. The report also includes the principal findings and issues identified in AEOD studies over the past year and summarizes information from such sources as licensee event reports, diagnostic evaluations, and reports to the NRC`s Operations Center. NUREG-1272, Vol. 9, No. 2, covers nuclear materials and presents a review of the events and concerns associated with the use of licensed material in nonreactor applications, such as personnel overexposures and medical misadministrations. Both reports also contain a discussion of the Incident Investigation Team program and summarize both the Incident Investigation Team and Augmented Inspection Team reports. Each volume contains a list of the AEOD reports issued from 1980 through FY 1995. NUREG-1272, Vol. 9, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC`s mission.
Office for Analysis and Evaluation of Operational Data 1994-FY 95 annual report. Volume 9, Number 2
International Nuclear Information System (INIS)
1996-09-01
This annual report of the US Nuclear Regulatory Commission's Office for Analysis and Evaluation of Operational Data (AEOD) describes activities conducted during CY 1994 and FY 1995. The report is published in three parts. NUREG-1272, Vol. 9, No. 1, covers power reactors and presents an overview of the operating experience of the nuclear power industry from the NRC perspective, including comments about the trends of some key performance measures. The report also includes the principal findings and issues identified in AEOD studies over the past year and summarizes information from such sources as licensee event reports, diagnostic evaluations, and reports to the NRC's Operations Center. NUREG-1272, Vol. 9, No. 2, covers nuclear materials and presents a review of the events and concerns associated with the use of licensed material in nonreactor applications, such as personnel overexposures and medical misadministrations. Both reports also contain a discussion of the Incident Investigation Team program and summarize both the Incident Investigation Team and Augmented Inspection Team reports. Each volume contains a list of the AEOD reports issued from 1980 through FY 1995. NUREG-1272, Vol. 9, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC's mission
B-1 Systems Approach to Training. Volume 3. Appendix B. Bibliography and Data Collection Trips
1975-07-01
the Fourth Annual Symposium on Psychology in the Air Force, 1974, ~ •—- ~ - --- - Creelman , J.A., Evaluation of Approach Training Procedures...of Engineering Psychology , American Psychologist, 1972, 27 (7), 615-622. Adams, J.A., and Hufford, I.E., Effects of Programmed Perceptual Training on...Control, Wright-Patterson Air Force Base, Ohio, April 7-9, 1970. Aldrich, T.B., Proceedings of the Annual Symposium on Psychology in the Air Force (2nd
Doweidar, H.; El-Damrawi, G.; El-Stohy, Sh.
2017-11-01
IR spectra of CdO-B2O3 and xCdO·(50 - x)MnO·50B2O3 glasses (0 ≤ x ≤ 50 mol%) have been analyzed. The fraction N4 of four coordinated boron atoms obtained from the integrated area under the IR spectra of CdO-B2O3 glasses is markedly higher than the reported NMR values. In both cases, N4 does not change with CdO content. The difference between N4 values of both techniques has been correlated with the relative absorption coefficient of BO4 unit with respect to BO3 unit, as suggested by Chryssikos et al. N4 data of xCdO·(50 - x)MnO·50B2O3 glasses could be used to calculate the fraction of modifier and former CdO and MnO in the borate matrix, as a function of composition. There is a linear increase in both the density and molar volume with increasing CdO content. The change has been correlated with the contribution of CdO and MnO. Electric conduction is assumed to take place via hopping of small polarons. There is a decrease in conductivity with increasing CdO concentration, which suggests that the electrons related to Cd sites are more localized than those at Mn sites.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. B K Singh. Articles written in Bulletin of Materials Science. Volume 30 Issue 3 June 2007 pp 235-238 Clay Materials. Instrumental characterization of clay by XRF, XRD and FTIR · Preeti Sagar Nayak B K Singh · More Details Abstract Fulltext PDF. Instrumental characterizations ...
Bulletin of the Chemical Society of Ethiopia - Vol 23, No 1 (2009)
African Journals Online (AJOL)
Bulletin of the Chemical Society of Ethiopia - Vol 23, No 1 (2009) ... CHEMICAL REGENERATION OF GRANULAR ACTIVATED CARBON USED IN CITRIC ... FLUORESCENCE PROPERTIES OF 4-ACYL ISOCHROMAN-1,3-DIONES · EMAIL ...
Physics of laser fusion. Volume II. Diagnostics of experiments on laser fusion targets at LLNL
Energy Technology Data Exchange (ETDEWEB)
Ahlstrom, H.G.
1982-01-01
These notes present the experimental basis and status for laser fusion as developed at LLNL. There are two other volumes in this series: Vol. I, by C.E. Max, presents the theoretical laser-plasma interaction physics; Vol. III, by J.F. Holzrichter et al., presents the theory and design of high-power pulsed lasers. A fourth volume will present the theoretical implosion physics. The notes consist of six sections. The first, an introductory section, provides some of the history of inertial fusion and a simple explanation of the concepts involved. The second section presents an extensive discussion of diagnostic instrumentation used in the LLNL Laser Fusion Program. The third section is a presentation of laser facilities and capabilities at LLNL. The purpose here is to define capability, not to derive how it was obtained. The fourth and fifth sections present the experimental data on laser-plasma interaction and implosion physics. The last chapter is a short projection of the future.
Physics of laser fusion. Volume II. Diagnostics of experiments on laser fusion targets at LLNL
International Nuclear Information System (INIS)
Ahlstrom, H.G.
1982-01-01
These notes present the experimental basis and status for laser fusion as developed at LLNL. There are two other volumes in this series: Vol. I, by C.E. Max, presents the theoretical laser-plasma interaction physics; Vol. III, by J.F. Holzrichter et al., presents the theory and design of high-power pulsed lasers. A fourth volume will present the theoretical implosion physics. The notes consist of six sections. The first, an introductory section, provides some of the history of inertial fusion and a simple explanation of the concepts involved. The second section presents an extensive discussion of diagnostic instrumentation used in the LLNL Laser Fusion Program. The third section is a presentation of laser facilities and capabilities at LLNL. The purpose here is to define capability, not to derive how it was obtained. The fourth and fifth sections present the experimental data on laser-plasma interaction and implosion physics. The last chapter is a short projection of the future
Journal of Agricultural Extension Vol. 17 (1) June, 2013 ISSN 1119 ...
African Journals Online (AJOL)
Onyii Ogbonna
Journal of Agricultural Extension. Vol. ... Nigeria one of the largest importers of fish in the developing world, importing ... stratum formed the third stage. ..... Quarterly. 28 (3 & 4): 8-13. Binyotubo, T.E (2011). A guide to fishing gear technology.
Integrated operations plan for the MFTF-B Mirror Fusion Test Facility. Volume I. Organization plan
International Nuclear Information System (INIS)
1981-12-01
This plan and the accompanying MFTF-B Integrated Operations Plan are submitted in response to UC/LLNL Purchase Order 3883801, dated July 1981. The organization plan also addresses the specific tasks and trade studies directed by the scope of work. The Integrated Operations Plan, which includes a reliability, quality assurance, and safety plan and an integrated logistics plan, comprises the burden of the report. In the first section of this volume, certain underlying assumptions and observations are discussed setting the requirements and limits for organization. Section B presents the recommended structure itself. Section C Device Availability vs Maintenance and Support Efforts and Section D Staffing Levels and Skills provide backup detail and justification. Section E is a trade study on maintenance and support by LLNL staff vs subcontract and Section F is a plan for transitioning from the construction phase into operation. A brief summary of schedules and estimated costs concludes the volume
No-migration variance petition. Appendices A--B: Volume 2, Revision 1
Energy Technology Data Exchange (ETDEWEB)
1990-03-01
Volume II contains Appendix A, emergency plan and Appendix B, waste analysis plan. The Waste Isolation Pilot Plant (WIPP) Emergency plan and Procedures (WP 12-9, Rev. 5, 1989) provides an organized plan of action for dealing with emergencies at the WIPP. A contingency plan is included which is in compliance with 40 CFR Part 265, Subpart D. The waste analysis plan provides a description of the chemical and physical characteristics of the wastes to be emplaced in the WIPP underground facility. A detailed discussion of the WIPP Waste Acceptance Criteria and the rationale for its established units are also included.
International Nuclear Information System (INIS)
Post, R.G.
1984-01-01
This volume presents information regarding low-level waste, volume reduction methodologies and economics. Topics include: public education on nuclear waste; economics of low-level waste management systems; operating experience with advanced volume reduction techniques; solidification of waste; operating experience with advanced volume reduction techniques--incineration; regional plans for the disposal of low-level waste; radwaste system modifications at nuclear power plants; operating experience with advanced volume reduction techniques--operations and on-site storage issues; and economic impact of 10CFR61
AFRREV STECH, Vol. 3(2) May, 2014
African Journals Online (AJOL)
Toshiba
2014-05-07
May 7, 2014 ... Niger State, Nigeria. &. IFABIYI, I.P.. Department of Geography and Environmental Management,. University of Ilorin, Ilorin, Kwara State, Nigeria. Abstract. Reservoir ... about 320 km2 with total storage volume of about 7 billion cubic meters. ... The calculated mean was done using equation 1: X = N. N α. ∑.
ILC Reference Design Report Volume 3 - Accelerator
Phinney, Nan; Walker, Nicholas J.; Aarons, Gerald; Abe, Toshinori; Abernathy, Jason; Ablikim, Medina; Abramowicz, Halina; Adey, David; Adloff, Catherine; Adolphsen, Chris; Afanaciev, Konstantin; Agapov, Ilya; Ahn, Jung-Keun; Aihara, Hiroaki; Akemoto, Mitsuo; del Carmen Alabau, Maria; Albert, Justin; Albrecht, Hartwig; Albrecht, Michael; Alesini, David; Alexander, Gideon; Alexander, Jim; Allison, Wade; Amann, John; Amirikas, Ramila; An, Qi; Anami, Shozo; Ananthanarayan, B.; Anderson, Terry; Andricek, Ladislav; Anduze, Marc; Anerella, Michael; Anfimov, Nikolai; Angal-Kalinin, Deepa; Antipov, Sergei; Antoine, Claire; Aoki, Mayumi; Aoza, Atsushi; Aplin, Steve; Appleby, Rob; Arai, Yasuo; Araki, Sakae; Arkan, Tug; Arnold, Ned; Arnold, Ray; Arnowitt, Richard; Artru, Xavier; Arya, Kunal; Aryshev, Alexander; Asakawa, Eri; Asiri, Fred; Asner, David; Atac, Muzaffer; Atoian, Grigor; Attié, David; Augustin, Jean-Eudes; Augustine, David B.; Ayres, Bradley; Aziz, Tariq; Baars, Derek; Badaud, Frederique; Baddams, Nigel; Bagger, Jonathan; Bai, Sha; Bailey, David; Bailey, Ian R.; Baker, David; Balalykin, Nikolai I.; Balbuena, Juan Pablo; Baldy, Jean-Luc; Ball, Markus; Ball, Maurice; Ballestrero, Alessandro; Ballin, Jamie; Baltay, Charles; Bambade, Philip; Ban, Syuichi; Band, Henry; Bane, Karl; Banerjee, Bakul; Barbanotti, Serena; Barbareschi, Daniele; Barbaro-Galtieri, Angela; Barber, Desmond P.; Barbi, Mauricio; Bardin, Dmitri Y.; Barish, Barry; Barklow, Timothy L.; Barlow, Roger; Barnes, Virgil E.; Barone, Maura; Bartels, Christoph; Bartsch, Valeria; Basu, Rahul; Battaglia, Marco; Batygin, Yuri; Baudot, Jerome; Baur, Ulrich; Elwyn Baynham, D.; Beard, Carl; Bebek, Chris; Bechtle, Philip; Becker, Ulrich J.; Bedeschi, Franco; Bedjidian, Marc; Behera, Prafulla; Behnke, Ties; Bellantoni, Leo; Bellerive, Alain; Bellomo, Paul; Bentson, Lynn D.; Benyamna, Mustapha; Bergauer, Thomas; Berger, Edmond; Bergholz, Matthias; Beri, Suman; Berndt, Martin; Bernreuther, Werner; Bertolini, Alessandro; Besancon, Marc; Besson, Auguste; Beteille, Andre; Bettoni, Simona; Beyer, Michael; Bhandari, R.K.; Bharadwaj, Vinod; Bhatnagar, Vipin; Bhattacharya, Satyaki; Bhattacharyya, Gautam; Bhattacherjee, Biplob; Bhuyan, Ruchika; Bi, Xiao-Jun; Biagini, Marica; Bialowons, Wilhelm; Biebel, Otmar; Bieler, Thomas; Bierwagen, John; Birch, Alison; Bisset, Mike; Biswal, S.S.; Blackmore, Victoria; Blair, Grahame; Blanchard, Guillaume; Blazey, Gerald; Blue, Andrew; Blümlein, Johannes; Boffo, Christian; Bohn, Courtlandt; Boiko, V.I.; Boisvert, Veronique; Bondarchuk, Eduard N.; Boni, Roberto; Bonvicini, Giovanni; Boogert, Stewart; Boonekamp, Maarten; Boorman, Gary; Borras, Kerstin; Bortoletto, Daniela; Bosco, Alessio; Bosio, Carlo; Bosland, Pierre; Bosotti, Angelo; Boudry, Vincent; Boumediene, Djamel-Eddine; Bouquet, Bernard; Bourov, Serguei; Bowden, Gordon; Bower, Gary; Boyarski, Adam; Bozovic-Jelisavcic, Ivanka; Bozzi, Concezio; Brachmann, Axel; Bradshaw, Tom W.; Brandt, Andrew; Brasser, Hans Peter; Brau, Benjamin; Brau, James E.; Breidenbach, Martin; Bricker, Steve; Brient, Jean-Claude; Brock, Ian; Brodsky, Stanley; Brooksby, Craig; Broome, Timothy A.; Brown, David; Brown, David; Brownell, James H.; Bruchon, Mélanie; Brueck, Heiner; Brummitt, Amanda J.; Brun, Nicole; Buchholz, Peter; Budagov, Yulian A.; Bulgheroni, Antonio; Bulyak, Eugene; Bungau, Adriana; Bürger, Jochen; Burke, Dan; Burkhart, Craig; Burrows, Philip; Burt, Graeme; Burton, David; Büsser, Karsten; Butler, John; Butterworth, Jonathan; Buzulutskov, Alexei; Cabruja, Enric; Caccia, Massimo; Cai, Yunhai; Calcaterra, Alessandro; Caliier, Stephane; Camporesi, Tiziano; Cao, Jun-Jie; Cao, J.S.; Capatina, Ofelia; Cappellini, Chiara; Carcagno, Ruben; Carena, Marcela; Carloganu, Cristina; Carosi, Roberto; Stephen Carr, F.; Carrion, Francisco; Carter, Harry F.; Carter, John; Carwardine, John; Cassel, Richard; Cassell, Ronald; Cavallari, Giorgio; Cavallo, Emanuela; Cembranos, Jose A.R.; Chakraborty, Dhiman; Chandez, Frederic; Charles, Matthew; Chase, Brian; Chattopadhyay, Subhasis; Chauveau, Jacques; Chefdeville, Maximilien; Chehab, Robert; Chel, Stéphane; Chelkov, Georgy; Chen, Chiping; Chen, He Sheng; Chen, Huai Bi; Chen, Jia Er; Chen, Sen Yu; Chen, Shaomin; Chen, Shenjian; Chen, Xun; Chen, Yuan Bo; Cheng, Jian; Chevallier, M.; Chi, Yun Long; Chickering, William; Cho, Gi-Chol; Cho, Moo-Hyun; Choi, Jin-Hyuk; Choi, Jong Bum; Choi, Seong Youl; Choi, Young-Il; Choudhary, Brajesh; Choudhury, Debajyoti; Rai Choudhury, S.; Christian, David; Christian, Glenn; Christophe, Grojean; Chung, Jin-Hyuk; Church, Mike; Ciborowski, Jacek; Cihangir, Selcuk; Ciovati, Gianluigi; Clarke, Christine; Clarke, Don G.; Clarke, James A.; Clements, Elizabeth; Coca, Cornelia; Coe, Paul; Cogan, John; Colas, Paul; Collard, Caroline; Colledani, Claude; Combaret, Christophe; Comerma, Albert; Compton, Chris; Constance, Ben; Conway, John; Cook, Ed; Cooke, Peter; Cooper, William; Corcoran, Sean; Cornat, Rémi; Corner, Laura; Cortina Gil, Eduardo; Clay Corvin, W.; Cotta Ramusino, Angelo; Cowan, Ray; Crawford, Curtis; Cremaldi, Lucien M; Crittenden, James A.; Cussans, David; Cvach, Jaroslav; da Silva, Wilfrid; Dabiri Khah, Hamid; Dabrowski, Anne; Dabrowski, Wladyslaw; Dadoun, Olivier; Dai, Jian Ping; Dainton, John; Daly, Colin; Damerell, Chris; Danilov, Mikhail; Daniluk, Witold; Daram, Sarojini; Datta, Anindya; Dauncey, Paul; David, Jacques; Davier, Michel; Davies, Ken P.; Dawson, Sally; De Boer, Wim; De Curtis, Stefania; De Groot, Nicolo; de la Taille, Christophe; de Lira, Antonio; De Roeck, Albert; de Sangro, Riccardo; De Santis,Stefano; Deacon, Laurence; Deandrea, Aldo; Dehmelt, Klaus; Delagnes, Eric; Delahaye, Jean-Pierre; Delebecque, Pierre; Delerue, Nicholas; Delferriere, Olivier; Demarteau, Marcel; Deng, Zhi; Denisov, Yu.N.; Densham, Christopher J.; Desch, Klaus; Deshpande, Nilendra; Devanz, Guillaume; Devetak, Erik; Dexter, Amos; Di benedetto, Vito; Diéguez, Angel; Diener, Ralf; Dinh, Nguyen Dinh; Dixit, Madhu; Dixit, Sudhir; Djouadi, Abdelhak; Dolezal, Zdenek; Dollan, Ralph; Dong, Dong; Dong, Hai Yi; Dorfan, Jonathan; Dorokhov, Andrei; Doucas, George; Downing, Robert; Doyle, Eric; Doziere, Guy; Drago, Alessandro; Dragt, Alex; Drake, Gary; Drásal, Zbynek; Dreiner, Herbert; Drell, Persis; Driouichi, Chafik; Drozhdin, Alexandr; Drugakov, Vladimir; Du, Shuxian; Dugan, Gerald; Duginov, Viktor; Dulinski, Wojciech; Dulucq, Frederic; Dutta, Sukanta; Dwivedi, Jishnu; Dychkant, Alexandre; Dzahini, Daniel; Eckerlin, Guenter; Edwards, Helen; Ehrenfeld, Wolfgang; Ehrlichman, Michael; Ehrlichmann, Heiko; Eigen, Gerald; Elagin, Andrey; Elementi, Luciano; Eliasson, Peder; Ellis, John; Ellwood, George; Elsen, Eckhard; Emery, Louis; Enami, Kazuhiro; Endo, Kuninori; Enomoto, Atsushi; Eozénou, Fabien; Erbacher, Robin; Erickson, Roger; Oleg Eyser, K.; Fadeyev, Vitaliy; Fang, Shou Xian; Fant, Karen; Fasso, Alberto; Faucci Giannelli, Michele; Fehlberg, John; Feld, Lutz; Feng, Jonathan L.; Ferguson, John; Fernandez-Garcia, Marcos; Luis Fernandez-Hernando, J.; Fiala, Pavel; Fieguth, Ted; Finch, Alexander; Finocchiaro, Giuseppe; Fischer, Peter; Fisher, Peter; Eugene Fisk, H.; Fitton, Mike D.; Fleck, Ivor; Fleischer, Manfred; Fleury, Julien; Flood, Kevin; Foley, Mike; Ford, Richard; Fortin, Dominique; Foster, Brian; Fourches, Nicolas; Francis, Kurt; Frey, Ariane; Frey, Raymond; Friedsam, Horst; Frisch, Josef; Frishman, Anatoli; Fuerst, Joel; Fujii, Keisuke; Fujimoto, Junpei; Fukuda, Masafumi; Fukuda, Shigeki; Funahashi, Yoshisato; Funk, Warren; Furletova, Julia; Furukawa, Kazuro; Furuta, Fumio; Fusayasu, Takahiro; Fuster, Juan; Gadow, Karsten; Gaede, Frank; Gaglione, Renaud; Gai, Wei; Gajewski, Jan; Galik, Richard; Galkin, Alexei; Galkin, Valery; Gallin-Martel, Laurent; Gannaway, Fred; Gao, Jian She; Gao, Jie; Gao, Yuanning; Garbincius, Peter; Garcia-Tabares, Luis; Garren, Lynn; Garrido, Luís; Garutti, Erika; Garvey, Terry; Garwin, Edward; Gascón, David; Gastal, Martin; Gatto, Corrado; Gatto, Raoul; Gay, Pascal; Ge, Lixin; Ge, Ming Qi; Ge, Rui; Geiser, Achim; Gellrich, Andreas; Genat, Jean-Francois; Geng, Zhe Qiao; Gentile, Simonetta; Gerbick, Scot; Gerig, Rod; Ghosh, Dilip Kumar; Ghosh, Kirtiman; Gibbons, Lawrence; Giganon, Arnaud; Gillespie, Allan; Gillman, Tony; Ginzburg, Ilya; Giomataris, Ioannis; Giunta, Michele; Gladkikh, Peter; Gluza, Janusz; Godbole, Rohini; Godfrey, Stephen; Goldhaber, Gerson; Goldstein, Joel; Gollin, George D.; Gonzalez-Sanchez, Francisco Javier; Goodrick, Maurice; Gornushkin, Yuri; Gostkin, Mikhail; Gottschalk, Erik; Goudket, Philippe; Gough Eschrich, Ivo; Gournaris, Filimon; Graciani, Ricardo; Graf, Norman; Grah, Christian; Grancagnolo, Francesco; Grandjean, Damien; Grannis, Paul; Grassellino, Anna; Graugés, Eugeni; Gray, Stephen; Green, Michael; Greenhalgh, Justin; Greenshaw, Timothy; Grefe, Christian; Gregor, Ingrid-Maria; Grenier, Gerald; Grimes, Mark; Grimm, Terry; Gris, Philippe; Grivaz, Jean-Francois; Groll, Marius; Gronberg, Jeffrey; Grondin, Denis; Groom, Donald; Gross, Eilam; Grunewald, Martin; Grupen, Claus; Grzelak, Grzegorz; Gu, Jun; Gu, Yun-Ting; Guchait, Monoranjan; Guiducci, Susanna; Guler, Ali Murat; Guler, Hayg; Gulmez, Erhan; Gunion, John; Guo, Zhi Yu; Gurtu, Atul; Ha, Huy Bang; Haas, Tobias; Haase, Andy; Haba, Naoyuki; Haber, Howard; Haensel, Stephan; Hagge, Lars; Hagura, Hiroyuki; Hajdu, Csaba; Haller, Gunther; Haller, Johannes; Hallermann, Lea; Halyo, Valerie; Hamaguchi, Koichi; Hammond, Larry; Han, Liang; Han, Tao; Hand, Louis; Handu, Virender K.; Hano, Hitoshi; Hansen, Christian; Hansen, Jørn Dines; Hansen, Jorgen Beck; Hara, Kazufumi; Harder, Kristian; Hartin, Anthony; Hartung, Walter; Hast, Carsten; Hauptman, John; Hauschild, Michael; Hauviller, Claude; Havranek, Miroslav; Hawkes, Chris; Hawkings, Richard; Hayano, Hitoshi; Hazumi, Masashi; He, An; He, Hong Jian; Hearty, Christopher; Heath, Helen; Hebbeker, Thomas; Hedberg, Vincent; Hedin, David; Heifets, Samuel; Heinemeyer, Sven; Heini, Sebastien; Helebrant, Christian; Helms, Richard; Heltsley, Brian; Henrot-Versille, Sophie; Henschel, Hans; Hensel, Carsten; Hermel, Richard; Herms, Atilà; Herten, Gregor; Hesselbach, Stefan; Heuer, Rolf-Dieter; Heusch, Clemens A.; Hewett, Joanne; Higashi, Norio; Higashi, Takatoshi; Higashi, Yasuo; Higo, Toshiyasu; Hildreth, Michael D.; Hiller, Karlheinz; Hillert, Sonja; Hillier, Stephen James; Himel, Thomas; Himmi, Abdelkader; Hinchliffe, Ian; Hioki, Zenro; Hirano, Koichiro; Hirose, Tachishige; Hisamatsu, Hiromi; Hisano, Junji; Hlaing, Chit Thu; Hock, Kai Meng; Hoeferkamp, Martin; Hohlfeld, Mark; Honda, Yousuke; Hong, Juho; Hong, Tae Min; Honma, Hiroyuki; Horii, Yasuyuki; Horvath, Dezso; Hosoyama, Kenji; Hostachy, Jean-Yves; Hou, Mi; Hou, Wei-Shu; Howell, David; Hronek, Maxine; Hsiung, Yee B.; Hu, Bo; Hu, Tao; Huang, Jung-Yun; Huang, Tong Ming; Huang, Wen Hui; Huedem, Emil; Huggard, Peter; Hugonie, Cyril; Hu-Guo, Christine; Huitu, Katri; Hwang, Youngseok; Idzik, Marek; Ignatenko, Alexandr; Ignatov, Fedor; Ikeda, Hirokazu; Ikematsu, Katsumasa; Ilicheva, Tatiana; Imbault, Didier; Imhof, Andreas; Incagli, Marco; Ingbir, Ronen; Inoue, Hitoshi; Inoue, Youichi; Introzzi, Gianluca; Ioakeimidi, Katerina; Ishihara, Satoshi; Ishikawa, Akimasa; Ishikawa, Tadashi; Issakov, Vladimir; Ito, Kazutoshi; Ivanov, V.V.; Ivanov, Valentin; Ivanyushenkov, Yury; Iwasaki, Masako; Iwashita, Yoshihisa; Jackson, David; Jackson, Frank; Jacobsen, Bob; Jaganathan, Ramaswamy; Jamison, Steven; Janssen, Matthias Enno; Jaramillo-Echeverria, Richard; Jaros, John; Jauffret, Clement; Jawale, Suresh B.; Jeans, Daniel; Jedziniak, Ron; Jeffery, Ben; Jehanno, Didier; Jenner, Leo J.; Jensen, Chris; Jensen, David R.; Jiang, Hairong; Jiang, Xiao Ming; Jimbo, Masato; Jin, Shan; Keith Jobe, R.; Johnson, Anthony; Johnson, Erik; Johnson, Matt; Johnston, Michael; Joireman, Paul; Jokic, Stevan; Jones, James; Jones, Roger M.; Jongewaard, Erik; Jönsson, Leif; Joshi, Gopal; Joshi, Satish C.; Jung, Jin-Young; Junk, Thomas; Juste, Aurelio; Kado, Marumi; Kadyk, John; Käfer, Daniela; Kako, Eiji; Kalavase, Puneeth; Kalinin, Alexander; Kalinowski, Jan; Kamitani, Takuya; Kamiya, Yoshio; Kamiya, Yukihide; Kamoshita, Jun-ichi; Kananov, Sergey; Kanaya, Kazuyuki; Kanazawa, Ken-ichi; Kanemura, Shinya; Kang, Heung-Sik; Kang, Wen; Kanjial, D.; Kapusta, Frédéric; Karataev, Pavel; Karchin, Paul E.; Karlen, Dean; Karyotakis, Yannis; Kashikhin, Vladimir; Kashiwagi, Shigeru; Kasley, Paul; Katagiri, Hiroaki; Kato, Takashi; Kato, Yukihiro; Katzy, Judith; Kaukher, Alexander; Kaur, Manjit; Kawagoe, Kiyotomo; Kawamura, Hiroyuki; Kazakov, Sergei; Kekelidze, V.D.; Keller, Lewis; Kelley, Michael; Kelly, Marc; Kelly, Michael; Kennedy, Kurt; Kephart, Robert; Keung, Justin; Khainovski, Oleg; Khan, Sameen Ahmed; Khare, Prashant; Khovansky, Nikolai; Kiesling, Christian; Kikuchi, Mitsuo; Kilian, Wolfgang; Killenberg, Martin; Kim, Donghee; Kim, Eun San; Kim, Eun-Joo; Kim, Guinyun; Kim, Hongjoo; Kim, Hyoungsuk; Kim, Hyun-Chui; Kim, Jonghoon; Kim, Kwang-Je; Kim, Kyung Sook; Kim, Peter; Kim, Seunghwan; Kim, Shin-Hong; Kim, Sun Kee; Kim, Tae Jeong; Kim, Youngim; Kim, Young-Kee; Kimmitt, Maurice; Kirby, Robert; Kircher, François; Kisielewska, Danuta; Kittel, Olaf; Klanner, Robert; Klebaner, Arkadiy L.; Kleinwort, Claus; Klimkovich, Tatsiana; Klinkby, Esben; Kluth, Stefan; Knecht, Marc; Kneisel, Peter; Ko, In Soo; Ko, Kwok; Kobayashi, Makoto; Kobayashi, Nobuko; Kobel, Michael; Koch, Manuel; Kodys, Peter; Koetz, Uli; Kohrs, Robert; Kojima, Yuuji; Kolanoski, Hermann; Kolodziej, Karol; Kolomensky, Yury G.; Komamiya, Sachio; Kong, Xiang Cheng; Konigsberg, Jacobo; Korbel, Volker; Koscielniak, Shane; Kostromin, Sergey; Kowalewski, Robert; Kraml, Sabine; Krammer, Manfred; Krasnykh, Anatoly; Krautscheid, Thorsten; Krawczyk, Maria; James Krebs, H.; Krempetz, Kurt; Kribs, Graham; Krishnagopal, Srinivas; Kriske, Richard; Kronfeld, Andreas; Kroseberg, Jürgen; Kruchonak, Uladzimir; Kruecker, Dirk; Krüger, Hans; Krumpa, Nicholas A.; Krumshtein, Zinovii; Kuang, Yu Ping; Kubo, Kiyoshi; Kuchler, Vic; Kudoh, Noboru; Kulis, Szymon; Kumada, Masayuki; Kumar, Abhay; Kume, Tatsuya; Kundu, Anirban; Kurevlev, German; Kurihara, Yoshimasa; Kuriki, Masao; Kuroda, Shigeru; Kuroiwa, Hirotoshi; Kurokawa, Shin-ichi; Kusano, Tomonori; Kush, Pradeep K.; Kutschke, Robert; Kuznetsova, Ekaterina; Kvasnicka, Peter; Kwon, Youngjoon; Labarga, Luis; Lacasta, Carlos; Lackey, Sharon; Lackowski, Thomas W.; Lafaye, Remi; Lafferty, George; Lagorio, Eric; Laktineh, Imad; Lal, Shankar; Laloum, Maurice; Lam, Briant; Lancaster, Mark; Lander, Richard; Lange, Wolfgang; Langenfeld, Ulrich; Langeveld, Willem; Larbalestier, David; Larsen, Ray; Lastovicka, Tomas; Lastovicka-Medin, Gordana; Latina, Andrea; Latour, Emmanuel; Laurent, Lisa; Le, Ba Nam; Le, Duc Ninh; Le Diberder, Francois; Dû, Patrick Le; Lebbolo, Hervé; Lebrun, Paul; Lecoq, Jacques; Lee, Sung-Won; Lehner, Frank; Leibfritz, Jerry; Lenkszus, Frank; Lesiak, Tadeusz; Levy, Aharon; Lewandowski, Jim; Leyh, Greg; Li, Cheng; Li, Chong Sheng; Li, Chun Hua; Li, Da Zhang; Li, Gang; Li, Jin; Li, Shao Peng; Li, Wei Ming; Li, Weiguo; Li, Xiao Ping; Li, Xue-Qian; Li, Yuanjing; Li, Yulan; Li, Zenghai; Li, Zhong Quan; Liang, Jian Tao; Liao, Yi; Lilje, Lutz; Guilherme Lima, J.; Lintern, Andrew J.; Lipton, Ronald; List, Benno; List, Jenny; Liu, Chun; Liu, Jian Fei; Liu, Ke Xin; Liu, Li Qiang; Liu, Shao Zhen; Liu, Sheng Guang; Liu, Shubin; Liu, Wanming; Liu, Wei Bin; Liu, Ya Ping; Liu, Yu Dong; Lockyer, Nigel; Logan, Heather E.; Logatchev, Pavel V.; Lohmann, Wolfgang; Lohse, Thomas; Lola, Smaragda; Lopez-Virto, Amparo; Loveridge, Peter; Lozano, Manuel; Lu, Cai-Dian; Lu, Changguo; Lu, Gong-Lu; Lu, Wen Hui; Lubatti, Henry; Lucotte, Arnaud; Lundberg, Björn; Lundin, Tracy; Luo, Mingxing; Luong, Michel; Luth, Vera; Lutz, Benjamin; Lutz, Pierre; Lux, Thorsten; Luzniak, Pawel; Lyapin, Alexey; Lykken, Joseph; Lynch, Clare; Ma, Li; Ma, Lili; Ma, Qiang; Ma, Wen-Gan; Macfarlane, David; Maciel, Arthur; MacLeod, Allan; MacNair, David; Mader, Wolfgang; Magill, Stephen; Magnan, Anne-Marie; Maiheu, Bino; Maity, Manas; Majchrzak, Millicent; Majumder, Gobinda; Makarov, Roman; Makowski, Dariusz; Malaescu, Bogdan; Mallik, C.; Mallik, Usha; Malton, Stephen; Malyshev, Oleg B.; Malysheva, Larisa I.; Mammosser, John; Mamta; Mamuzic, Judita; Manen, Samuel; Manghisoni, Massimo; Manly, Steven; Marcellini, Fabio; Marcisovsky, Michal; Markiewicz, Thomas W.; Marks, Steve; Marone, Andrew; Marti, Felix; Martin, Jean-Pierre; Martin, Victoria; Martin-Chassard, Gisèle; Martinez, Manel; Martinez-Rivero, Celso; Martsch, Dennis; Martyn, Hans-Ulrich; Maruyama, Takashi; Masuzawa, Mika; Mathez, Hervé; Matsuda, Takeshi; Matsumoto, Hiroshi; Matsumoto, Shuji; Matsumoto, Toshihiro; Matsunaga, Hiroyuki; Mättig, Peter; Mattison, Thomas; Mavromanolakis, Georgios; Mawatari, Kentarou; Mazzacane, Anna; McBride, Patricia; McCormick, Douglas; McCormick, Jeremy; McDonald, Kirk T.; McGee, Mike; McIntosh, Peter; McKee, Bobby; McPherson, Robert A.; Meidlinger, Mandi; Meier, Karlheinz; Mele, Barbara; Meller, Bob; Melzer-Pellmann, Isabell-Alissandra; Mendez, Hector; Mercer, Adam; Merkin, Mikhail; Meshkov, I.N.; Messner, Robert; Metcalfe, Jessica; Meyer, Chris; Meyer, Hendrik; Meyer, Joachim; Meyer, Niels; Meyners, Norbert; Michelato, Paolo; Michizono, Shinichiro; Mihalcea, Daniel; Mihara, Satoshi; Mihara, Takanori; Mikami, Yoshinari; Mikhailichenko, Alexander A.; Milardi, Catia; Miller, David J.; Miller, Owen; Miller, Roger J.; Milstene, Caroline; Mimashi, Toshihiro; Minashvili, Irakli; Miquel, Ramon; Mishra, Shekhar; Mitaroff, Winfried; Mitchell, Chad; Miura, Takako; Miyamoto, Akiya; Miyata, Hitoshi; Mjörnmark, Ulf; Mnich, Joachim; Moenig, Klaus; Moffeit, Kenneth; Mokhov, Nikolai; Molloy, Stephen; Monaco, Laura; Monasterio, Paul R.; Montanari, Alessandro; Moon, Sung Ik; Moortgat-Pick, Gudrid A.; Mora de Freitas, Paulo; Morel, Federic; Moretti, Stefano; Morgunov, Vasily; Mori, Toshinori; Morin, Laurent; Morisseau, François; Morita, Yoshiyuki; Morita, Youhei; Morita, Yuichi; Morozov, Nikolai; Morozumi, Yuichi; Morse, William; Moser, Hans-Guenther; Moultaka, Gilbert; Mtingwa, Sekazi; Mudrinic, Mihajlo; Mueller, Alex; Mueller, Wolfgang; Muennich, Astrid; Muhlleitner, Milada Margarete; Mukherjee, Bhaskar; Mukhopadhyaya, Biswarup; Müller, Thomas; Munro, Morrison; Murayama, Hitoshi; Muto, Toshiya; Myneni, Ganapati Rao; Nabhiraj, P.Y.; Nagaitsev, Sergei; Nagamine, Tadashi; Nagano, Ai; Naito, Takashi; Nakai, Hirotaka; Nakajima, Hiromitsu; Nakamura, Isamu; Nakamura, Tomoya; Nakanishi, Tsutomu; Nakao, Katsumi; Nakao, Noriaki; Nakayoshi, Kazuo; Nam, Sang; Namito, Yoshihito; Namkung, Won; Nantista, Chris; Napoly, Olivier; Narain, Meenakshi; Naroska, Beate; Nauenberg, Uriel; Nayyar, Ruchika; Neal, Homer; Nelson, Charles; Nelson, Janice; Nelson, Timothy; Nemecek, Stanislav; Neubauer, Michael; Neuffer, David; Newman, Myriam Q.; Nezhevenko, Oleg; Ng, Cho-Kuen; Nguyen, Anh Ky; Nguyen, Minh; Van Nguyen Thi,Hong; Niebuhr, Carsten; Niehoff, Jim; Niezurawski, Piotr; Nishitani, Tomohiro; Nitoh, Osamu; Noguchi, Shuichi; Nomerotski, Andrei; Noonan, John; Norbeck, Edward; Nosochkov, Yuri; Notz, Dieter; Nowak, Grazyna; Nowak, Hannelies; Noy, Matthew; Nozaki, Mitsuaki; Nyffeler, Andreas; Nygren, David; Oddone, Piermaria; O'Dell, Joseph; Oh, Jong-Seok; Oh, Sun Kun; Ohkuma, Kazumasa; Ohlerich, Martin; Ohmi, Kazuhito; Ohnishi, Yukiyoshi; Ohsawa, Satoshi; Ohuchi, Norihito; Oide, Katsunobu; Okada, Nobuchika; Okada, Yasuhiro; Okamura, Takahiro; Okugi, Toshiyuki; Okumi, Shoji; Okumura, Ken-ichi; Olchevski, Alexander; Oliver, William; Olivier, Bob; Olsen, James; Olsen, Jeff; Olsen, Stephen; Olshevsky, A.G.; Olsson, Jan; Omori, Tsunehiko; Onel, Yasar; Onengut, Gulsen; Ono, Hiroaki; Onoprienko, Dmitry; Oreglia, Mark; Oren, Will; Orimoto, Toyoko J.; Oriunno, Marco; Orlandea, Marius Ciprian; Oroku, Masahiro; Orr, Lynne H.; Orr, Robert S.; Oshea, Val; Oskarsson, Anders; Osland, Per; Ossetski, Dmitri; Österman, Lennart; Ostiguy, Francois; Otono, Hidetoshi; Ottewell, Brian; Ouyang, Qun; Padamsee, Hasan; Padilla, Cristobal; Pagani, Carlo; Palmer, Mark A.; Pam, Wei Min; Pande, Manjiri; Pande, Rajni; Pandit, V.S.; Pandita, P.N.; Pandurovic, Mila; Pankov, Alexander; Panzeri, Nicola; Papandreou, Zisis; Paparella, Rocco; Para, Adam; Park, Hwanbae; Parker, Brett; Parkes, Chris; Parma, Vittorio; Parsa, Zohreh; Parsons, Justin; Partridge, Richard; Pasquinelli, Ralph; Pásztor, Gabriella; Paterson, Ewan; Patrick, Jim; Patteri, Piero; Ritchie Patterson, J.; Pauletta, Giovanni; Paver, Nello; Pavlicek, Vince; Pawlik, Bogdan; Payet, Jacques; Pchalek, Norbert; Pedersen, John; Pei, Guo Xi; Pei, Shi Lun; Pelka, Jerzy; Pellegrini, Giulio; Pellett, David; Peng, G.X.; Penn, Gregory; Penzo, Aldo; Perry, Colin; Peskin, Michael; Peters, Franz; Petersen, Troels Christian; Peterson, Daniel; Peterson, Thomas; Petterson, Maureen; Pfeffer, Howard; Pfund, Phil; Phelps, Alan; Van Phi, Quang; Phillips, Jonathan; Piccolo, Marcello; Piemontese, Livio; Pierini, Paolo; Thomas Piggott, W.; Pike, Gary; Pillet, Nicolas; Jayawardena, Talini Pinto; Piot, Phillippe; Pitts, Kevin; Pivi, Mauro; Plate, Dave; Pleier, Marc-Andre; Poblaguev, Andrei; Poehler, Michael; Poelker, Matthew; Poffenberger, Paul; Pogorelsky, Igor; Poirier, Freddy; Poling, Ronald; Poole, Mike; Popescu, Sorina; Popielarski, John; Pöschl, Roman; Postranecky, Martin; Potukochi, Prakash N.; Prast, Julie; Prat, Serge; Preger, Miro; Prepost, Richard; Price, Michael; Proch, Dieter; Puntambekar, Avinash; Qin, Qing; Qu, Hua Min; Quadt, Arnulf; Quesnel, Jean-Pierre; Radeka, Veljko; Rahmat, Rahmat; Rai, Santosh Kumar; Raimondi, Pantaleo; Ramberg, Erik; Ranjan, Kirti; Rao, Sista V.L.S.; Raspereza, Alexei; Ratti, Alessandro; Ratti, Lodovico; Raubenheimer, Tor; Raux, Ludovic; Ravindran, V.; Raychaudhuri, Sreerup; Re, Valerio; Rease, Bill; Reece, Charles E.; Regler, Meinhard; Rehlich, Kay; Reichel, Ina; Reichold, Armin; Reid, John; Reid, Ron; Reidy, James; Reinhard, Marcel; Renz, Uwe; Repond, Jose; Resta-Lopez, Javier; Reuen, Lars; Ribnik, Jacob; Rice, Tyler; Richard, François; Riemann, Sabine; Riemann, Tord; Riles, Keith; Riley, Daniel; Rimbault, Cécile; Rindani, Saurabh; Rinolfi, Louis; Risigo, Fabio; Riu, Imma; Rizhikov, Dmitri; Rizzo, Thomas; Rochford, James H.; Rodriguez, Ponciano; Roeben, Martin; Rolandi, Gigi; Roodman, Aaron; Rosenberg, Eli; Roser, Robert; Ross, Marc; Rossel, François; Rossmanith, Robert; Roth, Stefan; Rougé, André; Rowe, Allan; Roy, Amit; Roy, Sendhunil B.; Roy, Sourov; Royer, Laurent; Royole-Degieux, Perrine; Royon, Christophe; Ruan, Manqi; Rubin, David; Ruehl, Ingo; Jimeno, Alberto Ruiz; Ruland, Robert; Rusnak, Brian; Ryu, Sun-Young; Sabbi, Gian Luca; Sadeh, Iftach; Sadygov, Ziraddin Y; Saeki, Takayuki; Sagan, David; Sahni, Vinod C.; Saini, Arun; Saito, Kenji; Saito, Kiwamu; Sajot, Gerard; Sakanaka, Shogo; Sakaue, Kazuyuki; Salata, Zen; Salih, Sabah; Salvatore, Fabrizio; Samson, Joergen; Sanami, Toshiya; Levi Sanchez, Allister; Sands, William; Santic, John; Sanuki, Tomoyuki; Sapronov, Andrey; Sarkar, Utpal; Sasao, Noboru; Satoh, Kotaro; Sauli, Fabio; Saunders, Claude; Saveliev, Valeri; Savoy-Navarro, Aurore; Sawyer, Lee; Saxton, Laura; Schäfer, Oliver; Schälicke, Andreas; Schade, Peter; Schaetzel, Sebastien; Scheitrum, Glenn; Schibler, Emilie; Schindler, Rafe; Schlösser, Markus; Schlueter, Ross D.; Schmid, Peter; Schmidt, Ringo Sebastian; Schneekloth, Uwe; Schreiber, Heinz Juergen; Schreiber, Siegfried; Schroeder, Henning; Peter Schüler, K.; Schulte, Daniel; Schultz-Coulon, Hans-Christian; Schumacher, Markus; Schumann, Steffen; Schumm, Bruce A.; Schwienhorst, Reinhard; Schwierz, Rainer; Scott, Duncan J.; Scuri, Fabrizio; Sefkow, Felix; Sefri, Rachid; Seguin-Moreau, Nathalie; Seidel, Sally; Seidman, David; Sekmen, Sezen; Seletskiy, Sergei; Senaha, Eibun; Senanayake, Rohan; Sendai, Hiroshi; Sertore, Daniele; Seryi, Andrei; Settles, Ronald; Sever, Ramazan; Shales, Nicholas; Shao, Ming; Shelkov, G.A.; Shepard, Ken; Shepherd-Themistocleous, Claire; Sheppard, John C.; Shi, Cai Tu; Shidara, Tetsuo; Shim, Yeo-Jeong; Shimizu, Hirotaka; Shimizu, Yasuhiro; Shimizu, Yuuki; Shimogawa, Tetsushi; Shin, Seunghwan; Shioden, Masaomi; Shipsey, Ian; Shirkov, Grigori; Shishido, Toshio; Shivpuri, Ram K.; Shrivastava, Purushottam; Shulga, Sergey; Shumeiko, Nikolai; Shuvalov, Sergey; Si, Zongguo; Siddiqui, Azher Majid; Siegrist, James; Simon, Claire; Simrock, Stefan; Sinev, Nikolai; Singh, Bhartendu K.; Singh, Jasbir; Singh, Pitamber; Singh, R.K.; Singh, S.K.; Singini, Monito; Sinha, Anil K.; Sinha, Nita; Sinha, Rahul; Sinram, Klaus; Sissakian, A.N.; Skachkov, N.B.; Skrinsky, Alexander; Slater, Mark; Slominski, Wojciech; Smiljanic, Ivan; Smith, A J Stewart; Smith, Alex; Smith, Brian J.; Smith, Jeff; Smith, Jonathan; Smith, Steve; Smith, Susan; Smith, Tonee; Neville Snodgrass, W.; Sobloher, Blanka; Sohn, Young-Uk; Solidum, Ruelson; Solyak, Nikolai; Son, Dongchul; Sonmez, Nasuf; Sopczak, Andre; Soskov, V.; Spencer, Cherrill M.; Spentzouris, Panagiotis; Speziali, Valeria; Spira, Michael; Sprehn, Daryl; Sridhar, K.; Srivastava, Asutosh; St. Lorant, Steve; Stahl, Achim; Stanek, Richard P.; Stanitzki, Marcel; Stanley, Jacob; Stefanov, Konstantin; Stein, Werner; Steiner, Herbert; Stenlund, Evert; Stern, Amir; Sternberg, Matt; Stockinger, Dominik; Stockton, Mark; Stoeck, Holger; Strachan, John; Strakhovenko, V.; Strauss, Michael; Striganov, Sergei I.; Strologas, John; Strom, David; Strube, Jan; Stupakov, Gennady; Su, Dong; Sudo, Yuji; Suehara, Taikan; Suehiro, Toru; Suetsugu, Yusuke; Sugahara, Ryuhei; Sugimoto, Yasuhiro; Sugiyama, Akira; Suh, Jun Suhk; Sukovic, Goran; Sun, Hong; Sun, Stephen; Sun, Werner; Sun, Yi; Sun, Yipeng; Suszycki, Leszek; Sutcliffe, Peter; Suthar, Rameshwar L.; Suwada, Tsuyoshi; Suzuki, Atsuto; Suzuki, Chihiro; Suzuki, Shiro; Suzuki, Takashi; Swent, Richard; Swientek, Krzysztof; Swinson, Christina; Syresin, Evgeny; Szleper, Michal; Tadday, Alexander; Takahashi, Rika; Takahashi, Tohru; Takano, Mikio; Takasaki, Fumihiko; Takeda, Seishi; Takenaka, Tateru; Takeshita, Tohru; Takubo, Yosuke; Tanaka, Masami; Tang, Chuan Xiang; Taniguchi, Takashi; Tantawi, Sami; Tapprogge, Stefan; Tartaglia, Michael A.; Tassielli, Giovanni Francesco; Tauchi, Toshiaki; Tavian, Laurent; Tawara, Hiroko; Taylor, Geoffrey; Telnov, Alexandre V.; Telnov, Valery; Tenenbaum, Peter; Teodorescu, Eliza; Terashima, Akio; Terracciano, Giuseppina; Terunuma, Nobuhiro; Teubner, Thomas; Teuscher, Richard; Theilacker, Jay; Thomson, Mark; Tice, Jeff; Tigner, Maury; Timmermans, Jan; Titov, Maxim; Tokareva, N.A.; Tollefson, Kirsten; Tomasek, Lukas; Tomovic, Savo; Tompkins, John; Tonutti, Manfred; Topkar, Anita; Toprek, Dragan; Toral, Fernando; Torrence, Eric; Traversi, Gianluca; Trimpl, Marcel; Mani Tripathi, S.; Trischuk, William; Trodden, Mark; Trubnikov, G.V.; Tschirhart, Robert; Tskhadadze, Edisher; Tsuchiya, Kiyosumi; Tsukamoto, Toshifumi; Tsunemi, Akira; Tucker, Robin; Turchetta, Renato; Tyndel, Mike; Uekusa, Nobuhiro; Ueno, Kenji; Umemori, Kensei; Ummenhofer, Martin; Underwood, David; Uozumi, Satoru; Urakawa, Junji; Urban, Jeremy; Uriot, Didier; Urner, David; Ushakov, Andrei; Usher, Tracy; Uzunyan, Sergey; Vachon, Brigitte; Valerio, Linda; Valin, Isabelle; Valishev, Alex; Vamra, Raghava; Van der Graaf, Harry; Van Kooten, Rick; Van Zandbergen, Gary; Vanel, Jean-Charles; Variola, Alessandro; Varner, Gary; Velasco, Mayda; Velte, Ulrich; Velthuis, Jaap; Vempati, Sundir K.; Venturini, Marco; Vescovi, Christophe; Videau, Henri; Vila, Ivan; Vincent, Pascal; Virey, Jean-Marc; Visentin, Bernard; Viti, Michele; Vo, Thanh Cuong; Vogel, Adrian; Vogt, Harald; von Toerne, Eckhard; Vorozhtsov, S.B.; Vos, Marcel; Votava, Margaret; Vrba, Vaclav; Wackeroth, Doreen; Wagner, Albrecht; Wagner, Carlos E.M.; Wagner, Stephen; Wake, Masayoshi; Walczak, Roman; Walkowiak, Wolfgang; Wallon, Samuel; Walsh, Roberval; Walston, Sean; Waltenberger, Wolfgang; Walz, Dieter; Wang, Chao En; Wang, Chun Hong; Wang, Dou; Wang, Faya; Wang, Guang Wei; Wang, Haitao; Wang, Jiang; Wang, Jiu Qing; Wang, Juwen; Wang, Lanfa; Wang, Lei; Wang, Min-Zu; Wang, Qing; Wang, Shu Hong; Wang, Xiaolian; Wang, Xue-Lei; Wang, Yi Fang; Wang, Zheng; Wanzenberg, Rainer; Ward, Bennie; Ward, David; Warmbein, Barbara; Warner, David W.; Warren, Matthew; Washio, Masakazu; Watanabe, Isamu; Watanabe, Ken; Watanabe, Takashi; Watanabe, Yuichi; Watson, Nigel; Wattimena, Nanda; Wayne, Mitchell; Weber, Marc; Weerts, Harry; Weiglein, Georg; Weiland, Thomas; Weinzierl, Stefan; Weise, Hans; Weisend, John; Wendt, Manfred; Wendt, Oliver; Wenzel, Hans; Wenzel, William A.; Wermes, Norbert; Werthenbach, Ulrich; Wesseln, Steve; Wester, William; White, Andy; White, Glen R.; Wichmann, Katarzyna; Wienemann, Peter; Wierba, Wojciech; Wilksen, Tim; Willis, William; Wilson, Graham W.; Wilson, John A.; Wilson, Robert; Wing, Matthew; Winter, Marc; Wirth, Brian D.; Wolbers, Stephen A.; Wolff, Dan; Wolski, Andrzej; Woodley, Mark D.; Woods, Michael; Woodward, Michael L.; Woolliscroft, Timothy; Worm, Steven; Wormser, Guy; Wright, Dennis; Wright, Douglas; Wu, Andy; Wu, Tao; Wu, Yue Liang; Xella, Stefania; Xia, Guoxing; Xia, Lei; Xiao, Aimin; Xiao, Liling; Xie, Jia Lin; Xing, Zhi-Zhong; Xiong, Lian You; Xu, Gang; Xu, Qing Jing; Yajnik, Urjit A.; Yakimenko, Vitaly; Yamada, Ryuji; Yamaguchi, Hiroshi; Yamamoto, Akira; Yamamoto, Hitoshi; Yamamoto, Masahiro; Yamamoto, Naoto; Yamamoto, Richard; Yamamoto, Yasuchika; Yamanaka, Takashi; Yamaoka, Hiroshi; Yamashita, Satoru; Yamazaki, Hideki; Yan, Wenbiao; Yang, Hai-Jun; Yang, Jin Min; Yang, Jongmann; Yang, Zhenwei; Yano, Yoshiharu; Yazgan, Efe; Yeh, G.P.; Yilmaz, Hakan; Yock, Philip; Yoda, Hakutaro; Yoh, John; Yokoya, Kaoru; Yokoyama, Hirokazu; York, Richard C.; Yoshida, Mitsuhiro; Yoshida, Takuo; Yoshioka, Tamaki; Young, Andrew; Yu, Cheng Hui; Yu, Jaehoon; Yu, Xian Ming; Yuan, Changzheng; Yue, Chong-Xing; Yue, Jun Hui; Zacek, Josef; Zagorodnov, Igor; Zalesak, Jaroslav; Zalikhanov, Boris; Zarnecki, Aleksander Filip; Zawiejski, Leszek; Zeitnitz, Christian; Zeller, Michael; Zerwas, Dirk; Zerwas, Peter; Zeyrek, Mehmet; Zhai, Ji Yuan; Zhang, Bao Cheng; Zhang, Bin; Zhang, Chuang; Zhang, He; Zhang, Jiawen; Zhang, Jing; Zhang, Jing Ru; Zhang, Jinlong; Zhang, Liang; Zhang, X.; Zhang, Yuan; Zhang, Zhige; Zhang, Zhiqing; Zhang, Ziping; Zhao, Haiwen; Zhao, Ji Jiu; Zhao, Jing Xia; Zhao, Ming Hua; Zhao, Sheng Chu; Zhao, Tianchi; Zhao, Tong Xian; Zhao, Zhen Tang; Zhao, Zhengguo; Zhou, De Min; Zhou, Feng; Zhou, Shun; Zhu, Shou Hua; Zhu, Xiong Wei; Zhukov, Valery; Zimmermann, Frank; Ziolkowski, Michael; Zisman, Michael S.; Zomer, Fabian; Zong, Zhang Guo; Zorba, Osman; Zutshi, Vishnu
2007-01-01
The International Linear Collider (ILC) is a 200-500 GeV center-of-mass high-luminosity linear electron-positron collider, based on 1.3 GHz superconducting radio-frequency (SCRF) accelerating cavities. The ILC has a total footprint of about 31 km and is designed for a peak luminosity of 2x10^34 cm^-2 s^-1. The complex includes a polarized electron source, an undulator-based positron source, two 6.7 km circumference damping rings, two-stage bunch compressors, two 11 km long main linacs and a 4.5 km long beam delivery system. This report is Volume III (Accelerator) of the four volume Reference Design Report, which describes the design and cost of the ILC.
International Nuclear Information System (INIS)
Kondrashina, Yu.G.; Mustafina, A.R.; Devyatov, F.V.; Vul'fson, S.G.; Kazanskij Gosudarstvennyj Univ., Kazan
1995-01-01
Data of pH-metric and magnetooptical analyses were used to evaluate stability and structure of benzoate and aminobenzoate dysprosium (3) complexes in water and water - 80 vol.% DMSO (DMFA) mixtures. Factors, dictating change of complex structure and stability when passing from water to organic water solvents, are discussed. 19 refs.; 2 figs.; 1 tab
1987-12-29
when the air or gas stream contains particulate matter. b. Pulverized materials passing through chutes or pneumatic conveyors . c. Nonconductive power...Hanover NH, 1971, AD 722 221. 146.Oakley, R.J., "Surface Transfer Impedance and Cable Shielding Design ," Wire Journal, Vol 4, No. 3, March 1971, pp...including considerations of grounding, bonding, and shielding in all phases of design , construction, operation, and maintenance of electronic equipment
DARPA Technical Accomplishments. An Historical Review of Selected DARPA Projects. Volume 1
1990-02-01
According to Mr. Albert Rubenstein, ARPA program manager at the time, Bell Telephone Laboratories (BTL), then constructing the Army’s Nike-Zeus Ballistic...18th Tri- Service Radar Symposiun, 1972, Vol. 1, p. 21. 14 Discussion with Mr. Albert Rubenstein, IDA, ARPA Defender Program Manager in 1958-59...in its use in Vietnam. 16-3 X26B-QT-2 INDUSTRY SAILPLANE TECHNOLOGY NAVY TEST PILOT TRNG ARMY SCHWEITZER AGILE VN REQUIREMENT I mmi" -" ~ ~ M . . •1OD
Anisotropic 3D texture synthesis with application to volume rendering
DEFF Research Database (Denmark)
Laursen, Lasse Farnung; Ersbøll, Bjarne Kjær; Bærentzen, Jakob Andreas
2011-01-01
images using a 12.1 megapixel camera. Next, we extend the volume rendering pipeline by creating a transfer function which yields not only color and opacity from the input intensity, but also texture coordinates for our synthesized 3D texture. Thus, we add texture to the volume rendered images....... This method is applied to a high quality visualization of a pig carcass, where samples of meat, bone, and fat have been used to produce the anisotropic 3D textures....
ZnO-PbO-B2O3 glasses as gamma-ray shielding materials
International Nuclear Information System (INIS)
Singh, Harvinder; Singh, Kulwant; Gerward, Leif; Singh, Kanwarjit; Sahota, Hari Singh; Nathuram, Rohila
2003-01-01
Values of the gamma-ray mass-attenuation coefficient, the photon mean free path (MFP), the effective atomic number and the effective electron density have been determined experimentally for xZnO · 2xPbO · (1-3x)B 2 O 3 (x=0.1-0.26) glasses at photon energies 511, 662, 1173 and 1332 keV and compared with theoretical data. The specific volume of the glasses has been derived from density measurements and studied as a function of composition. It is pointed out that these glasses have potential applications in radiation shielding
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. B P Das. Articles written in Bulletin of Materials Science. Volume 25 Issue 6 November 2002 pp 517-519. Structural, dielectric and electrical properties of Sm-modified Pb(SnTi)O3 ferroelectric system · B P Das R N P Choudhary P K Mahapatra · More Details Abstract Fulltext ...
Some aspects of the relation between the volume of prostate carcinoma and its interstitial BT volume
International Nuclear Information System (INIS)
Zivanovic, A; Babic, J; Erak, M.; Dabic, K.; Donat, D.; Kuzmanovic, Z.; Savic, D.
1996-01-01
It is a fact that the volume achieved by the interstitial procedure during the brachy treatment of prostate carcinoma is several times smaller than the one we get in, so called, external beam therapy. Furthermore, interstitial brachytherapy offers the possibility to apply large dose into the small volume. However, both dose and volume are at the same time the factors that limit the therapy and the main technical offenders in case of therapy failure. We tried, through a strong individual approach, to compare the volume obtained mathematically and the volume obtained by planning (TPS). By means of clinical examinations and CT scans we conceived a prostate as half of the volume of ellipsoid under one condition only: the magnification of the prostate has to be a symmetrical one. Finally, we applied the following formula: V prostate=(1(2)) ellipsoid=2.09·a/2·e/2·b where a=(1(2)) of sagittal diameter b=prostate height (from apex to base) c=(1(2)) of transversal diameter Each volume obtained in the this way has been taken into account during the application of interstitial needles which in their own way and in accordance to a routine planning, form an active therapeutic interstitial volume. The obtained data showed differences between these two types of volumes. From the statistical point of view, mathematically obtained volume of CV was 16.6% while interstitial volume was 14.9%. T-test was 3.9. On average, mathematical volume is lower and this balance is a desirable one because it means a smaller possibility for potential positive biopsy as a result of a 'rest' tumour. If on the other hand, positive biopsy is a result of the 'rest' tumour and our interpretation has been a contradictory one, precious time with disappointing results will be lost. At the end we achieved: a) double checked control of the embraced volumes, b) stronger fulcrum for the next step: dose-fraction balance
216-B-3 expansion ponds closure plan
International Nuclear Information System (INIS)
1994-10-01
This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA
216-B-3 expansion ponds closure plan
Energy Technology Data Exchange (ETDEWEB)
1994-10-01
This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.
Directory of Open Access Journals (Sweden)
Yong-sen Jia
2015-01-01
Full Text Available Objective. The purpose of the study was to elucidate the molecular mechanism of tenacissoside H (TDH inhibiting esophageal carcinoma infiltration and proliferation. Methods. In vitro, EC9706 cells were treated with TDH. Cells proliferation and cell cycle were assayed. PI3K and NF-κB mRNAs expression were determined by real time PCR. In vivo, model of nude mice with tumor was established. Mice were treated with TDH. Inhibition ratio of tumor volume was calculated. PCNA expression was examined. Protein expression in PI3K/Akt-NF-κB signaling pathway was determined. Results. In vitro, TDH significantly inhibited cells proliferation in a time-and-dose-dependent manner. TDH arrested the cell cycle in S phase and significantly inhibited PI3K and NF-κB mRNA expression, compared with blank controlled group (P<0.05. In vivo, TDH strongly inhibits tumor growth and volume. PCNA expression was significantly decreased after treatment of TDH. TDH downregulated proteins expression in PI3K/Akt-NF-κB transduction cascade (P<0.05. Conclusion. TDH inhibited esophageal carcinoma infiltration and proliferation both in vitro and in vivo. The anticancer activity has relation to arresting the cell cycle at the S phase, inhibited the PCNA expression of transplanted tumors in nude mice, and regulated the protein expression in the PI3K/Akt-NF-κB transduction cascade.
DEFF Research Database (Denmark)
Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C
2016-01-01
Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...
Directory of Open Access Journals (Sweden)
Manuel Páez
2014-04-01
Full Text Available Se determinaron las densidades de la Glicina en soluciones acuosas de Tiosulfato de Sodio Pentahidratado (0.01-2.0 mol Kg-1 usando un densímetro de tubo vibrador DMA 5000 a las temperaturas de (283,15;288,15; 293,15; 298,15; 303,15; 308,15,313,15 y 318,15 K y 1,011 bar. Se calcularon los volúmenes molares aparentes ( , los volúmenes molares aparentes a dilución infinita ( , la pendiente experimental ( , los volúmenes estandar de transferencia ( , las expansibilidades molares parciales a dilución infinita ( , la segunda derivada del volumen molar aparente a dilución infinita con respecto a la temperatura y los números de hidratación ( . Los valores obtenidos para estos parámetros fueron analizados en términos de las interacciones que ocurren a nivel de la solución. Adicionalmente, los valores de fueron interpretados en función de las interacciones soluto-cosoluto de acuerdo al modelo de la co-esfera y calculándose a partir de estos los los parámetros de interacción volumétricos dobles y triples ,usando la teoría de McMillan–Mayer . Los valores de son positivos y aumentan con el aumento de la molalidad del Na2S2O3.5H2O, mientras que los valores de son negativos en todas las concentraciones de solvente mixto; lo que sugiere que a nivel de la solución se favorecen las interacciones soluto-solvente y que la Glicina actúa como un disruptor de la estructura de las soluciones acuosas de Tiosulfato de Sodio Pentahidratado.
African Journals Online (AJOL)
jenny
2006-02-22
Feb 22, 2006 ... Southern African Journal of Environmental Education, Vol. .... To this end, a planning conference on environmental .... mathematics, physics, chemistry, biology, geography, agriculture, home economics and human and.
Programme of studies. Vol. 3: Energy. Pt. 2
International Nuclear Information System (INIS)
1995-01-01
This volume contains the reports on studies carried out by different institutions. Their titles are: 1. Overall economic impact of strategies for cutting down emissions, 2. Analysis of obstacles to, and steps towards, the realization of CO 2 emission reduction targets, 3. Future regulatory framework, especially for line-transmitted energy, in support of climate protection targets, 4. Conceptual study for a further-education and market introduction programme ''Efficient and economical use of electricity'', 5. Perspectives and consequences of the completion of the internal European market, especially the stepwise establishment of a European power market, and of international conventions (in particular with a view to climate protection) for a policy aiming to reduce greenhouse gas emissions, 6. Concept for, and valuation of, economic relations with developing countries, the Commonwealth of independent states (CIS), and eastern Europe with the aim of cutting down greenhouse gases, as well as population projections for united Germany to the year 2100 - with special regard to migrations. (orig.) [de
South African Gastroenterology Review - Vol 2, No 3 (2004)
African Journals Online (AJOL)
Risk factors of accelerated liver fibrosis in HIV-HCV coinfection: a matched analysis: original · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ayman B Ibrahim, Alexander Shpaner, Jose Nieto, Sammy Saab, 14-17. http://dx.doi.org/10.4314/sagr.v2i3.30718 ...
Energy Technology Data Exchange (ETDEWEB)
Lewis, BE
2003-10-07
The Gunite and Associated Tanks (GAAT) Remediation Project was the first of its kind performed in the United States. Robotics and remotely operated equipment were used to successfully transfer almost 94,000 gal of remote-handled transuranic sludge containing over 81,000 Ci of radioactive contamination from nine large underground storage tanks at the Oak Ridge National Laboratory (ORNL). The sludge was transferred with over 439,000 gal of radioactive waste supernatant and {approx}420,500 gal of fresh water that was used in sluicing operations. The GAATs are located in a high-traffic area of ORNL near a main thoroughfare. Volume 1 provides information on the various phases of the project and describes the types of equipment used. Volume 1 also discusses the tank waste retrieval performance and the lessons learned during the remediation effort. Volume 2 consists of the following appendixes, which are referenced in Vol. 1: A--Background Information for the Gunite and Associated Tanks Operable Unit; B--Annotated Bibliography; C--GAAT Equipment Matrix; D--Comprehensive Listing of the Sample Analysis Data from the GAAT Remediation Project; and E--Vendor List for the GAAT Remediation Project. The remediation of the GAATs was completed {approx}5.5 years ahead of schedule and {approx}$120,435K below the cost estimated in the Remedial Investigation/Feasibility Study for the project. These schedule and cost savings were a direct result of the selection and use of state-of-the-art technologies and the dedication and drive of the engineers, technicians, managers, craft workers, and support personnel that made up the GAAT Remediation Project Team.
International Nuclear Information System (INIS)
Lewis, BE
2003-01-01
The Gunite and Associated Tanks (GAAT) Remediation Project was the first of its kind performed in the United States. Robotics and remotely operated equipment were used to successfully transfer almost 94,000 gal of remote-handled transuranic sludge containing over 81,000 Ci of radioactive contamination from nine large underground storage tanks at the Oak Ridge National Laboratory (ORNL). The sludge was transferred with over 439,000 gal of radioactive waste supernatant and ∼420,500 gal of fresh water that was used in sluicing operations. The GAATs are located in a high-traffic area of ORNL near a main thoroughfare. Volume 1 provides information on the various phases of the project and describes the types of equipment used. Volume 1 also discusses the tank waste retrieval performance and the lessons learned during the remediation effort. Volume 2 consists of the following appendixes, which are referenced in Vol. 1: A--Background Information for the Gunite and Associated Tanks Operable Unit; B--Annotated Bibliography; C--GAAT Equipment Matrix; D--Comprehensive Listing of the Sample Analysis Data from the GAAT Remediation Project; and E--Vendor List for the GAAT Remediation Project. The remediation of the GAATs was completed ∼5.5 years ahead of schedule and ∼$120,435K below the cost estimated in the Remedial Investigation/Feasibility Study for the project. These schedule and cost savings were a direct result of the selection and use of state-of-the-art technologies and the dedication and drive of the engineers, technicians, managers, craft workers, and support personnel that made up the GAAT Remediation Project Team
Foothills Parkway Section 8B Final Environmental Report, Volume 4, Appendices E-I
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical, resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER consists of Appendices E through I (all ecological survey reports), which are summarized individually in the sections that follow. The following conclusions result from the completion of these surveys and the ER impact analysis: (1) Forest clearing should be limited as much as possible; (2) Disturbed areas should be replanted with native trees; (3) Drainages should be bridged rather than leveled with cut and fill; (4) For areas of steep slopes and potential erosion
Journal of Food Technology in Africa - Vol 7, No 3 (2002)
African Journals Online (AJOL)
Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.
Directory of Open Access Journals (Sweden)
Jeong HU
2015-01-01
Full Text Available Hyeon-Uk Jeong,1 Mihwa Kwon,2 Yongnam Lee,3 Ji Seok Yoo,3 Dae Hee Shin,3 Im-Sook Song,2 Hye Suk Lee1 1College of Pharmacy, The Catholic University of Korea, Bucheon 420-743, Korea; 2College of Pharmacy and Research Institute of Pharmaceutical Sciences, Kyungpook National University, Daegu 702-701, Korea; 3Central R&D Institute, Yungjin Pharm Co., Ltd., Suwon 443-270, Korea Abstract: We investigated the in vitro transport characteristics of catalposide in HEK293 cells overexpressing organic anion transporter 1 (OAT1, OAT3, organic anion transporting polypeptide 1B1 (OATP1B1, OATP1B3, organic cation transporter 1 (OCT1, OCT2, P-glycoprotein (P-gp, and breast cancer resistance protein (BCRP. The transport mechanism of catalposide was investigated in HEK293 and LLC-PK1 cells overexpressing the relevant transporters. The uptake of catalposide was 319-, 13.6-, and 9.3-fold greater in HEK293 cells overexpressing OAT3, OATP1B1, and OATP1B3 transporters, respectively, than in HEK293 control cells. The increased uptake of catalposide via the OAT3, OATP1B1, and OATP1B3 transporters was decreased to basal levels in the presence of representative inhibitors such as probenecid, furosemide, and cimetidine (for OAT3 and cyclosporin A, gemfibrozil, and rifampin (for OATP1B1 and OATP1B3. The concentration-dependent OAT3-mediated uptake of catalposide revealed the following kinetic parameters: Michaelis constant (Km =41.5 µM, maximum uptake rate (Vmax =46.2 pmol/minute, and intrinsic clearance (CLint =1.11 µL/minute. OATP1B1- and OATP1B3-mediated catalposide uptake also showed concentration dependency, with low CLint values of 0.035 and 0.034 µL/minute, respectively. However, the OCT1, OCT2, OAT1, P-gp, and BCRP transporters were apparently not involved in the uptake of catalposide into cells. In addition, catalposide inhibited the transport activities of OAT3, OATP1B1, and OATP1B3 with half-maximal inhibitory concentration values of 83, 200, and 235 µ
International Nuclear Information System (INIS)
1993-12-01
Volume II presents supplementary Background Material collected and analysed during the course of the project. Volume II consists of two parts: PART A (Sources and Methods) and PART B (Special Sub sector Issues). PART A contains seven chapters. The subject of Chapter 1 is to integrate the material of this volume into the analytical approach as a whole and to give an outline of the tools applied in the Strategy development. Reference data provided in Chapter 2 summarizes the information as to the past energy consumption and the future economic development. Chapter 3 compiles basic parameters and assumptions with regard to energy forms, costs, the economic development as laid down for use in the project. Chapter 4 discusses in detail the projection of energy demand. Chapter 5 draws up the Projects under consideration. Chapter 6 presents key results of energy scenario computations, and Chapter 7 provides energy scenario indicators and assessment information. PART B of this Volume II contains full reports regarding topics, which have only briefly been addressed in Volume I. (author).[Data
Energy Technology Data Exchange (ETDEWEB)
IC Consult-ERM Energy Limited-COWI Consult-EC-PHARE Programme Collaboration
1993-12-01
Volume II presents supplementary Background Material collected and analysed during the course of the project. Volume II consists of two parts: PART A (Sources and Methods) and PART B (Special Sub sector Issues). PART A contains seven chapters. The subject of Chapter 1 is to integrate the material of this volume into the analytical approach as a whole and to give an outline of the tools applied in the Strategy development. Reference data provided in Chapter 2 summarizes the information as to the past energy consumption and the future economic development. Chapter 3 compiles basic parameters and assumptions with regard to energy forms, costs, the economic development as laid down for use in the project. Chapter 4 discusses in detail the projection of energy demand. Chapter 5 draws up the Projects under consideration. Chapter 6 presents key results of energy scenario computations, and Chapter 7 provides energy scenario indicators and assessment information. PART B of this Volume II contains full reports regarding topics, which have only briefly been addressed in Volume I. (author).[Data].
International Nuclear Information System (INIS)
1987-01-01
The three days of conference proceedings are published in three separate volumes. The first includes 7 papers relating to economic issues - those presented at the Sizewell-B public inquiry and the changes in the economic situation since the inquiry ended. The electricity demand, how this demand is to be met by nuclear and other fuel sources and how energy conservation might be an economic alternative to simply building more generating capacity are all issues discussed. The possible privatisation of the industry is also touched on. Volume two has 8 papers concerned with environmental and safety issues. These include the influence of the Sizewell-B decision on nuclear licensing and reactor safety, the technical and safety aspects of pressurized water reactors (PWR), the roles of British Nuclear Fuels and the United Kingdom Atomic Energy Authority, and radiation protection and effluent discharge control. The six papers in volume 3 look at public perception issues - not only towards nuclear power but towards the public inquiry process. The local authority view, the Friends of the Earth case against the PWR, and technical expertise in the decision process are also topics covered. All the papers are indexed separately. (UK)
Identification of sites within the Palo Duro Basin. Volume 2. Palo Duro Location B
International Nuclear Information System (INIS)
1984-11-01
This three-volume document narrows to two sites for continued investigations for potential nuclear waste repository sites in the Palo Duro Basin of the Texas Panhandle. Volume 1 narrows a site previously identified in Deaf Smith County, Texas; Volume 2 narrows a site previously identified in Swisher County, Texas; and Volume 3 contains responses to comments received regarding the drafts of Volumes 1 and 2 (BMI/ONWI-531). These volumes discuss the methodology and logic used as well as the results that narrowed these sites. Each of the 10 site performance criteria was divided into descriptors related to site performance characteristics. Each descriptor was evaluated by a systematic logic to determine if it could be used as a discriminator. Then more- and less-preferred areas for groups of discriminators were defined and composite maps were prepared and evaluated to identify the sites
International Nuclear Information System (INIS)
1982-04-01
This statement of case summarises the case which the CEGB intends to put to the public enquiry into building a PWR reactor at Sizewell. The two volumes are divided into chapters covering an introduction, the Electricity Supply Industry and the CEGB, nuclear development on the CEGB system, new generating plant, the need for Sizewell B and various aspects of safety and design. (U.K.)
Ezcurra, I; Wycliffe, P; Nehlin, L; Ellerström, M; Rask, L
2000-10-01
The transcriptional activator ABI3 is a key regulator of gene expression during embryo maturation in crucifers. In monocots, the related VP1 protein regulates the Em promoter synergistically with abscisic acid (ABA). We identified cis-elements in the Brassica napus napin napA promoter mediating regulation by ABI3 and ABA, by analyzing substitution mutation constructs of napA in transgenic tobacco plantlets ectopically expressing ABI3. In transient analysis using particle bombardment of tobacco leaf sections, a tetramer of the distB ABRE (abscisic acid-responsive element) mediated transactivation by ABI3 and ABI3-dependent response to ABA, whereas a tetramer of the composite RY/G complex, containing RY repeats and a G-box, mediated only ABA-independent transactivation by ABI3. Deletion of the conserved B2 and B3 domains of ABI3 abolished transactivation of napA by ABI3. The two domains of ABI3 interact with different cis-elements: B2 is necessary for ABA-independent and ABA-dependent activations through the distB ABRE, whereas B3 interacts with the RY/G complex. Thus B2 mediates the interaction of ABI3 with the protein complex at the ABRE. The regulation of napA by ABI3 differs from Em regulation by VP1, in that the B3 domain of ABI3 is essential for the ABA-dependent regulation of napA.
Enrichment of W2B5 from WO3 and B2O3 by Double SHS Method
Directory of Open Access Journals (Sweden)
Bora DERIN
2018-02-01
Full Text Available A second self-propagating high-temperature synthesis (SHS was carried out to enrich the W2B5 content in the SHS product containing a mixture of various tungsten boride compounds. In the experiment, the process called Double-SHS (D-SHS was conducted in two steps. In the first SHS reaction, an initial molar composition ratio of WO3:B2O3:Mg mixture was selected as 1:3:8. The product was then hot-leached with hydrochloric acid to eliminate MgO and Mg3B2O6 phases. The leached product, consisting of 72.6 wt.% W2B5, 16.1 wt.% WB, 8.4 wt.% W2B, and 2.9 wt.% W, was again reacted with the Mg and B2O3 mixture by second SHS. After another acid leaching step, W2B5 content in the D-SHS product was found to be 98.2 wt.%. The study showed that D-SHS is an effective method for boron enrichment in the tungsten compounds.DOI: http://dx.doi.org/10.5755/j01.ms.24.1.17834
International Nuclear Information System (INIS)
Ediger, M.D.; Domingue, R.P.; Fayer, M.D.
1984-01-01
A detailed experimental and theoretical examination of electronic excited state transport in the finite volume system, octadecyl rhodamine B molecules in triton X-100 micelles, is presented. Picosecond fluorescence mixing and transient grating techniques were used to examine systems in which the average number of chromophores per micelle ranged from 0.1 to 11. Because of the clustering of chromophores in the small micelles, the energy transport observed is extremely efficient. A statistical mechanical theory, based on a density expansion with a Pade approximant, is developed for donor--donor transport on a spherical surface. This theory accurately accounts for the experimental data with only the micelle radius as an adjustable parameter. The radius obtained from this procedure is in good agreement with determinations by other methods. This demonstrates that quantitative information about the spatial extent of chromophore distributions in small volumes can be obtained when appropriate finite volume energy transport theories are employed. It is shown that theories developed for infinite volumes are not applicable to systems such as the ones considered here. Finally the partitioning of rhodamine B and octadecyl rhodamine B between aqueous and micellar phases is measured, and lifetimes and rotation times are reported
International Nuclear Information System (INIS)
Kim, Sung-Hak; Park, Jinah; Choi, Moon-Chang; Kim, Hwang-Phill; Park, Jung-Hyun; Jung, Yeonjoo; Lee, Ju-Hee; Oh, Do-Youn; Im, Seock-Ah; Bang, Yung-Jue; Kim, Tae-You
2007-01-01
DNA methyltransferases (DNMT) 3B is a de novo DNMT that represses transcription independent of DNMT activity. In order to gain a better insight into DNMT3B-mediated transcriptional repression, we performed a yeast two-hybrid analysis using DNMT3B as a bait. Of the various binding candidates, ZHX1, a member of zinc-finger and homeobox protein, was found to interact with DNMT3B in vivo and in vitro. N-terminal PWWP domain of DNMT3B was required for its interaction with homeobox motifs of ZHX1. ZHX1 contains nuclear localization signal at C-terminal homeobox motif, and both ZHX1 and DNMT3B were co-localized in nucleus. Furthermore, we found that ZHX1 enhanced the transcriptional repression mediated by DNMT3B when DNMT3B is directly targeted to DNA. These results showed for First the direct linkage between DNMT and zinc-fingers homeoboxes protein, leading to enhanced gene silencing by DNMT3B
Enhanced FIB-SEM systems for large-volume 3D imaging
Xu, C Shan; Hayworth, Kenneth J; Lu, Zhiyuan; Grob, Patricia; Hassan, Ahmed M; García-Cerdán, José G; Niyogi, Krishna K; Nogales, Eva; Weinberg, Richard J; Hess, Harald F
2017-01-01
Focused Ion Beam Scanning Electron Microscopy (FIB-SEM) can automatically generate 3D images with superior z-axis resolution, yielding data that needs minimal image registration and related post-processing. Obstacles blocking wider adoption of FIB-SEM include slow imaging speed and lack of long-term system stability, which caps the maximum possible acquisition volume. Here, we present techniques that accelerate image acquisition while greatly improving FIB-SEM reliability, allowing the system to operate for months and generating continuously imaged volumes > 106 µm3. These volumes are large enough for connectomics, where the excellent z resolution can help in tracing of small neuronal processes and accelerate the tedious and time-consuming human proofreading effort. Even higher resolution can be achieved on smaller volumes. We present example data sets from mammalian neural tissue, Drosophila brain, and Chlamydomonas reinhardtii to illustrate the power of this novel high-resolution technique to address questions in both connectomics and cell biology. DOI: http://dx.doi.org/10.7554/eLife.25916.001 PMID:28500755
Journal of Pharmacy & Bioresources - Vol 3, No 2 (2006)
African Journals Online (AJOL)
Microbial contamination of disinfectant solutions in some health care institutions of three towns in Northern Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B A Tytler, J O Adeyemi, E O Adetoran, H M Biyama, 77-82. http://dx.doi.org/10.4314/jpb.v3i2.32097 ...
Force estimation from OCT volumes using 3D CNNs.
Gessert, Nils; Beringhoff, Jens; Otte, Christoph; Schlaefer, Alexander
2018-05-04
Estimating the interaction forces of instruments and tissue is of interest, particularly to provide haptic feedback during robot-assisted minimally invasive interventions. Different approaches based on external and integrated force sensors have been proposed. These are hampered by friction, sensor size, and sterilizability. We investigate a novel approach to estimate the force vector directly from optical coherence tomography image volumes. We introduce a novel Siamese 3D CNN architecture. The network takes an undeformed reference volume and a deformed sample volume as an input and outputs the three components of the force vector. We employ a deep residual architecture with bottlenecks for increased efficiency. We compare the Siamese approach to methods using difference volumes and two-dimensional projections. Data were generated using a robotic setup to obtain ground-truth force vectors for silicon tissue phantoms as well as porcine tissue. Our method achieves a mean average error of [Formula: see text] when estimating the force vector. Our novel Siamese 3D CNN architecture outperforms single-path methods that achieve a mean average error of [Formula: see text]. Moreover, the use of volume data leads to significantly higher performance compared to processing only surface information which achieves a mean average error of [Formula: see text]. Based on the tissue dataset, our methods shows good generalization in between different subjects. We propose a novel image-based force estimation method using optical coherence tomography. We illustrate that capturing the deformation of subsurface structures substantially improves force estimation. Our approach can provide accurate force estimates in surgical setups when using intraoperative optical coherence tomography.
Energy Technology Data Exchange (ETDEWEB)
Wang, Tianhong; Jiang, Yue; Wang, Guo-Li [Harbin Institute of Technology, Department of Physics, Harbin (China); Wang, Zhi-Hui [Beifang University of Nationalities, School of Electrical and Information Engineering, Yinchuan (China); Jiang, Libo [University of Pittsburgh, Department of Physics and Astronomy, Pittsburgh, PA (United States)
2017-01-15
In this paper, we study the OZI-allowed two-body strong decays of 3{sup -} heavy-light mesons. Experimentally the charmed D{sub 3}{sup *}(2760) and the charm-strange D{sub s3}{sup *}(2860) states with these quantum numbers have been discovered. For the bottomed B(5970) state, which was found by the CDF Collaboration recently, its quantum number has not been decided yet and we assume it is a 3{sup -} meson in this paper. The theoretical prediction for the strong decays of bottom-strange state B{sub s3}{sup *} is also given. The relativistic wave functions of 3{sup -} heavy mesons are constructed and their numerical values are obtained by solving the corresponding Bethe-Salpeter equation with instantaneous approximation. The transition matrix is calculated by using the PCAC and low energy theorem, following which the decay widths are obtained. For D{sub 3}{sup *}(2760) and D{sub s3}{sup *}(2860), the total strong decay widths are 72.6 and 47.6 MeV, respectively. For B{sub 3}{sup *} with M = 5978 MeV and B{sub s3}{sup *} with M = 6178 MeV, their strong decay widths are 22.9 and 40.8 MeV, respectively. (orig.)
X-ray diffraction study of the phase purity, order and texture of ductile B2 intermetallics
Energy Technology Data Exchange (ETDEWEB)
Mulay, R.P.; Wollmershauser, J.A.; Heisel, M.A. [Materials Science and Engineering, University of Virginia, Charlottesville, VA 22904-4745 (United States); Bei, H. [Oak Ridge National Laboratory, Material Science and Technology Division, Oak Ridge, TN 37831 (United States); Russell, A.M. [Iowa State University, Department of Materials Science and Engineering, Ames, IA 50011 (United States); Agnew, S.R., E-mail: sra4p@virginia.edu [Materials Science and Engineering, University of Virginia, Charlottesville, VA 22904-4745 (United States)
2010-04-15
Representatives (AgY, CuY, AgEr, CuDy, MgY and MgCe) of the newly discovered family of ductile stoichiometric B2 intermetallic (metal-rare-earth element, MR) compounds were characterized by X-ray diffraction, to determine if their anomalous ductility is related to an exceptional level of phase purity, lack of chemical ordering or a strong crystallographic texture. Brittle NiAl served as an anti-type in this study. We found that all of the rare-earth compounds, except MgY, have a significant volume fraction ({approx}5-20 vol.%) of second phases (M{sub 2}R intermetallics and R{sub 2}O{sub 3} oxides), which has not been reported in previous studies of these materials. The most ductile of observed MR compounds, AgY, is highly ordered. A moderate texture was observed in AgY, which may explain its higher ductility (using polycrystal modeling) as compared to other MR compounds. However, the intrinsic polycrystalline ductility of these compounds in the randomly textured state (like that observed in CuY) still has no specific, definitive explanation.
X-ray diffraction study of the phase purity, order and texture of ductile B2 intermetallics
International Nuclear Information System (INIS)
Mulay, R.P.; Wollmershauser, J.A.; Heisel, M.A.; Bei, H.; Russell, A.M.; Agnew, S.R.
2010-01-01
Representatives (AgY, CuY, AgEr, CuDy, MgY and MgCe) of the newly discovered family of ductile stoichiometric B2 intermetallic (metal-rare-earth element, MR) compounds were characterized by X-ray diffraction, to determine if their anomalous ductility is related to an exceptional level of phase purity, lack of chemical ordering or a strong crystallographic texture. Brittle NiAl served as an anti-type in this study. We found that all of the rare-earth compounds, except MgY, have a significant volume fraction (∼5-20 vol.%) of second phases (M 2 R intermetallics and R 2 O 3 oxides), which has not been reported in previous studies of these materials. The most ductile of observed MR compounds, AgY, is highly ordered. A moderate texture was observed in AgY, which may explain its higher ductility (using polycrystal modeling) as compared to other MR compounds. However, the intrinsic polycrystalline ductility of these compounds in the randomly textured state (like that observed in CuY) still has no specific, definitive explanation.
General and special engineering materials science. Vol. 3
International Nuclear Information System (INIS)
Ondracek, G.; Hofmann, P.
1983-04-01
The report about general and special engineering materials science is the result of lectures given by the authors in two terms in 1982 at Instituto Balseiro, San Carlos de Bariloche, the graduated college of the Universidad de Cuyo and Comision Nacional de Energia Atomica, Republica Argentina. These lectures were organised in the frame of the project ''nuclear engineering'' (ARG/78/020) of the United Nations Development Program (UNDP) by the International Atomic Energy Agency (IAEA). Some chapters of the report are written in English, others in Spanish. The report is subdivided into three volumes. The present volume III concerns special engineering materials science and considers nuclear materials with respect to off-normal (''accident'') reactor operation conditions including nuclear materials in loss-of-coolant accident and nuclear materials in core melt accidents. (orig./IHOE) [de
Theoretical analysis of the structural phase transformation from B3 to B1 in BeO under high pressure
Jain, Arvind; Verma, Saligram; Nagarch, R. K.; Shah, S.; Kaurav, Netram
2018-05-01
We have performed the phase transformation and elastic properties of BeO at high pressure by formulating effective interionic interaction potential. The elastic constants, including the long-range Coulomb and van der Waals (vdW) interactions and the short-range repulsive interaction of up to second-neighbor ions within the Hafemeister and Flygare approach, are derived. Assuming that both the ions are polarizable, we employed the Slater-Kirkwood variational method to estimate the vdW coefficients, a structural phase transition (Pt) from ZnS structure (B3) to NaCl structure (B1) at 108 GPa has been predicted for BeO. The estimated value of the phase transition pressure (Pt) and the magnitude of the discontinuity in volume at the transition pressure are consistent as compared to the theoretical data. The variations of elastic constants with pressure follow a systematic trend identical to that observed in others compounds of ZnS type structure family.
African Journals Online (AJOL)
Journal Home > Archives > Vol 29 (2012) ... Leakage aware hardware and stochastic power scheduling for smart mobile devices ... Energy efficient topology for Wireless Mesh Networks · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Zeng, Cheng-Hui; Yang, Yang-Yi; Zhu, Yi-Min; Wang, Hong-Ming; Chu, Tian-Shu; Ng, Seik Weng
2012-01-01
A new dinuclear terbium complex [Tb(2)(4-msal)(6)(H(2)O)(4)]·6H(2)O (1) (4-msal = 4-methylsalcylate) was synthesized. Its structure was determined by single crystal X-ray diffraction, and the complex was characterized by PXRD, FT-IR, fluorescence, TGA and DTA. Complex 1 exists as discrete molecules that are linked by extensive O-H … O hydrogen bonds into a 3D network. The luminescence lifetimes of 3 μM methanol solution and solid sample of 1 are 1.321 and 1.009 ms, respectively. The quantum yield of solid sample is 6.0%. The luminescence quenched more than 50% when 3% (vol/vol) different impurities (acetone, acetonitrile, chloroform, dichloromethane, dioxane, DMF, DMSO, ethanol, ether, ethyl acetate, glycol, H(2)O, hexane, TEA, THF and toluene or their mixture) were added. The inverse linear relationship between the Lg value of fluorescence intensity and the volume ratio of the minor component (to a maximum of 20%) is interpreted in terms of LgI = a-bX (I: luminescence intensity; X: volume ratio of impurities in methanol; a, b are constants). So 1 is a potential luminescent sensor for analyzing the purity of methanol. © 2012 Wiley Periodicals, Inc. Photochemistry and Photobiology © 2012 The American Society of Photobiology.
Safe Management and disposal of nuclear waste. Volume 3
International Nuclear Information System (INIS)
1993-01-01
These proceedings of the international conference Safewaste 93, volume 3 are divided into three poster sessions bearing on: poster session P-1: Radioactive waste management and actinide burning; poster session P-2: Safety aspects of radioactive waste disposal; poster session P-3: Transport and disposal
1991-01-01
WATER DEPTHI FTI ,.f’ WELL I NTEGRITY~...- . -rS Ng~ ELEVATIONI GAL/VOL PROT. CA6 +9lG-lECURE U H E I H T O F •....-7\\ - - C ý C R E T E C O L L A R IN... treatment facility for intercepting and stripping contaminated groundwater of volatile organic compounds (VOCs). In order to perform the aquifer test...available in the IRM treatment facility building were used as a backup for flow rate measurements. During the aquifer test, water from BCW-3 was piped
International Nuclear Information System (INIS)
Tao Chengying
1986-01-01
The data of molar volumes of uranous nitrate and nitric acid are necessary for the calculation of the changes in phase volume during the extraction in U(NO 3 ) 4 -HNO 3 /30%TBP-kerosene system. However, the data of the partial molar volume of U(NO 3 ) 4 are not available in literature. In the present work, the molar volumes of U(NO 3 ) 4 and HNO 3 are calculated by linear fitting of the experimental data. The result of the molar volume of HNO 3 is consistent with those in literature
International Nuclear Information System (INIS)
Mullins, C.B.; Felde, D.K.; Sutton, A.G.; Gould, S.S.; Morris, D.G.; Robinson, J.J.
1982-05-01
Reduced instrument responses are presented for Thermal-Hyraulic Test Facility (THTF) Test 3.06.6B. This test was conducted by members of the Oak Ridge National Laboratory Pressurized-Water-Reactor (PWR) Blowdown Heat Transfer (BDHT) Separate-Effects Program on August 29, 1980. The objective of the program was to investigate heat transfer phenomena believed to occur in PWR's during accidents, including small and large break loss-of-coolant accidents. Test 3.06.6B was conducted to obtain transient film boiling data in rod bundle geometry under reactor accident-type conditions. The primary purpose of this report is to make the reduced instrument responses for THTF Test 3.06.6B available. Included in the report are uncertainties in the instrument responses, calculated mass flows, and calculated rod powers
Therapeutic hip injections: Is the injection volume important?
International Nuclear Information System (INIS)
Young, R.; Harding, J.; Kingsly, A.; Bradley, M.
2012-01-01
Aim: To assess whether an increased volume of local anaesthetic injection given with intra-articular steroids improves symptom relief in osteoarthritis of the hip. Materials and methods: One hundred and ten patients with hip osteoarthritis were randomized into two groups (A and B). All patients were given 40 mg triamcinolone and 2 ml bupivicaine, and patients from group B were also given 6 ml of sterile water for injection. Change in WOMAC (Western Ontario and McMaster University Osteoarthritis Index Version 3.1) scores from baseline to 3 months were calculated and assessed for clinical and statistical significance. The patients were assessed for pain at 2 weekly intervals using the Oxford pain chart. Results: Patients from group B showed some reduction in stiffness (7%) and improved function (3%) compared with group A, and there were more clinical responders in these two categories. However, there was no significant statistical or clinical difference in WOMAC scores between the two groups at 3 months. There was also no statistical difference in pain symptoms between the two groups during the study period, measured at 2 weekly intervals. One hundred and two patients reached the study endpoint; eight patients who had bilateral hip injections were subsequently included in the analysis, and these patients did not alter the findings significantly. Conclusions: Published total injection volumes used for treating osteoarthritis of the hip with intra-articular steroids vary from 3 to 12 ml. The present study has shown that there is no detriment to using a larger volume of injectate, and recommends that practitioners use total volumes between 3 and 9 ml.
Therapeutic hip injections: Is the injection volume important?
Energy Technology Data Exchange (ETDEWEB)
Young, R., E-mail: russell.young@gwh.nhs.uk [Department of Radiology, Great Western Hospital, Swindon (United Kingdom); Harding, J. [Department of Radiology, University Hospital Coventry, Coventry (United Kingdom); Kingsly, A. [Department of Mathematics and Statistics, Bristol Institue of Technology, University of the West of England, Bristol (United Kingdom); Bradley, M. [Department of Radiology, Southmead Hospital, Bristol (United Kingdom)
2012-01-15
Aim: To assess whether an increased volume of local anaesthetic injection given with intra-articular steroids improves symptom relief in osteoarthritis of the hip. Materials and methods: One hundred and ten patients with hip osteoarthritis were randomized into two groups (A and B). All patients were given 40 mg triamcinolone and 2 ml bupivicaine, and patients from group B were also given 6 ml of sterile water for injection. Change in WOMAC (Western Ontario and McMaster University Osteoarthritis Index Version 3.1) scores from baseline to 3 months were calculated and assessed for clinical and statistical significance. The patients were assessed for pain at 2 weekly intervals using the Oxford pain chart. Results: Patients from group B showed some reduction in stiffness (7%) and improved function (3%) compared with group A, and there were more clinical responders in these two categories. However, there was no significant statistical or clinical difference in WOMAC scores between the two groups at 3 months. There was also no statistical difference in pain symptoms between the two groups during the study period, measured at 2 weekly intervals. One hundred and two patients reached the study endpoint; eight patients who had bilateral hip injections were subsequently included in the analysis, and these patients did not alter the findings significantly. Conclusions: Published total injection volumes used for treating osteoarthritis of the hip with intra-articular steroids vary from 3 to 12 ml. The present study has shown that there is no detriment to using a larger volume of injectate, and recommends that practitioners use total volumes between 3 and 9 ml.
Big Area Additive Manufacturing of High Performance Bonded NdFeB Magnets.
Li, Ling; Tirado, Angelica; Nlebedim, I C; Rios, Orlando; Post, Brian; Kunc, Vlastimil; Lowden, R R; Lara-Curzio, Edgar; Fredette, Robert; Ormerod, John; Lograsso, Thomas A; Paranthaman, M Parans
2016-10-31
Additive manufacturing allows for the production of complex parts with minimum material waste, offering an effective technique for fabricating permanent magnets which frequently involve critical rare earth elements. In this report, we demonstrate a novel method - Big Area Additive Manufacturing (BAAM) - to fabricate isotropic near-net-shape NdFeB bonded magnets with magnetic and mechanical properties comparable or better than those of traditional injection molded magnets. The starting polymer magnet composite pellets consist of 65 vol% isotropic NdFeB powder and 35 vol% polyamide (Nylon-12). The density of the final BAAM magnet product reached 4.8 g/cm 3 , and the room temperature magnetic properties are: intrinsic coercivity H ci = 688.4 kA/m, remanence B r = 0.51 T, and energy product (BH) max = 43.49 kJ/m 3 (5.47 MGOe). In addition, tensile tests performed on four dog-bone shaped specimens yielded an average ultimate tensile strength of 6.60 MPa and an average failure strain of 4.18%. Scanning electron microscopy images of the fracture surfaces indicate that the failure is primarily related to the debonding of the magnetic particles from the polymer binder. The present method significantly simplifies manufacturing of near-net-shape bonded magnets, enables efficient use of rare earth elements thus contributing towards enriching the supply of critical materials.
Kong, Guanghui; Zhao, Yao; Jing, Maofeng; Huang, Jie; Yang, Jin; Xia, Yeqiang; Kong, Liang; Ye, Wenwu; Xiong, Qin; Qiao, Yongli; Dong, Suomeng; Ma, Wenbo; Wang, Yuanchao
2015-08-01
Plant pathogens secrete an arsenal of effector proteins to impair host immunity. Some effectors possess enzymatic activities that can modify their host targets. Previously, we demonstrated that a Phytophthora sojae RXLR effector Avr3b acts as a Nudix hydrolase when expressed in planta; and this enzymatic activity is required for full virulence of P. sojae strain P6497 in soybean (Glycine max). Interestingly, recombinant Avr3b produced by E. coli does not have the hydrolase activity unless it was incubated with plant protein extracts. Here, we report the activation of Avr3b by a prolyl-peptidyl isomerase (PPIase), cyclophilin, in plant cells. Avr3b directly interacts with soybean cyclophilin GmCYP1, which activates the hydrolase activity of Avr3b in a PPIase activity-dependent manner. Avr3b contains a putative Glycine-Proline (GP) motif; which is known to confer cyclophilin-binding in other protein substrates. Substitution of the Proline (P132) in the putative GP motif impaired the interaction of Avr3b with GmCYP1; as a result, the mutant Avr3bP132A can no longer be activated by GmCYP1, and is also unable to promote Phytophthora infection. Avr3b elicits hypersensitive response (HR) in soybean cultivars producing the resistance protein Rps3b, but Avr3bP132A lost its ability to trigger HR. Furthermore, silencing of GmCYP1 rendered reduced cell death triggered by Avr3b, suggesting that GmCYP1-mediated Avr3b maturation is also required for Rps3b recognition. Finally, cyclophilins of Nicotiana benthamiana can also interact with Avr3b and activate its enzymatic activity. Overall, our results demonstrate that cyclophilin is a "helper" that activates the enzymatic activity of Avr3b after it is delivered into plant cells; as such, cyclophilin is required for the avirulence and virulence functions of Avr3b.
International Nuclear Information System (INIS)
Horng, Annie; Raya, J.; Klinikum der Ludwig-Maximilians-Universitaet Muenchen, Grosshadern; Zscharn, M.
2011-01-01
Purpose: To analyze locoregional deformation patterns indicative of contact areas in patellar cartilage after different loading exercises. Materials and Methods: 7 healthy patellae were examined in-vivo before and immediately after standardized loading (kneeling, squatting or knee bends) and after 90 minutes of rest using a sagittal 3D-T1-w FLASH WE sequence (22 msec/ 9.8msec/ 15 / 0.3 x 0.3 x 1.5 mm 3 ) at 3 T. After cartilage segmentation and 3D reconstruction, voxel-based and global precision errors (PR) were calculated. The former were used to determine significant differences in local cartilage thickness. Voxel-based 2σ-thickness difference maps were calculated to visualize locoregional deformation patterns. Global changes in volume (Vol), mean thickness (mTh) and cartilage-bone-interface area (CBIA) were calculated. Results: The voxel-based PR depended on cartilage thickness (D) ranging from 0.12 - 0.35 mm. For D ≥ 1 mm the RF was 3 (2.4 %) for Vol, 0.06 mm (2.0 %) for mTh and 16 mm 2 (1.4 %) for CBIA. The focal cartilage deformation equaled 14 % of the local thickness reduction. The deformation areas were oval and located in the peripheral medial (more vertically oriented, all exercises) and caudo-lateral (more horizontally oriented, kneeling and knee bends) aspects of the patella and were least pronounced in knee bends. Significant changes for Vol/mTh ranged from 2.1 to 3.7 %. Conclusion: This MRI-based study is the first to identify in-vivo voxel-based patellar cartilage deformation patterns indicating contact and loading zones after kneeling and squatting. These zones are anatomically and functionally plausible and may represent areas where stress induced degeneration and subsequent OA can originate. The data may facilitate understanding of individual knee loading properties and help to improve and validate biomechanical models for the knee. (orig.)
International Nuclear Information System (INIS)
Lee, M.S.; Terry, B.S.; Grieveson, P.
1993-01-01
The interfacial phenomena occurring during the contacting of liquid Al-B, Al-Ti-B, and Al-Zr-B melts with KF-AlF 3 liquid fluxes have been investigated by optical examination of quenched metal drops previously immersed in the liquid fluxes. Reactions in the Al-B/KF-AlF 3 system involve the formation of metastable AlB 12 at the metal/flux interface. At high KBF 4 levels in the flux, the AlB 12 is dispersed in the flux and also at low KBF 4 levels in the metal. Reactions in the Al-Ti-B/KF-AlF 3 system involve the formation of TiB 2 , which may be dispersed in either the metal or the flux depending upon the composition of the flux. The results obtained for the Al-Ti-B/NaF-AlF 3 and Al-Zr-B/KF-AlF 3 systems were similar to those observed for the Al-Ti-B/KF-AlF 3 system
Molar volume dependence of the pressure of solid 3He at very low temperatures
International Nuclear Information System (INIS)
Mamiya, T.; Sawada, A.; Fukuyama, H.; Iwahashi, K.; Masuda, Y.
1983-01-01
The pressure of solid 3 He has been measured as a function of temperature T between 0.3 and 50 mK at molar volumes between 24.19 and 23.31 cm 3 . The entropy discontinuity obtained from the pressure jump at the ordering transition turned out to be almost independent of molar volumes, being about 0.40Rln2 in the studied range of molar volumes
Huang, Hao; Li, Ruohan; Yuan, Jinxian; Zhou, Xin; Liu, Xi; Ou, Shu; Xu, Tao; Chen, Yangmei
2016-05-15
EphB family receptor tyrosine kinases, in cooperation with cell surface-bound ephrinB ligands, play a critical role in maintenance of dendritic spine morphogenesis, axons guidance, synaptogenesis, synaptic reorganization and plasticity in the central nervous system (CNS). However, the expression pattern of ephrinB/EphB in intractable temporal lobe epilepsy (TLE) and the underlying molecular mechanisms during epileptogenesis remain poorly understood. Here we investigated the expression pattern and cellular distribution of ephrinB/EphB in intractable TLE patients and lithium chloride-pilocarpine induced TLE rats using real-time quantitative polymerase chain reaction (RT-qPCR), immunohistochemistry, double-labeled immunofluorescence and Western blot analysis. Compared to control groups, ephrinB3 and EphB3 mRNA expression were significantly up-regulated in intractable TLE patients and TLE rats, while the mRNA expression trend of ephrinB1/2 and EphB1/2/4/6 in intractable TLE patients and TLE rats were inconsistent. Western blot analysis and semi-quantitative immunohistochemistry confirmed that ephrinB3 and EphB3 protein level were up-regulated in intractable TLE patients and TLE rats. At the same time, double-labeled immunofluorescence indicate that ephrinB3 was expressed mainly in the cytoplasm and protrusions of glia and neurons, while EphB3 was expressed mainly in the cytoplasm of neurons. Taken together, up-regulated expression of ephrinB3/EphB3 in intractable TLE patients and experimental TLE rats suggested that ephrinB3/EphB3 might be involved in the pathogenesis of TLE. Copyright © 2016 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Leonard, Kara Lynne; Hepel, Jaroslaw T.; Hiatt, Jessica R.; Dipetrillo, Thomas A.; Price, Lori Lyn; Wazer, David E.
2013-01-01
Purpose: To evaluate dose-volume parameters and the interfraction interval (IFI) as they relate to cosmetic outcome and normal tissue effects of 3-dimensional conformal radiation therapy (3D-CRT) for accelerated partial breast irradiation (APBI). Methods and Materials: Eighty patients were treated by the use of 3D-CRT to deliver APBI at our institutions from 2003-2010 in strict accordance with the specified dose-volume constraints outlined in the National Surgical Adjuvant Breast and Bowel Project B39/Radiation Therapy Oncology Group 0413 (NSABP-B39/RTOG 0413) protocol. The prescribed dose was 38.5 Gy in 10 fractions delivered twice daily. Patients underwent follow-up with assessment for recurrence, late toxicity, and overall cosmetic outcome. Tests for association between toxicity endpoints and dosimetric parameters were performed with the chi-square test. Univariate logistic regression was used to evaluate the association of interfraction interval (IFI) with these outcomes. Results: At a median follow-up time of 32 months, grade 2-4 and grade 3-4 subcutaneous fibrosis occurred in 31% and 7.5% of patients, respectively. Subcutaneous fibrosis improved in 5 patients (6%) with extended follow-up. Fat necrosis developed in 11% of women, and cosmetic outcome was fair/poor in 19%. The relative volume of breast tissue receiving 5%, 20%, 50%, 80%, and 100% (V5-V100) of the prescribed dose was associated with risk of subcutaneous fibrosis, and the volume receiving 50%, 80%, and 100% (V50-V100) was associated with fair/poor cosmesis. The mean IFI was 6.9 hours, and the minimum IFI was 6.2 hours. The mean and minimum IFI values were not significantly associated with late toxicity. Conclusions: The incidence of moderate to severe late toxicity, particularly subcutaneous fibrosis and fat necrosis and resulting fair/poor cosmesis, remains high with continued follow-up. These toxicity endpoints are associated with several dose-volume parameters. Minimum and mean IFI values were
International Nuclear Information System (INIS)
He Ming; Wu Mengqiang; Zhang Shuren; Zhou Xiaohua; Zhang Ting; Chen Song
2010-01-01
Research highlights: → As for CBS ternary system glass ceramics, due to the complex phase compositions, many methods could be difficult to determine quantitatively the absolute amounts of crystalline and remaining oxides. In this study, an available method based on the Rietveld method was used to quantitatively analyze the relative weight fraction and densities of crystalline phases. These above data are used to obtain a table of both relative weight fraction of crystalline phases and densities of all phases including CBS LTCC. Using volume additivity rule, it is possible to analysis quantitatively the absolute weight fraction of crystalline phases and also the oxides molar content in the remaining glass. - Abstract: Based on Rietveld method of X-ray techniques and volume additivity rule, a new method was developed to quantitatively analyze the phase composition of CaO-B 2 O 3 -SiO 2 ternary system glass ceramics. Lattice parameters, densities and relative weight fractions of crystalline phases in CaO-B 2 O 3 -SiO 2 ternary system were obtained by X-ray diffraction (XRD) refinement. According to the relative weight fraction of crystalline phases and densities of various components, the volume additivity rule was revealed by calculating the absolute weight fraction of crystalline phases of CaO-B 2 O 3 -SiO 2 glass ceramics. In addition, molar contents of the oxides in the remaining glass can also be determined by this method. Comparing this method with internal standard method, it is found that the maximum deviations of the crystallinity and the absolute weight fraction of crystalline phases are less than 2.6% and 2.9%, respectively. As a result, quantitative evaluation of CaO-B 2 O 3 -SiO 2 ternary system glass ceramics can be achieved using this method.
Large volume syringe pump extruder for desktop 3D printers
Directory of Open Access Journals (Sweden)
Kira Pusch
2018-04-01
Full Text Available Syringe pump extruders are required for a wide range of 3D printing applications, including bioprinting, embedded printing, and food printing. However, the mass of the syringe becomes a major challenge for most printing platforms, requiring compromises in speed, resolution and/or volume. To address these issues, we have designed a syringe pump large volume extruder (LVE that is compatible with low-cost, open source 3D printers, and herein demonstrate its performance on a PrintrBot Simple Metal. Key aspects of the LVE include: (1 it is open source and compatible with open source hardware and software, making it inexpensive and widely accessible to the 3D printing community, (2 it utilizes a standard 60 mL syringe as its ink reservoir, effectively increasing print volume of the average bioprinter, (3 it is capable of retraction and high speed movements, and (4 it can print fluids using nozzle diameters as small as 100 μm, enabling the printing of complex shapes/objects when used in conjunction with the freeform reversible embedding of suspended hydrogels (FRESH 3D printing method. Printing performance of the LVE is demonstrated by utilizing alginate as a model biomaterial ink to fabricate parametric CAD models and standard calibration objects. Keywords: Additive manufacturing, 3D bioprinting, Embedded printing, FRESH, Soft materials extrusion
Energy Technology Data Exchange (ETDEWEB)
Hellwege, K H; Hellwege, A M [eds.; Eisenmann, B; Schaefer, H
1986-01-01
Volume III/14 'Structure data of elements and intermetallic phases' is a supplement to and extension of Volume III/6. Since the publication of III/6 in 1971 (considering original papers up to 1967), the amount of new information for these substances has increased rapidly. Therefore the data had to be divided into several parts. The first part, III/14b1, is presented herewith. In Volume III/6, simple sulfides, selenides and tellurides were treated together with the intermetallic phases. The data are compiled in the same way as in III/6: for each substance the space group, lattice constants, their dependence on temperature and pressure, and other information is listed in the tables. In several cases, mostly for solid solutions, diagrams are given which are added in a separate chapter. Original papers containing a complete structure analysis are referred to in the tables. (orig./GSCH).
African Journals Online (AJOL)
Prof Ezechukwu
2012-07-13
10.4314/njp.v40i1,9. Abstract Objective: Although the calibre of the airway is kept patent by multifactorial control system, there is evidence that ..... Lewinshohn HC, Capel LH, Smart. J. Changes in forced expiratory volumes throughout ...
Tsuchiya, Yuji; Miura, Shun; Awaji, Satoshi; Ichino, Yusuke; Matsumoto, Kaname; Izumi, Teruo; Watanabe, Kazuo; Yoshida, Yutaka
2017-10-01
REBa2Cu3O y superconducting tapes are appropriate for high field magnet applications at low temperatures (i.e. below liquid nitrogen temperature). To clarify the morphology and the volume of the effective pinning center at low temperatures, we used a low-temperature growth technique to fabricate SmBa2Cu3O y (SmBCO) films with various amounts of BaHfO3 (BHO) nanorods onto MgO-buffered metal substrates produced by ion-beam-assisted deposition; we investigated their flux pinning properties using a 25 T cryogen-free superconducting magnet that was recently developed at Tohoku University. According to the microstructural analysis using transmission electron microscopy, the BHO nanorods have a content-dependent morphology and are aligned for the higher content. The inclined and discontinuous BHO nanorods were observed in SmBCO films with BHO contents up to 3.8 vol%; they show an excellent flux pinning force density (1.5 TN m-3 at 21 T and 4.2 K) even when the magnetic field is perpendicular to the films. Based on the effective mass model for the flux pinning, the random pinning centers are dominant at low temperatures. The correlated flux pinning is stronger for aligned nanorods; however, the random pinning center becomes weaker in the 4.5 vol% BHO-doped films. Therefore, the optimal BHO doping level is approximately 3.8 vol% in terms of the amplitude of the critical current density and the anisotropy from 4.2 K to 20 K because this provides the best mixture of correlated and random flux pinning centers.
Whole object surface area and volume of partial-view 3D models
International Nuclear Information System (INIS)
Mulukutla, Gopal K; Proussevitch, Alexander A; Genareau, Kimberly D; Durant, Adam J
2017-01-01
Micro-scale 3D models, important components of many studies in science and engineering, are often used to determine morphological characteristics such as shape, surface area and volume. The application of techniques such as stereoscopic scanning electron microscopy on whole objects often results in ‘partial-view’ models with a portion of object not within the field of view thus not captured in the 3D model. The nature and extent of the surface not captured is dependent on the complex interaction of imaging system attributes (e.g. working distance, viewing angle) with object size, shape and morphology. As a result, any simplistic assumptions in estimating whole object surface area or volume can lead to significant errors. In this study, we report on a novel technique to estimate the physical fraction of an object captured in a partial-view 3D model of an otherwise whole object. This allows a more accurate estimate of surface area and volume. Using 3D models, we demonstrate the robustness of this method and the accuracy of surface area and volume estimates relative to true values. (paper)
Ruiz Gómez, Olga Lidia
2016-01-01
En los tefrítidos la búsqueda, localización y aceptación del hospedero, depende generalmente de estímulos químicos que pueden ser identificados por las hembras a la distancia. La emisión de compuestos volátiles del fruto, puede cambiar con la oviposición y modificar la atracción de las hembras. En el presente estudio se evaluó la atracción de hembras grávidas de Toxotrypana curvicauda hacia frutos de papaya sin ovipositar y ovipositados y se identificaron los compuestos volátiles de los fruto...
African Journals Online (AJOL)
Library _info_Sc_ 1
2004-07-11
Jul 11, 2004 ... Samaru Journal of Information Studies Vol. 11 (1 & 2)2011 ... It is therefore paramount that the library ... source of primary and up to date information, both students and ... entertainment, arts, fashion, law, economy, medicine,.
Neuropsychology and neuropharmacology of P3a and P3b.
Polich, John; Criado, José R
2006-05-01
Perspectives on the P300 event-related brain potential (ERP) are reviewed by outlining the distinction between the P3a and P3b subcomponents. The critical factor for eliciting P3a is how target/standard discrimination difficulty rather than novelty modulates task processing. The neural loci of P3a and P3b generation are sketched and a theoretical model is developed. P3a originates from stimulus-driven disruption of frontal attention engagement during task processing. P3b originates when temporal-parietal mechanisms process the stimulus information for memory storage. The neuropharmacological implications of this view are then outlined by evaluating how acute and chronic use of ethanol, marijuana, and nicotine affect P3a and P3b. The findings suggest that the circuit underlying ERP generation is influenced in a different ways for acute intake and varies between chronic use levels across drugs. Theoretical implications are assessed.
International Nuclear Information System (INIS)
1983-01-01
Volume II B contains appendices for: flight line maps; geology maps; explanation of geologic legend; flight line/geology maps; radiometric contour maps; magnetic contour maps; multi-variant analysis maps; and geochemical factor analysis maps
Energy Technology Data Exchange (ETDEWEB)
Horng, Annie [University Hospital LMU Munich, Muenchen (Germany). Radiology; Raya, J. [New York Univ. Medical Center, NY (United States). Center of Biomedical Imaging; Klinikum der Ludwig-Maximilians-Universitaet Muenchen, Grosshadern (Germany). Inst. fuer Klinische Radiologie; Zscharn, M. [Klinikum der Ludwig-Maximilians-Universitaet Muenchen, Grosshadern (DE). Inst. fuer Klinische Radiologie] (and others)
2011-05-15
Purpose: To analyze locoregional deformation patterns indicative of contact areas in patellar cartilage after different loading exercises. Materials and Methods: 7 healthy patellae were examined in-vivo before and immediately after standardized loading (kneeling, squatting or knee bends) and after 90 minutes of rest using a sagittal 3D-T1-w FLASH WE sequence (22 msec/ 9.8msec/ 15 / 0.3 x 0.3 x 1.5 mm{sup 3}) at 3 T. After cartilage segmentation and 3D reconstruction, voxel-based and global precision errors (PR) were calculated. The former were used to determine significant differences in local cartilage thickness. Voxel-based 2{sigma}-thickness difference maps were calculated to visualize locoregional deformation patterns. Global changes in volume (Vol), mean thickness (mTh) and cartilage-bone-interface area (CBIA) were calculated. Results: The voxel-based PR depended on cartilage thickness (D) ranging from 0.12 - 0.35 mm. For D {>=} 1 mm the RF was < 0.31 mm (< voxel size), and for D {>=} 2 mm, the RF was < 0.22 mm. The global PR was 83 mm{sup 3} (2.4 %) for Vol, 0.06 mm (2.0 %) for mTh and 16 mm{sup 2} (1.4 %) for CBIA. The focal cartilage deformation equaled 14 % of the local thickness reduction. The deformation areas were oval and located in the peripheral medial (more vertically oriented, all exercises) and caudo-lateral (more horizontally oriented, kneeling and knee bends) aspects of the patella and were least pronounced in knee bends. Significant changes for Vol/mTh ranged from 2.1 to 3.7 %. Conclusion: This MRI-based study is the first to identify in-vivo voxel-based patellar cartilage deformation patterns indicating contact and loading zones after kneeling and squatting. These zones are anatomically and functionally plausible and may represent areas where stress induced degeneration and subsequent OA can originate. The data may facilitate understanding of individual knee loading properties and help to improve and validate biomechanical models for the knee
A three-dimensional gradient refocused 3D volume imaging of discoid lateral meniscus
International Nuclear Information System (INIS)
Araki, Yutaka; Ootani, Masatoshi; Furukawa, Tomoaki; Yamamoto, Tadatsuka; Tomoda, Kaname; Tsukaguchi, Isao; Mitomo, Masanori.
1991-01-01
An axial 3D volume scan with MRI was applied to the evaluation of discoid lateral meniscus of the knee. By 0.7 mm-thick thin sliced and gapless images with volume scan, characteristically elongated appearance of discoid lateral meniscus was clearly depicted. These MR findings completely accorded with those on arthroscopy. Our conclusion is that an axial 3D volume scan was essential to the diagnosis of discoid lateral meniscus. (author)
African Journals Online (AJOL)
Egyptian Journal of Pediatric Allergy and Immunology (The) - Vol 12, No 1 (2014) ... The effect of serum angiotensin II and angiotensin II type 1 receptor gene ... with diabetic ketoacidosis · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
International Nuclear Information System (INIS)
1995-04-01
This report documents the results of the combined effort of the NRC and the industry produce improved Standard Technical Specifications (STS), Revision 1 for General Electric BWR/4 Plants. The changes reflected in Revision 1 resulted from the experience gained from license amendment applications to convert to these improved ST or to adopt partial improvements to existing technical specifications. This NUREG is the result of extensive public technical meetings and discussions between the Nuclear Regulatory Commission (NRC) staff and various nuclear power plant licensees, Nuclear Steam Supply System (NSSS) Owners Groups, NSSS vendors, and the Nuclear Energy Institute (NEI). The improved STS were developed based on the criteria in the Final Commission Policy Statement on Technical Specifications Improvements for Nuclear Power Reactors, dated July 22, 1993. The improved STS will be used as the basis for individual nuclear power plant licensees to develop improved plant-specific technical specifications. This report contains three volumes. Volume I contains the Specifications for all chapters and sections of the improved STS. This document, Volume 2, contains the Bases for Chapters 2.0 and 3.0, and Sections 3.1-3.3 of the improved STS. Volume 3 contains the Bases for Sections 3.4-3.10 of the improved STS
MILSTAMP: Military Standard Transportation and Movement Procedures. Volume 1
1987-03-15
GUATEMALA AREA: DE3 QUEPOS DB1 SAN JOSE DE4 GOLFITO DB2 PUERTO QUETZAL HONDURAS AREA: EL SALVADOR AREA: DFI SAN LORENZO DC1 LA UNION DF2 FUERZA DC2 LA...DB2 PUERTO QUETZAL DE1 PUNTARENAS DB3 SANTO THOMAS, GUATEMALA DE2 CALDERA DE3 QUEPOS DE4 GOLFITO F21-10 CH 6 DoD 4500.32-R Vol. I HONDURAS AREA: DF2...012 PUERTO QUETZAL DE1 PUNTARENAS DB3 SANTO THOMAS, GUATEMALA DE2 CALDERA DE3 QUEPOS DE4 GOLFITO F21 -10 CH 6 DoD 4500.32-R Vol. I HONDURAS AREA
Scott, A. Donald, Jr.; Kleb, Mary M.; Raper, James L.
2000-01-01
This report provides a compendium of NASA aircraft data that are available from NASA's Global Tropospheric Experiment's (GTE) Pacific Exploratory Mission-Tropics B (PEM-Tropics B) conducted in March and April 1999. PEM-Tropics B was conducted during the southern-tropical wet season when the influence from biomass burning observed in PEM-Tropics A was minimal. Major deployment sites were Hawaii, Kiritimati (Christmas Island), Tahiti, Fiji, and Easter Island. The broad goals of PEM-Tropics B were to improved understanding of the oxidizing power of the atmosphere and the processes controlling sulfur aerosol formation and to establish baseline values for chemical species that are directly coupled to the oxidizing power and aerosol loading of the troposphere. The purpose of this document is to provide a representation of aircraft data that will be available in archived format via NASA Langley's Distributed Active Archive Center (DAAC) or are available through the GTE Project Office archive. The data format is not intended to support original research/analysis, but to assist the reader in identifying data that are of interest.
Coast Guard Proceedings. Volume 69, Number 4 /Volume 70, Number 1. Winter 2012/Spring 2013
2013-01-01
prison. If the willful or knowing violation involved use of a dan- gerous weapon or injury to an officer authorized to enforce the safety zone, the...or injury to any vessel or waterfront facility, safeguard U.S. ports, harbors, territories, or secure the obser- vance of U.S. rights and...Rulemaking: Past, Present, and Future. Duke Law Jour- nal, vol. 55, pp 943. 4. Farzan, R., DiMicco, J.M., and Brownholtz, B. Spreading the honey : a
Results of atmospheric diffusion experiments, vol.3
International Nuclear Information System (INIS)
Kakuta, Michio; Hayashi, Takashi; Adachi, Takashi.
1988-02-01
An extensive study on 'Emergency monitoring and prediction code system' has been carried in JAERI since 1980. Six series of field experiments on atmospheric diffusion were conducted to develop and verify the prediction models for environmental concentration distribution following accidental release of radioactivity. Results of field experiments (Inland complex terrain, surface and elevated point sources) conducted in 15 - 19th October 1984 (TSUKUBA84) and in 6 - 10th November 1985 (TSUKUBA85) are contained in this volume. (author)
1983-01-01
1884c, 1884d, 1885, 1887a, 1887b, 1889a, 1889b, 1889c , 1889d, 1889e, 1890, 1891a, 1891b, 1891c, 1892a, 1892b, 1892c, and 1.895) and publicly...the Effigy Builders. The American Antiquarian and Oriental Journal. Vol. 11: 139-163. 1889c Burial Mounds Viewed as Monuments. The American
Afican Health Sciences Vol 10 No 3.pmd
African Journals Online (AJOL)
Administrator
Antidiabetic and haematinic effects of Parquetina nigrescens on alloxan induced .... after induction of diabetes and continually measured weekly afterwards for ... electric blender/mill grate and was then soaked in. 300 ml of distilled ... The packed cell volume (PCV) ..... the ethanolic extract of Alstonia Boonei (De-Wild) stem.
A Revised Mechanism for the Activation of Complement C3 to C3b
Rodriguez, Elizabeth; Nan, Ruodan; Li, Keying; Gor, Jayesh; Perkins, Stephen J.
2015-01-01
The solution structure of complement C3b is crucial for the understanding of complement activation and regulation. C3b is generated by the removal of C3a from C3. Hydrolysis of the C3 thioester produces C3u, an analog of C3b. C3b cleavage results in C3c and C3d (thioester-containing domain; TED). To resolve functional questions in relation to C3b and C3u, analytical ultracentrifugation and x-ray and neutron scattering studies were used with C3, C3b, C3u, C3c, and C3d, using the wild-type allotype with Arg102. In 50 mm NaCl buffer, atomistic scattering modeling showed that both C3b and C3u adopted a compact structure, similar to the C3b crystal structure in which its TED and macroglobulin 1 (MG1) domains were connected through the Arg102–Glu1032 salt bridge. In physiological 137 mm NaCl, scattering modeling showed that C3b and C3u were both extended in structure, with the TED and MG1 domains now separated by up to 6 nm. The importance of the Arg102–Glu1032 salt bridge was determined using surface plasmon resonance to monitor the binding of wild-type C3d(E1032) and mutant C3d(A1032) to immobilized C3c. The mutant did not bind, whereas the wild-type form did. The high conformational variability of TED in C3b in physiological buffer showed that C3b is more reactive than previously thought. Because the Arg102-Glu1032 salt bridge is essential for the C3b-Factor H complex during the regulatory control of C3b, the known clinical associations of the major C3S (Arg102) and disease-linked C3F (Gly102) allotypes of C3b were experimentally explained for the first time. PMID:25488663
RELAP5/MOD3 code manual. Volume 4, Models and correlations
International Nuclear Information System (INIS)
1995-08-01
The RELAP5 code has been developed for best-estimate transient simulation of light water reactor coolant systems during postulated accidents. The code models the coupled behavior of the reactor coolant system and the core for loss-of-coolant accidents and operational transients such as anticipated transient without scram, loss of offsite power, loss of feedwater, and loss of flow. A generic modeling approach is used that permits simulating a variety of thermal hydraulic systems. Control system and secondary system components are included to permit modeling of plant controls, turbines, condensers, and secondary feedwater systems. RELAP5/MOD3 code documentation is divided into seven volumes: Volume I presents modeling theory and associated numerical schemes; Volume II details instructions for code application and input data preparation; Volume III presents the results of developmental assessment cases that demonstrate and verify the models used in the code; Volume IV discusses in detail RELAP5 models and correlations; Volume V presents guidelines that have evolved over the past several years through the use of the RELAP5 code; Volume VI discusses the numerical scheme used in RELAP5; and Volume VII presents a collection of independent assessment calculations
African Journal of Paediatric Surgery - Vol 3, No 1 (2006)
African Journals Online (AJOL)
Acute Intussusception in childhood: Aspects of epidemiologic, Clinical Features and Management at Children's Hospital, Donka, Guinea Conakry · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M Keita, O T Barry, N Doumbouya, A F Diallo, B M Toure, I Balde, 1-3 ...
International Nuclear Information System (INIS)
Bauer, Ralf W.; Frellesen, Claudia; Schell, Boris; Lehnert, Thomas; Jacobi, Volkmar; Vogl, Thomas J.; Kerl, J.M.; Renker, Matthias; Ackermann, Hanns; Schoepf, U.J.
2011-01-01
To investigate the role of perfusion defect (PD) size on dual energy CT pulmonary blood volume assessment as predictor of right heart strain and patient outcome and its correlation with d-dimer levels in acute pulmonary embolism (PE). 53 patients with acute PE who underwent DECT pulmonary angiography were retrospectively analyzed. Pulmonary PD size caused by PE was measured on DE iodine maps and quantified absolutely (VolPD) and relatively to the total lung volume (RelPD). Signs of right heart strain (RHS) on CT were determined. Information on d-dimer levels and readmission for recurrent onset of PE and death was collected. D-dimer level was mildly (r = 0.43-0.47) correlated with PD size. Patients with RHS had significantly higher VolPD (215 vs. 73 ml) and RelPD (9.9 vs. 2.9%) than patients without RHS (p 5% RelPD, while no such events were found for patients with <5% RelPD. Pulmonary blood volume on DECT in acute PE correlates with RHS and appears to be a predictor of patient outcome in this pilot study. (orig.)
The superfamily of C3b/C4b-binding proteins
DEFF Research Database (Denmark)
Kristensen, Torsten; D'Eustachio, P; Ogata, R T
1987-01-01
The determination of primary structures by amino acid and nucleotide sequencing for the C3b-and/or C4b-binding proteins H, C4BP, CR1, B, and C2 has revealed the presence of a common structural element. This element is approximately 60 amino acids long and is repeated in a tandem fashion, commencing...... at the amino-terminal end of each molecule. Two other complement components, C1r and C1s, have two of these repeating units in the carboxy-terminal region of their noncatalytic A chains. Three noncomplement proteins, beta 2-glycoprotein I (beta 2I), the interleukin 2 receptor (IL 2 receptor), and the b chain...... of factor XIII, have 4, 2 and 10 of these repeating units, respectively. These proteins obviously belong to the above family, although there is no evidence that they interact with C3b and/or C4b. Human haptoglobin and rat leukocyte common antigen also contain two and three repeating units, respectively...
International Nuclear Information System (INIS)
1968-01-01
Proceedings of a Symposium organized by the IAEA and held in Karlsruhe, 30 October - 3 November 1967. The meeting was attended by 183 scientists from 23 countries and three international organizations. Contents: (Vol.1) Review of national programmes (5 papers); Nuclear data for fast reactors (12 papers); Experimental methods (3 papers); Zoned systems (7 papers); Kinetics (7 papers). (Vol.11) Fast critical experiments (8 papers); Heterogeneity in fast critical experiments (5 papers); Fast power reactors (13 papers); Fast pulsed reactors (3 papers); Panel discussion. Each paper is in its original language (50 English, 11 French and 3 Russian) and is preceded by an abstract in English with a second one in the original language if this is not English. Discussions are in English. (author)
Schwartz, Robert
2012-01-01
This issue of ETS Policy Notes (Vol. 20, No. 3) provides highlights from the Salzburg Global Seminar in December 2011. The seminar focused on bettering the educational and life prospects of students up to age 18 worldwide. [This article was written with the assistance of Beth Brody.
International Nuclear Information System (INIS)
Hanaguri, Katsuro; Kimura, Hideaki; Kayashima, Yasuyo; Suemoto, Kouichiro; Makihata, Hiroshi; Maruhashi, Akira; Ohya, Toshihide; Ito, Katsuhide; Shen, Yun.
1997-01-01
As a new application of helical (spiral) scan, volume measurement has received a significant interest. Although it is important to evaluate gallbladder contractibility to decide on a treatment plan for a gallbladder lesion, qualitative analysis of gallbladder contractibility is very difficult owing to the fact that the volume of gallbladder can not be measured using usual DIC examination (plain X-P and tomography). In this study, the accuracy of volume measurement of helical CT was checked firstly by gallbladder phantom experiments. Then 128 cases of volume measurement of helical 3D CT Cholangiography (DIC-CT) were performed. Under the conditions of optimized scan technique (3 mm TH, 3 mm/s, 1 mm recon interval, Hispeed, GEMS), the difference of contractibility was obtained between clinical cases with and without thick wall. The experiment has shown that helical 3D CT volume measurement is very simple and highly accurate method which is useful for the evaluation of gallbladder contractibility. (author)
From micro-scale 3D simulations to macro-scale model of periodic porous media
Crevacore, Eleonora; Tosco, Tiziana; Marchisio, Daniele; Sethi, Rajandrea; Messina, Francesca
2015-04-01
In environmental engineering, the transport of colloidal suspensions in porous media is studied to understand the fate of potentially harmful nano-particles and to design new remediation technologies. In this perspective, averaging techniques applied to micro-scale numerical simulations are a powerful tool to extrapolate accurate macro-scale models. Choosing two simplified packing configurations of soil grains and starting from a single elementary cell (module), it is possible to take advantage of the periodicity of the structures to reduce the computation costs of full 3D simulations. Steady-state flow simulations for incompressible fluid in laminar regime are implemented. Transport simulations are based on the pore-scale advection-diffusion equation, that can be enriched introducing also the Stokes velocity (to consider the gravity effect) and the interception mechanism. Simulations are carried on a domain composed of several elementary modules, that serve as control volumes in a finite volume method for the macro-scale method. The periodicity of the medium involves the periodicity of the flow field and this will be of great importance during the up-scaling procedure, allowing relevant simplifications. Micro-scale numerical data are treated in order to compute the mean concentration (volume and area averages) and fluxes on each module. The simulation results are used to compare the micro-scale averaged equation to the integral form of the macroscopic one, making a distinction between those terms that could be computed exactly and those for which a closure in needed. Of particular interest it is the investigation of the origin of macro-scale terms such as the dispersion and tortuosity, trying to describe them with micro-scale known quantities. Traditionally, to study the colloidal transport many simplifications are introduced, such those concerning ultra-simplified geometry that usually account for a single collector. Gradual removal of such hypothesis leads to a
African Journal of Infectious Diseases - Vol 3, No 1 (2009)
African Journals Online (AJOL)
Hand hygiene and health: an epidemiological study of students in Amravati · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D.H Tambekar, S.D Shirsa, S.R Kakde, K.B Ambekar. http://dx.doi.org/10.4314/ajid.v3i1.55076 ...
West African Journal of Medicine - Vol 23, No 3 (2004)
African Journals Online (AJOL)
Circulating immune complexes, immunoglobulin classes (IgG, IgA and IgM) and complement components (C3c, C4 and Factor B) in diabetic Nigerians. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KS Akinlade, OG Arinola, LS Salimonu, GO Oyeyinka, 253-255.
International Nuclear Information System (INIS)
Ma, C; Yin, Y
2015-01-01
Purpose: A method using four-dimensional(4D) PET/CT in design of radiation treatment planning was proposed and the target volume and radiation dose distribution changes relative to standard three-dimensional (3D) PET/CT were examined. Methods: A target deformable registration method was used by which the whole patient’s respiration process was considered and the effect of respiration motion was minimized when designing radiotherapy planning. The gross tumor volume of a non-small-cell lung cancer was contoured on the 4D FDG-PET/CT and 3D PET/CT scans by use of two different techniques: manual contouring by an experienced radiation oncologist using a predetermined protocol; another technique using a constant threshold of standardized uptake value (SUV) greater than 2.5. The target volume and radiotherapy dose distribution between VOL3D and VOL4D were analyzed. Results: For all phases, the average automatic and manually GTV volume was 18.61 cm3 (range, 16.39–22.03 cm3) and 31.29 cm3 (range, 30.11–35.55 cm3), respectively. The automatic and manually volume of merged IGTV were 27.82 cm3 and 49.37 cm3, respectively. For the manual contour, compared to 3D plan the mean dose for the left, right, and total lung of 4D plan have an average decrease 21.55%, 15.17% and 15.86%, respectively. The maximum dose of spinal cord has an average decrease 2.35%. For the automatic contour, the mean dose for the left, right, and total lung have an average decrease 23.48%, 16.84% and 17.44%, respectively. The maximum dose of spinal cord has an average decrease 1.68%. Conclusion: In comparison to 3D PET/CT, 4D PET/CT may better define the extent of moving tumors and reduce the contouring tumor volume thereby optimize radiation treatment planning for lung tumors
Energy Technology Data Exchange (ETDEWEB)
Ma, C; Yin, Y [Shandong Tumor Hospital, Jinan, Shandong Provice (China)
2015-06-15
Purpose: A method using four-dimensional(4D) PET/CT in design of radiation treatment planning was proposed and the target volume and radiation dose distribution changes relative to standard three-dimensional (3D) PET/CT were examined. Methods: A target deformable registration method was used by which the whole patient’s respiration process was considered and the effect of respiration motion was minimized when designing radiotherapy planning. The gross tumor volume of a non-small-cell lung cancer was contoured on the 4D FDG-PET/CT and 3D PET/CT scans by use of two different techniques: manual contouring by an experienced radiation oncologist using a predetermined protocol; another technique using a constant threshold of standardized uptake value (SUV) greater than 2.5. The target volume and radiotherapy dose distribution between VOL3D and VOL4D were analyzed. Results: For all phases, the average automatic and manually GTV volume was 18.61 cm3 (range, 16.39–22.03 cm3) and 31.29 cm3 (range, 30.11–35.55 cm3), respectively. The automatic and manually volume of merged IGTV were 27.82 cm3 and 49.37 cm3, respectively. For the manual contour, compared to 3D plan the mean dose for the left, right, and total lung of 4D plan have an average decrease 21.55%, 15.17% and 15.86%, respectively. The maximum dose of spinal cord has an average decrease 2.35%. For the automatic contour, the mean dose for the left, right, and total lung have an average decrease 23.48%, 16.84% and 17.44%, respectively. The maximum dose of spinal cord has an average decrease 1.68%. Conclusion: In comparison to 3D PET/CT, 4D PET/CT may better define the extent of moving tumors and reduce the contouring tumor volume thereby optimize radiation treatment planning for lung tumors.
International Nuclear Information System (INIS)
Bourourou, Y.; Beldi, L.; Bentria, B.; Gueddouh, A.; Bouhafs, B.
2014-01-01
In this paper, spin-polarization and pressure effects on the structural and electronic properties of the 3d transition-metal mono-borides TM–B (TM=Mn, Fe, Co) have been studied by using both local spin-density approximation (LSDA) and generalized gradient approximation (GGA) within the framework of density-functional theory (DFT). At equilibrium, spin-polarization calculations show that MnB and FeB compounds carry magnetic moment. The non-spin-polarization results show that the non-magnetic state is unstable for MnB and FeB compounds, but a stable non-magnetic phase for CoB compound, which is discussed in the framework of the well-known Stoner criterion. The calculated lattice parameters, bulk moduli, their first-pressure derivatives and magnetic moments agree well with experimental and other theoretical results. Significant differences in volume and in bulk modulus were found between the magnetic and non-magnetic case reached 4%, 22%, respectively. The effect of pressure on the crystal structure reflects in a compression of the unit cell volume with a decreasing in the magnetic moment. The density of states of MnB and FeB ferromagnetic compounds are significantly modified under high pressures. The exchange energy decreases with increasing pressure, at approximately V/V 0 =0.6, the exchange energy becomes absent in ferromagnetic compounds causes mirror in upper and lowers half panels. Finally, we notice that spin-polarization and pressure play a crucially important role in determining the electronic and structural properties of 3d transition-metal mono-borides. - Highlights: • Spin polarization and pressure effects on TM–B (TM=Mn, Fe, Co) have been investigated. • The non-spin-polarization results show that the non-magnetic state is stable for CoB. • The magnetic states of MnB and FeB are found more stable than their nonmagnetic states. • We report significant differences between the magnetic and non-magnetic cases. • The density of states of MnB and
International Nuclear Information System (INIS)
Ma, Brigette; King, Ann; Lo, Y.M. Dennis; Yau, Y.Y.; Zee, Benny; Hui, Edwin P.; Leung, Sing F.; Mo, Frankie; Kam, Michael K.; Ahuja, Anil; Kwan, Wing H.; Chan, Anthony
2006-01-01
Purpose: Plasma Epstein-Barr virus DNA (pEBV DNA) is an important prognostic marker in nasopharyngeal carcinoma (NPC). This study tested the hypotheses that pEBV DNA reflects tumor burden and metabolic activity by evaluating its relationship with tumor volume and 18 F-fluorodeoxyglucose ( 18 F-FDG) uptake in NPC. Methods and Materials: Pre-treatment pEBV DNA analysis, 18 F-FDG positron emission tomography-computed tomography scan (PET-CT) and magnetic resonance imaging (MRI) of the head and neck were performed in 57 patients. Net volume (cm 3 ) of the primary tumor (T vol ) and regional nodes (N vol ) were quantified on MRI. 18 F-FDG uptake was expressed as the maximum standardized uptake value (SUV max ) at the primary tumor (T suv ) and regional nodes (N suv ). Lesions with SUV max ≥ 2.5 were considered malignant. Relationship between SUV max , natural logarithm (log) of pEBV DNA, and square root (sq) of MRI volumes was analyzed using the Wilcoxon test. A linear regression model was constructed to test for any interaction between variables and disease stage. Results: Log-pEBV DNA showed significant correlation with sq-T vol (r = 0.393), sq-N vol (r = 0.452), total tumor volume (sq-Total vol = T vol + N vol , r = 0.554), T suv (r = 0.276), N suv (r = 0.434), and total SUV max (Total suv = T suv + N suv , r = 0.457). Likewise, sq-T vol was correlated to T suv (r 0.426), and sq-N vol with N suv (r = 0.651). Regression analysis showed that only log-pEBV DNA was significantly associated with sq-Total vol (p vol was significantly associated with T suv (p = 0.002; parameter estimate = 3.923; 95% confidence interval = 1.498-6.348). Conclusion: This study supports the hypothesis that cell-free plasma EBV DNA is a marker of tumor burden in EBV-related NPC
Density of Na2O-Li2O-SiO2-B2O3 Molten Slag at 1 803-1 873 K
Institute of Scientific and Technical Information of China (English)
XIAO Feng; FANG Liang
2004-01-01
The density of three kinds of molten slags was measured by modified sessile drop method at 1 803-1 873 K. The density of molten slag is found to decrease with increasing temperature. The temperature coefficients of Na2O-Li2O-SiO2 and Li2O-SiO2-B2O3 slag are smaller than that of Na2O-B2O3 slag. The molar volume of slags increases with increasing temperature.
Vitrification and some physical and chemical properties of glass in the BaO-B2O3-GeO2 system
International Nuclear Information System (INIS)
Dzhavadyan, V.G.; Kostanyan, K.A.
1977-01-01
The results are presented of the determination of the areas of glass-transition in RO-B 2 O-GeO 2 systems (where R=Mg, Ca, Sr, Ba) and of the study of the density, the refraction index and the coefficient of linear thermal expansion of glasses of the BaO-B 2 O 3 -GeO 2 system as a function of the composition. It is shown that the substitution of the glass forming agent in the borogermanate component by BaO leads to a non-linear growth of the density. A negative deviation is observed of the experimental variation of the molar volume from the ideal and the positive deviation of the refraction indices from the ideal values. A content of 30 % and over of BaO brings about a sharp increase in the value of the coefficient of linear thermal expansion. Changes of the m lar volume, refraction index and coefficient of linear thermal expansion of glasses as a function of their compositions is due to the variation of the coordination number of boron on charge of the BaO/B 2 O 3 ratio
1991-01-01
FILES FOR COMPOUNDS OF POTENTIAL CONCERN Vol. 7 APPENDIX 0 - HUMAN HEALTH RISK CALCULATIONS Vol. 7 APPENDIX P - INVENTORY OF SITE SPECIES Vol. 7...Driing Mud 0" 0 3 am 01 99 5 .Annula space seal:- GnmuldBsuryoni 0 33 Lbs/gal mud weight ... Benuar-siid shiny 3 33 16. Driling addives used 13 yesLbs...CONSTRUCTION REPORT / 5 WISCONSIN STATE BOARD OF HEALTH WELL DRILLING DIVISION JUL 11 |W Note: Section 32 of the Wisconsin Well Drilling Sanitary Code
Energy Technology Data Exchange (ETDEWEB)
Cottrell, W.B.; Klein, A.
1978-04-11
This index to Nuclear Safety covers articles published in Nuclear Safety, Vol. 11, No. 1 (January-February 1970), through Vol. 18, No. 6 (November-December 1977). It is divided into three sections: a chronological list of articles (including abstracts) followed by a permuted-title (KWIC) index and an author index. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center (NSIC), covers all safety aspects of nuclear power reactors and associated facilities. Over 450 technical articles published in Nuclear Safety in the last eight years are listed in this index.
International Nuclear Information System (INIS)
Cottrell, W.B.; Klein, A.
1978-01-01
This index to Nuclear Safety covers articles published in Nuclear Safety, Vol. 11, No. 1 (January-February 1970), through Vol. 18, No. 6 (November-December 1977). It is divided into three sections: a chronological list of articles (including abstracts) followed by a permuted-title (KWIC) index and an author index. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center (NSIC), covers all safety aspects of nuclear power reactors and associated facilities. Over 450 technical articles published in Nuclear Safety in the last eight years are listed in this index
Ethiopian Journal of Health Sciences - Vol 28, No 2 (2018)
African Journals Online (AJOL)
Ethiopian Journal of Health Sciences - Vol 28, No 2 (2018). Journal Home > Archives > Vol 28, No 2 (2018). Log in or Register to get access to full text downloads. ... Prevalence of opportunistic intestinal parasites and associated factors among HIV patients while receiving ART at Arba Minch Hospital in southern Ethiopia: a ...
Thermodynamic study of the A-B phase transition in superfluid 3He: Phase diagram and consequences
International Nuclear Information System (INIS)
Hahn, I.
1993-01-01
The authors have measured the A-B phase transition temperature of superfluid 3 He at pressures from zero to 29 bars, and in all magnetic fields up to the high field limit of the B phase (0.59 Tesla). This work is the first precision measurement of the A-B phase transition over the entire phase diagram (P, T, B). Measurements at low magnetic fields can be related to microscopic interactions in liquid 3 He. The results show that all current microscopic models of normal liquid 3 He are incomplete. Also, the results suggest the possibility that the conventional identification of the order parameter of superfluid 3 He-A is incorrect. The measurements at high magnetic fields can be related through thermodynamic identities to quantities which are immeasurable directly, such as the molar volume changes at the A-B phase transition, and the specific heat of the A-phase of superfluid 3 He in the limit T → 0. The authors detect the phase transition by monitoring the attenuation of zero around traversing a 4-mm path in the superfluid. Because thermometry is so crucial to the success of the measurements, the authors elected to use two independent thermometers. The authors use a pulsed NMR measurement of the susceptibility of Pt nuclei, which varies as 1/T, to guarantee linearity of the temperature scale. In order to achieve the high resolution required by the experiment, the authors also use an LCMN thermometer driven by a unique digital bridge which the authors constructed
Big Area Additive Manufacturing of High Performance Bonded NdFeB Magnets
Li, Ling; Tirado, Angelica; Nlebedim, I. C.; Rios, Orlando; Post, Brian; Kunc, Vlastimil; Lowden, R. R.; Lara-Curzio, Edgar; Fredette, Robert; Ormerod, John; Lograsso, Thomas A.; Paranthaman, M. Parans
2016-10-01
Additive manufacturing allows for the production of complex parts with minimum material waste, offering an effective technique for fabricating permanent magnets which frequently involve critical rare earth elements. In this report, we demonstrate a novel method - Big Area Additive Manufacturing (BAAM) - to fabricate isotropic near-net-shape NdFeB bonded magnets with magnetic and mechanical properties comparable or better than those of traditional injection molded magnets. The starting polymer magnet composite pellets consist of 65 vol% isotropic NdFeB powder and 35 vol% polyamide (Nylon-12). The density of the final BAAM magnet product reached 4.8 g/cm3, and the room temperature magnetic properties are: intrinsic coercivity Hci = 688.4 kA/m, remanence Br = 0.51 T, and energy product (BH)max = 43.49 kJ/m3 (5.47 MGOe). In addition, tensile tests performed on four dog-bone shaped specimens yielded an average ultimate tensile strength of 6.60 MPa and an average failure strain of 4.18%. Scanning electron microscopy images of the fracture surfaces indicate that the failure is primarily related to the debonding of the magnetic particles from the polymer binder. The present method significantly simplifies manufacturing of near-net-shape bonded magnets, enables efficient use of rare earth elements thus contributing towards enriching the supply of critical materials.
FMDP Reactor Alternative Summary Report: Volume 3 - partially complete LWR alternative
International Nuclear Information System (INIS)
Greene, S.R.; Fisher, S.E.; Bevard, B.B.
1996-09-01
The Department of Energy Office of Fissile Materials Disposition (DOE/MD) initiated a detailed analysis activity to evaluate each of ten plutonium disposition alternatives that survived an initial screening process. This document, Volume 3 of a four volume report summarizes the results of these analyses for the partially complete LWR (PCLWR) reactor based plutonium disposition alternative
FMDP Reactor Alternative Summary Report: Volume 3 - partially complete LWR alternative
Energy Technology Data Exchange (ETDEWEB)
Greene, S.R.; Fisher, S.E.; Bevard, B.B. [and others
1996-09-01
The Department of Energy Office of Fissile Materials Disposition (DOE/MD) initiated a detailed analysis activity to evaluate each of ten plutonium disposition alternatives that survived an initial screening process. This document, Volume 3 of a four volume report summarizes the results of these analyses for the partially complete LWR (PCLWR) reactor based plutonium disposition alternative.
International Nuclear Information System (INIS)
Vieira, Marcelo Luiz Campos; Nomura, Cesar H.; Tranchesi Junior, Bernardino; Oliveira, Wercules A. de; Naccarato, Gustavo; Serpa, Bruna S.; Passos, Rodrigo B.D.; Funari, Marcelo B. G.; Fischer, Claudio H.; Morhy, Samira S.
2009-01-01
Background: Real-time three-dimensional echocardiography (RT-3D-Echo) and ultrafast computed tomography (CT) are two novel methods for the analysis of LV ejection fraction and volumes. Objective: To compare LVEF and volume measurements as obtained using RT-3D-Echo and ultrafast CT. Methods: Thirty nine consecutive patients (27 men, mean age of 57+- 12 years) were studied using RT-3D-Echo and 64-slice ultrafast CT. LVEF and LV volumes were analyzed. Statistical analysis: coefficient of correlation (r: Pearson), Bland-Altman analysis, linear regression analysis, 95% CI, p 5 .58)%; end-diastolic volume ranged from 49.6 to 178.2 (87+-27.8) ml; end-systolic volume ranged from 11.4 to 78 (33.1+-13.6) ml. CT scan measurements: LVEF ranged from 53 to 86% (67.8+-7.78); end-diastolic volume ranged from 51 to 186 (106.5+-30.3) ml; end-systolic volume ranged from 7 to 72 (35.5+-13.4)ml. Correlations between RT-3D-Echo and CT were: LVEF (r: 0.7888, p<0.0001, 95% CI 0.6301 to 0.8843); end-diastolic volume (r: 0.7695, p<0.0001, 95% CI 0.5995 to 0.8730); end-systolic volume (r: 0.8119, p<0.0001, 95% CI 0.6673 to 0.8975). Conclusion: Good correlation between LVEF and ventricular volume parameters as measured by RT-3D-Echo and 64-slice ultrafast CT was found in the present case series. (author)
African Journals Online (AJOL)
Items 51 - 100 of 102 ... Vol 3, No 1 (2006), Hybrid fiber reinforced self-compacting concrete: fiber synergy at low fber volume fraction, Abstract ... Vol 1, No 2 (2004), Optimising of Steel Fiber Reinforced Concrete Mix Design, Abstract ... Vol 4, No 2 (2007), Performance of Crushed Coconut Shell Dual Media Filter, Abstract.
Clinical Utility of 4D FDG-PET/CT Scans in Radiation Treatment Planning
Energy Technology Data Exchange (ETDEWEB)
Aristophanous, Michalis, E-mail: maristophanous@lroc.harvard.edu [Department of Radiation Oncology, Dana-Farber/Brigham and Women' s Cancer Center and Harvard Medical School, Boston, MA (United States); Berbeco, Ross I.; Killoran, Joseph H. [Department of Radiation Oncology, Dana-Farber/Brigham and Women' s Cancer Center and Harvard Medical School, Boston, MA (United States); Yap, Jeffrey T. [Department of Radiology, Dana-Farber Cancer Institute and Harvard Medical School, Boston, MA (United States); Sher, David J.; Allen, Aaron M.; Larson, Elysia; Chen, Aileen B. [Department of Radiation Oncology, Dana-Farber/Brigham and Women' s Cancer Center and Harvard Medical School, Boston, MA (United States)
2012-01-01
Purpose: The potential role of four-dimensional (4D) positron emission tomography (PET)/computed tomography (CT) in radiation treatment planning, relative to standard three-dimensional (3D) PET/CT, was examined. Methods and Materials: Ten patients with non-small-cell lung cancer had sequential 3D and 4D [{sup 18}F]fluorodeoxyglucose PET/CT scans in the treatment position prior to radiation therapy. The gross tumor volume and involved lymph nodes were contoured on the PET scan by use of three different techniques: manual contouring by an experienced radiation oncologist using a predetermined protocol; a technique with a constant threshold of standardized uptake value (SUV) greater than 2.5; and an automatic segmentation technique. For each technique, the tumor volume was defined on the 3D scan (VOL3D) and on the 4D scan (VOL4D) by combining the volume defined on each of the five breathing phases individually. The range of tumor motion and the location of each lesion were also recorded, and their influence on the differences observed between VOL3D and VOL4D was investigated. Results: We identified and analyzed 22 distinct lesions, including 9 primary tumors and 13 mediastinal lymph nodes. Mean VOL4D was larger than mean VOL3D with all three techniques, and the difference was statistically significant (p < 0.01). The range of tumor motion and the location of the tumor affected the magnitude of the difference. For one case, all three tumor definition techniques identified volume of moderate uptake of approximately 1 mL in the hilar region on the 4D scan (SUV maximum, 3.3) but not on the 3D scan (SUV maximum, 2.3). Conclusions: In comparison to 3D PET, 4D PET may better define the full physiologic extent of moving tumors and improve radiation treatment planning for lung tumors. In addition, reduction of blurring from free-breathing images may reveal additional information regarding regional disease.
DNA (cytosine-5-methyltransferase 3B (DNMT 3B polymorphism and risk of Down syndrome offspring
Directory of Open Access Journals (Sweden)
Cláudia Melo de Moura
2018-01-01
Full Text Available Down syndrome (DS is the most common form of human genetic mental retardation. Several polymorphisms in genes coding folic acid cycle enzymes have been associated to the risk of bearing a DS child; however, the results are controversial. S-adenosyl-l-methionine (SAM is an important intermediate of folic acid pathway and acts as methyl donor and substrate for DNA (cytosine-5-methyltransferase 3B (DNMT3B – EC 2.1.1.37 de novo methylation processes during embryogenesis. Recent studies suggest that a functional polymorphism of DNMT 3B in maternal genotype may be associated with a decreased risk of having a DS child. We herein investigate the association of this polymorphism with the occurrence of DS in a Brazilian population. We have genotyped 111 mothers of DS infants (MDS and 212 control mothers (CM through PCR-RFLP. The observed genotypic frequencies were CC = 0.22; CT = 0.49 and TT = 0.29 in CM, and CC = 0.30; CT = 0.52 and TT = 0.18 in MDS. Allelic frequencies were C = 0.47 and T = 0.53 in CM and C = 0.56 and T = 0.44 in MDS. No deviation of HWE was observed, and both DNMT 3B rs2424913 genotype (χ2 = 4.53; DF = 1; P = 0.03 and allelic (χ2 = 4.90; DF = 1; P = 0.03 frequencies show significant differences between MDS and CM. The presence of the mutant DNMT 3B T allele decreases 30% the risk of bearing a DS child (OR = 0.69; 95% CI: 0.50–0.96; P = 0.03, and the risk is diminished up to 45% in association with the homozygous genotype (OR = 0.54; 95% CI: 0.31–0.96; P = 0.04. Our results suggest that women harboring the single nucleotide polymorphism DNMT 3B rs2424913 have a decreased risk of a DS pregnancy, and further studies are necessary to confirm this protective effect.
Foothills Parkway Section 8B Final Environmental Report, Volume 2, Appendices A-C
Energy Technology Data Exchange (ETDEWEB)
Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.
1999-07-01
In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NW, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this EN there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constricting Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER, which consists of Appendices A, B, and C, assesses the potential geologic impacts of the proposed Section 8B construction, presents the results of the Section 8B soil survey, and describes the water quality studies and analyses performed for the ER. The following summary sections provide information for geology, soils, and water quality.
Microstructure of Fe-Cr-C hardfacing alloys with additions of Nb, Ti and, B
International Nuclear Information System (INIS)
Berns, H.; Fischer, A.
1987-01-01
The abrasive wear of machine parts and tools used in the mining, earth moving, and transporting of mineral materials can be lowered by filler wire welding of hardfacing alloys. In this paper, the microstructures of Fe-Cr-C and Fe-Cr-C-Nb/Ti hardfacing alloys and deposits and those of newly developed Fe-Cr-C-B and Fe-Ti-Cr-C-B ones are described. They show up to 85 vol.% of primarily solidified coarse hard phases; i.e., Carbides of MC-, M/sub 7/C/sub 3/-, M/sub 3/C-type and Borides of MB/sub 2/-, M/sub 3/B/sub 2/-, M/sub 2/B-, M/sub 3/B-, M/sub 23/B/sub 6/-type, which are embedded in a hard eutectic. This itself consists of eutectic hard phases and a martensitic or austenitic metal matrix. The newly developed Fe-Cr-C-B alloys reach hardness values of up to 1200 HV and are harder than all purchased ones. The primary solidification of the MB/sub 2/-type phase of titanium requires such high amounts of titanium and boron that these alloys are not practical for manufacture as commercial filler wires
WARM SPITZER PHOTOMETRY OF THREE HOT JUPITERS: HAT-P-3b, HAT-P-4b AND HAT-P-12b
Energy Technology Data Exchange (ETDEWEB)
Todorov, Kamen O. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Department of Astronomy, University of Maryland at College Park, College Park, MD 20742 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Lewis, Nikole K. [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel [Astronomy Department, California Institute of Technology, Pasadena, CA 91125 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)
2013-06-20
We present Warm Spitzer/IRAC secondary eclipse time series photometry of three short-period transiting exoplanets, HAT-P-3b, HAT-P-4b and HAT-P-12b, in both the available 3.6 and 4.5 {mu}m bands. HAT-P-3b and HAT-P-4b are Jupiter-mass objects orbiting an early K and an early G dwarf star, respectively. For HAT-P-3b we find eclipse depths of 0.112%+0.015%-0.030% (3.6 micron) and 0.094%+0.016%-0.009% (4.5 {mu}m). The HAT-P-4b values are 0.142%+0.014%-0.016% (3.6 micron) and 0.122%+0.012%-0.014% 4.5 {mu}m). The two planets' photometry is consistent with inefficient heat redistribution from their day to night sides (and low albedos), but it is inconclusive about possible temperature inversions in their atmospheres. HAT-P-12b is a Saturn-mass planet and is one of the coolest planets ever observed during secondary eclipse, along with the hot Neptune GJ 436b and the hot Saturn WASP-29b. We are able to place 3{sigma} upper limits on the secondary eclipse depth of HAT-P-12b in both wavelengths: <0.042% (3.6 {mu}m) and <0.085% (4.5 {mu}m). We discuss these results in the context of the Spitzer secondary eclipse measurements of GJ 436b and WASP-29b. It is possible that we do not detect the eclipses of HAT-P-12b due to high eccentricity, but find that weak planetary emission in these wavelengths is a more likely explanation. We place 3{sigma} upper limits on the |e cos {omega}| quantity (where e is eccentricity and {omega} is the argument of periapsis) for HAT-P-3b (<0.0081) and HAT-P-4b (<0.0042), based on the secondary eclipse timings.
Synthesis behavior of nanocrystalline Al-Al2O3 composite during low time mechanical milling process
International Nuclear Information System (INIS)
Alizadeh, Mostafa; Aliabadi, Morteza Mirzaei
2011-01-01
Research highlights: → In the low time milling the effect of Al 2 O 3 amount is investigated → Al 2 O 3 particles are distributed uniformly in the Al matrix → In the low time milling it is possible to produce nanostructured composite powder → Median size and bulk density measurements demonstrate reaching the steady state. - Abstract: In this work, four different volume fractions of Al 2 O 3 (10, 20, 30 and 40 vol.%) were mixed with the fine Al powder and the powder blends were milled for 5 h. Scanning electron microscopy analysis, particle size analysis and bulk density measurements were used to investigate the morphological changes and achieving the steady state conditions. The results showed that increasing the Al 2 O 3 content can provide the steady state particle size in 5 h milling process. It was found that increasing the volume fraction of Al 2 O 3 leads to increasing the uniformity of Al 2 O 3 . Standard deviations of microhardness measurements confirmed this result. The XRD pattern and XRF investigations depicted that increasing the Al 2 O 3 content causes an increase in the crystal defects, micro-strain and Fe contamination during 5 h milling process of nanocrystalline composite powders while the grain size is decreased. To investigate the effect of milling time, Al-30 vol.% Al 2 O 3 (which achieved steady state during 5 h milling process) was milled for 1-4 h. The results depicted that the milling time lower than 5 h, do not achieve to steady state conditions.
ECAJS 2009 VOL 14 No 1 FINAL EDIT doc
African Journals Online (AJOL)
user
, PR 65b/m regular and good volume, 1 st and 2 nd heart sounds-Normal. Respiratory system: RR 20b/min, symmetrical .... surgery have not wavered from the original T. David reimplantation concept. Given David's personal results out to 5-10 ...
Handbook of the Economics of Education. Volume 3
Hanushek, Eric A., Ed.; Machin, Stephen J., Ed.; Woessmann, Ludger, Ed.
2011-01-01
How does education affect economic and social outcomes, and how can it inform public policy? Volume 3 of the Handbooks in the Economics of Education uses newly available high quality data from around the world to address these and other core questions. With the help of new methodological approaches, contributors cover econometric methods and…
Sonographic measurement of thyroid gland volume: A comparison of 2D and 3D ultrasound
Energy Technology Data Exchange (ETDEWEB)
Ying, Michael [Department of Optometry and Radiography, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China)]. E-mail: ormying@polyu.edu.hk; Sin Manhong [Department of Optometry and Radiography, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China); Pang, Shuk-fan [Department of Optometry and Radiography, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China)
2005-11-01
Aims: This study was undertaken to investigate the inter-observer reproducibility of 2D and 3D ultrasound in the measurement of thyroid gland volume. The symmetry of thyroid lobes in healthy subjects was also investigated. Materials and methods: The volume of the left and right lobes of the thyroid gland was measured in 20 healthy subjects (10 men and 10 women) using 2D and 3D ultrasound. On 2D ultrasound, the thyroid lobe volume was calculated by ellipsoid equation (volume = {pi}/6 x craniocaudal x mediolateral x anteroposterior dimensions), whereas 3D ultrasound volumetric measurements were performed with a 3D add-on system. In each subject, the thyroid gland was scanned by two operators to investigate inter-observer variability. Results: There was a moderate agreement between 2D and 3D ultrasound in the measurement of thyroid volume (r = 0.77). 3D ultrasound (90%) had a higher inter-observer reproducibility than 2D ultrasound (85%) in the measurements. About 74% of healthy subjects had the right thyroid lobe larger than the left lobe. Conclusion: 3D ultrasound is useful in the measurement of thyroid volume with a higher reproducibility than 2D ultrasound. Asymmetry of thyroid lobes was noted in healthy subjects.
Sonographic measurement of thyroid gland volume: A comparison of 2D and 3D ultrasound
International Nuclear Information System (INIS)
Ying, Michael; Sin Manhong; Pang, Shuk-fan
2005-01-01
Aims: This study was undertaken to investigate the inter-observer reproducibility of 2D and 3D ultrasound in the measurement of thyroid gland volume. The symmetry of thyroid lobes in healthy subjects was also investigated. Materials and methods: The volume of the left and right lobes of the thyroid gland was measured in 20 healthy subjects (10 men and 10 women) using 2D and 3D ultrasound. On 2D ultrasound, the thyroid lobe volume was calculated by ellipsoid equation (volume = π/6 x craniocaudal x mediolateral x anteroposterior dimensions), whereas 3D ultrasound volumetric measurements were performed with a 3D add-on system. In each subject, the thyroid gland was scanned by two operators to investigate inter-observer variability. Results: There was a moderate agreement between 2D and 3D ultrasound in the measurement of thyroid volume (r = 0.77). 3D ultrasound (90%) had a higher inter-observer reproducibility than 2D ultrasound (85%) in the measurements. About 74% of healthy subjects had the right thyroid lobe larger than the left lobe. Conclusion: 3D ultrasound is useful in the measurement of thyroid volume with a higher reproducibility than 2D ultrasound. Asymmetry of thyroid lobes was noted in healthy subjects
Micro-heterogeneities in R2O-RO-B2O3
International Nuclear Information System (INIS)
Kawazoe, H.; Kokumai, H.; Hosono, H.; Kanazawa, T.
1980-01-01
ESR of incorporated Cu 2+ was used in the detection of micro-inhomogeneity in xR 2 O x yMgO x (100-x-y)B 2 O 3 glasses. The inhomogeneous region determined by ESR was found to be far wider than that obtained by opalescence. It was concluded that in the glasses of x + y approx. 2+ tends to accelerate the simultaneous formation of boroxol and diborate groups and in the glasses of x + y approx. < 15, boroxol group and pyroborate ion. The conclusion was confirmed by laser Raman scattering. Molecular volume was measured over the whole glass-forming region to explore the correlation between the micro-structure and a macroscopic property of the glasses. It showed no marked change at the specified composition where micro-structure changed. (orig.)
International Nuclear Information System (INIS)
Zhang, Lei; Šob, M; Wu, Zhe; Zhang, Ying; Lu, Guang-Hong
2014-01-01
We present a comprehensive study of the relationship between the ferromagnetism and the structural properties of Fe systems from three-dimensional ones to isolated atoms based on the spin-density functional theory. We have found a relation between the magnetic moment and the volume of the Voronoi polyhedron, determining, in most cases, the value of the total magnetic moment as a function of this volume with an average accuracy of ±0.28 μ B and of the 3d magnetic moment with an average accuracy of ±0.07 μ B when the atomic volume is larger than 22 Å 3 . It is demonstrated that this approach is applicable for many three-dimensional systems, including high-symmetry structures of perfect body-centered cubic (bcc), face-centered cubic (fcc), hexagonal close-packed (hcp), double hexagonal close-packed (dhcp), and simple cubic (sc) crystals, as well as for lower-symmetry ones, for example atoms near a grain boundary (GB) or a surface, around a vacancy or in a linear chain (for low-dimensional cases, we provide a generalized definition of the Voronoi polyhedron). Also, we extend the validity of the Stoner model to low-dimensional structures, such as atomic chains, free-standing monolayers and surfaces, determining the Stoner parameter for these systems. The ratio of the 3d-exchange splitting to the magnetic moment, corresponding to the Stoner parameter, is found to be I 3d = (0.998 ± 0.006) eV /μ B for magnetic moments up to 3.0 μ B . Further, the 3d exchange splitting changes nearly linearly in the region of higher magnetic moments (3.0–4.0 μ B ) and the corresponding Stoner exchange parameter equals I 3d h =(0.272±0.006) eV/μ B . The existence of these two regions reflects the fact that, with increasing Voronoi volume, the 3d bands separate first and, consequently, the 3d magnetic moment increases. When the Voronoi volume is sufficiently large (≥22 Å 3 ), the separation of the 3d bands is complete and the magnetic moment reaches a value of 3.0
RP-HPLC Determination of vitamins B1, B3, B6, folic acid and B12 in multivitamin tablets
Directory of Open Access Journals (Sweden)
SOTE VLADIMIROV
2005-10-01
Full Text Available Abstract:Asimple and sensitive reversed-phase, ion-pair HPLC method was developed and validated for the simultaneous determination of B-group vitamins, thiamine chloride hydrochloride (B1, nicotinamide (B3, pyridoxine hydrochloride (B6 and folic acid in Pentovit® coated tablets. The cyanocobalamine (B12 was determined separately, because of its low concentration in the investigated multivitamin preparation. RP-HPLC analysis was performed with a LKB 2150 HPLC system, equipped with a UV/VIS Waters M484 detector. The procedures for the determination of B1, B2, B6 and folic acid were carried out on a Supelcosil ABZ+ (15 cm 4.6 mm; 5 µm column with methanol-5mM heptanesulphonic acid sodium salt 0.1%triethylamine TEA(25:75 V/V; pH 2.8 as themobile phase. For the determination of B12 a Suplex pKb-100 (15 cm 4.6 mm; 5 µm column andmethanolâwater (22:78 V/V as themobile phase were used. The column effluentsweremonitored at 290 nm for B 1, B3, B6 and folic acid, and at 550 nm for B12. The obtained results and statistical parameters for all the investigated vitamins of the B-group in Pentovit® coated tablets were satisfactory and ranged from 90.4 % to 108.5 % (RSD. from 0.5% to 4.1 %. The parameters for the validation of the methods are given.
Errata Resonance, Vol.20, No.12, 2015. Rajaram Nityananda, Sun ...
Indian Academy of Sciences (India)
IAS Admin
Resonance, Vol.20, No.12, 2015. Rajaram Nityananda, Sun, Sky and Clouds: Where Light and Matter Meet. Page 1121: The correct Figure 5 is reproduced below: Resonance, Vol.20, No.11, 2015. Anil Kumar, Felix Bloch (1905–1983). Page 956: Para 1, Line 5, 'also from Zürich' should be read as 'from nearby Bern'.
Harris, Leigh K.; Dye, Natalie A.; Theriot, Julie A.
2014-01-01
Summary Rod-shaped bacteria typically elongate at a uniform width. To investigate the genetic and physiological determinants involved in this process, we studied a mutation in the morphogenetic protein MreB in Caulobacter crescentus that gives rise to cells with a variable-width phenotype, where cells have regions that are both thinner and wider than wild-type. During growth, individual cells develop a balance of wide and thin regions, and mutant MreB dynamically localizes to poles and thin regions. Surprisingly, the surface area to volume ratio of these irregularly-shaped cells is, on average, very similar to wild-type. We propose that, while mutant MreB localizes to thin regions and promotes rod-like growth there, wide regions develop as a compensatory mechanism, allowing cells to maintain a wild-type-like surface area to volume ratio. To support this model, we have shown that cell widening is abrogated in growth conditions that promote higher surface area to volume ratios, and we have observed individual cells with high ratios return to wild-type levels over several hours by developing wide regions, suggesting that compensation can take place at the level of individual cells. PMID:25266768
Information manager-2011-Vol 11
African Journals Online (AJOL)
Library _info_Sc_ 1
The Information Manager Vol. ... extent while carrying out their duties on a daily basis. ... It concluded by admonishing librarians to brace up and keep pace ... Proper training should be given to .... used to information and communication technologies .... proficiency Skills .... analysis of the workplace and implementation of.
International Nuclear Information System (INIS)
Wang, Y.; Karolinska Hospital and Karolinska Inst., Stockholm; Jacobsson, H.; Jacobson, S.H.; Kimiaei, S.; Larsson, S.A.
1995-01-01
The distrubution volume of an organ may have a clinical impact in many cases and various methods have been designed to make volume assessments. In this paper, we describe a new method for delineation of the distribution outline and volume determination. The method is based on smoothing, differentiation, image relaxation and voxel counting of single photon emission computer tomography (SPECT) image sets with 3-D operators. A special routine corrects for the inherent thickness of the voxel-based outline. Phantom experiments, using a SPECT system with LEGP-collimator and a 64x64 acquisition matrix with 6.3x6.3 mm 2 pixel size, demonstrated good correlation between the measured and the true volumes. For volumes larger than 120 cc the correlation coefficient was 0.9999 with SE 1.0 cc and an average relative deviation of 0.49%. For volumes below 120 cc, the accuracy was impaired due to low resolution power. By improving the system spatial resolution with an LEHR-collimator and a smaller pixel-size (4.1x4.1 mm 2 ), good accuracy was achieved also for volumes in the range from 3 to 120 cc. Measurements of 15 differently shaped phantoms of volumes between 3 and 104 cc demonstrated high correlation between measured and true volumes: R=0.9921 and SE=0.74 cc (5.3%). For volumes as small as 3 and 5 cc, the difference between the true and the assessed volume was 0.6 cc. The reproducibility of the method was within 3% for volumes above 120 cc and within 7% for volumes below. Due to this accuracy, we conclude that the method can be applied for various clinical routine and research applications using SPECT. (orig.)
Dosimetry of 99mTc-DD-3B6/22 Fab' for use in staging ovarian cancer
International Nuclear Information System (INIS)
Hetherington, E.; Smith, S.V.; Schmidt, P.F.; Di Bartolo, N.M.; Prabakaran, K.; Femandes, V.; Donaghy, T.; Clingan, P.; Bundesen, P.; Hillyard, C.
1998-01-01
Full text: The diagnostic utility of 99 mTc-DD-3B6/22 Fab'' for staging ovarian cancer in a phase 11 trial is under way. The dose due to 99 mTc- DD-3B6/22 Fab'' was used to estimate the dose for the analogous 188 Re compound for therapy of ovarian cancer. The new agent, 99 mTc-DD-3B6/22 Fab'' (600 mBq) was found to clear rapidly from the blood via the renal system. A ''kidney'' phantom was used to calibrate renal activity. The dose to selected organs was estimated using the MlRDose 2 adult female model. In most cases the kidney uptake accounted for 30% of activity administered. Urine activity was measured directly and the dose calculated assuming a mean volume of 300 mL. All remaining activity was assumed to be uniformly distributed throughout the body. Results show the dose to kidneys, bladder wall and whole body were 4.5-9.1; 1.2-6.3; 0.2-0.3 cGy, respectively. The biological distribution of the 188 Re-DD-3B6/22 Fab'' was assumed to be similar to that of 99 mTc-DD-3B6/22 Fab''. The activity/time data was adjusted for the relative t 1/2 of 99 mTc and 188 Re. The calculated kidney dose due to 188 Re was approx. 800 cGy. As kidney damage from acute radiation nephritis is thought to occur at doses >1000 cGy, this study indicates that provided uptake at tumor site is adequate 188 Re-DD-3B6/22 Fab'' may have a role in therapy of ovarian cancer
Revised data book for evaluation of combustion and gasification models: Final report, Volume 3
Energy Technology Data Exchange (ETDEWEB)
Christensen, K.R.; Rasband, M.W.; Smoot, L.D.
1987-10-01
During the previous contract (DE-AC21-81MC16518) a major task was to identify, collect and publish detailed experimental data for evaluation of comprehensive gasification/combustion codes. A review of the literature was completed and prospective data were identified for inclusion in this data book in five categories of increasing complexity: (1) non-reacting, gaseous flows (58 cases); (2) non-reacting, particle-laden flows (43 cases); (3) gaseous combustion (34 cases); (4) pulverized coal combustion (57 cases); (5) entrained coal gasification (6 cases). Selection of these data was based on a set of criteria which included data completeness, availability of detailed, digital profiles for several properties (e.g., species concentrations, velocity, temperature) and data accuracy. From these 198 cases, which were referenced in the final report (Vol. III), the data base was reduced to a total of 35 sets of data from 8 laboratories, with at least 3 cases in each category above. For these 35 cases, the measured data, together with geometrical dimensions and test conditions were documented in a uniform tabular format. These data were also stored on a magnetic tape for distribution. During this follow-on contract (DE-AC21-85MC22059), the accuracy of the data was checked and several additional corrections were made. The format for reporting the data (Appendix B) was simplified. Also, a review of additional data sets available from the Combustion Laboratory and other sources was completed. In all, 213 cases from 52 investigators at 18 laboratories were considered and 37 cases are included in this data book from 22 different investigations at 8 independent laboratories. 81 refs.
Photometric investigation of hot exoplanets: TrES-3b and Qatar-1b
Püsküllü, Ç.; Soydugan, F.; Erdem, A.; Budding, E.
2017-08-01
New photometric follow-up observations of transitting 'hot Jupiters' TrES-3b and Qatar-1b are presented. Weighted mean values of the solutions of light curves in R-filter for both planetary systems are reported and compared with the previous results. The transit light curves were analysed using the WINFITTER code. The physical properties of the planets were estimated. The planet radii are found to be Rp = 1.381 ± 0.033RJ for TrES-3b and Rp = 1.142 ± 0.025RJ for Qatar-1b. Transit times and their uncertainties were also determined and a new linear ephemeris was computed for both systems. Analysis of transit times showed that a significant signal could not be determined for TrES-3b, while weak evidence was found for Qatar-1b, which might be tested using more precise future transit times.
Internet Journal of Medical Update - EJOURNAL - Vol 3, No 2 (2008)
African Journals Online (AJOL)
Lateralization pattern in patients with Schizophrenia and Depression. B Bhushan, A Prakash, R Gupta. http://dx.doi.org/10.4314/ijmu.v3i2.39836 · Gender Determination using Fingertip Features. J-F Wang, C-L Lin, Y-H Chang, ML Nagurka, C-W Yen, C Yeh. http://dx.doi.org/10.4314/ijmu.v3i2.39838 · Effects of smoking on ...
Zhang, Lei; Sob, M; Wu, Zhe; Zhang, Ying; Lu, Guang-Hong
2014-02-26
We present a comprehensive study of the relationship between the ferromagnetism and the structural properties of Fe systems from three-dimensional ones to isolated atoms based on the spin-density functional theory. We have found a relation between the magnetic moment and the volume of the Voronoi polyhedron, determining, in most cases, the value of the total magnetic moment as a function of this volume with an average accuracy of ±0.28 μ(B) and of the 3d magnetic moment with an average accuracy of ±0.07 μ(B) when the atomic volume is larger than 22 ų. It is demonstrated that this approach is applicable for many three-dimensional systems, including high-symmetry structures of perfect body-centered cubic (bcc), face-centered cubic (fcc), hexagonal close-packed (hcp), double hexagonal close-packed (dhcp), and simple cubic (sc) crystals, as well as for lower-symmetry ones, for example atoms near a grain boundary (GB) or a surface, around a vacancy or in a linear chain (for low-dimensional cases, we provide a generalized definition of the Voronoi polyhedron). Also, we extend the validity of the Stoner model to low-dimensional structures, such as atomic chains, free-standing monolayers and surfaces, determining the Stoner parameter for these systems. The ratio of the 3d-exchange splitting to the magnetic moment, corresponding to the Stoner parameter, is found to be I(3d) = (0.998 ± 0.006) eV /μ(B) for magnetic moments up to 3.0 μ(B). Further, the 3d exchange splitting changes nearly linearly in the region of higher magnetic moments (3.0-4.0 μ(B)) and the corresponding Stoner exchange parameter equals I(h)(3d) = (0.272 ± 0.006) eV /μ(B). The existence of these two regions reflects the fact that, with increasing Voronoi volume, the 3d bands separate first and, consequently, the 3d magnetic moment increases. When the Voronoi volume is sufficiently large (≥22 ų), the separation of the 3d bands is complete and the magnetic moment reaches a value of 3.0 μ(B
GPU-Based 3D Cone-Beam CT Image Reconstruction for Large Data Volume
Directory of Open Access Journals (Sweden)
Xing Zhao
2009-01-01
Full Text Available Currently, 3D cone-beam CT image reconstruction speed is still a severe limitation for clinical application. The computational power of modern graphics processing units (GPUs has been harnessed to provide impressive acceleration of 3D volume image reconstruction. For extra large data volume exceeding the physical graphic memory of GPU, a straightforward compromise is to divide data volume into blocks. Different from the conventional Octree partition method, a new partition scheme is proposed in this paper. This method divides both projection data and reconstructed image volume into subsets according to geometric symmetries in circular cone-beam projection layout, and a fast reconstruction for large data volume can be implemented by packing the subsets of projection data into the RGBA channels of GPU, performing the reconstruction chunk by chunk and combining the individual results in the end. The method is evaluated by reconstructing 3D images from computer-simulation data and real micro-CT data. Our results indicate that the GPU implementation can maintain original precision and speed up the reconstruction process by 110–120 times for circular cone-beam scan, as compared to traditional CPU implementation.
Silva, S R; Afonso, J; Monteiro, A; Morais, R; Cabo, A; Batista, A C; Guedes, C M; Teixeira, A
2018-06-01
Carcass data were collected from 24 kids (average live weight of 12.5±5.5 kg; range 4.5 to 22.4 kg) of Jarmelista Portuguese native breed, to evaluate bioelectrical impedance analysis (BIA) as a technique for prediction of light kid carcass and muscle chemical composition. Resistance (Rs, Ω) and reactance (Xc, Ω), were measured in the cold carcasses with a single frequency bioelectrical impedance analyzer and, together with impedance (Z, Ω), two electrical volume measurements (VolA and VolB, cm2/Ω), carcass cold weight (CCW), carcass compactness and several carcass linear measurements were fitted as independent variables to predict carcass composition by stepwise regression analysis. The amount of variation explained by VolA and VolB only reached a significant level (Pcarcass fat weight (0.814⩽R 2⩽0.862; Pcarcass fat weight (combined with carcass length, CL; R 2=0.943; Pcarcass composition.
45 CFR 73b.3 - Reports of violations.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Reports of violations. 73b.3 Section 73b.3 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DEBARMENT OR SUSPENSION OF FORMER EMPLOYEES § 73b.3 Reports of violations. (a) If an officer or employee of the Department has reason to...
Post-perovskite transitions in CaB4+O3 at high pressure
International Nuclear Information System (INIS)
Akaogi, M; Shirako, Y; Kojitani, H; Takamori, S; Yamaura, K; Takayama-Muromachi, E
2010-01-01
High-pressure phase transitions in CaRhO 3 were examined using a multianvil apparatus up to 27 GPa and 1930 o C. CaRhO 3 perovskite transforms to post-perovskite via a monoclinic intermediate phase with increasing pressure. Volume changes for the transitions of perovskite - intermediate phase and of intermediate phase - post-perovskite are -1.1 and -0.7 %, respectively. CaRhO 3 post-perovskite is the fourth quenchable post-perovskite oxide found so far. By high-temperature calorimetric experiments, enthalpy of the perovskite - post-perovskite transition in CaRuO 3 was measured as 15.2±3.3 kJ/mol. Combining the datum with those of CaIrO 3 , it is shown that CaIrO 3 perovskite is energetically less stable than CaRuO 3 perovskite. This is consistent with the fact that orthorhombic distortion of CaIrO 3 perovskite is larger than CaRuO 3 , as indicated with the tilt-angle of octahedral framework of perovskite structure. The transition pressure from perovskite to post-perovskite in CaBO 3 (B = Ru, Rh, Ir) increases almost linearly with decreasing the tilt-angle, suggesting that the perovskite - post-perovskite transition may result from instability of the perovskite structure with pressure.
International Nuclear Information System (INIS)
Latli, Bachir; Casida, J.E.
1996-01-01
NaB 3 H 4 and LiB 3 H 4 at 78% and 97% isotopic enrichments, respectively, were used in the synthesis of 3 H-labeled 1-(6-chloro-3-pyridyl)-methyl-2-nitromethyleneimidazolidine (CH-IMI) and N'-[(6-chloro-3-pyridyl)methyl]-n''-cyano-n'-methylacetamidine (acetamiprid) (two very potent insecticides) and of 1-(6-chloro-3-pyridyl)methyl-2-iminoimidazolidine (desnitro-IMI) (a metabolite of the commercial insecticides imidacloprid). 6-Chloronicotinoyl chloride was treated with either NaB 3 H 4 in methanol or LiB 3 H 4 in tetrahydrofuran and the resulting alcohol transformed to 2-chloro-5-chloromethylpyridine, which was then coupled to N-cyano-N'-methylacetamidine to give [ 3 H] acetamiprid (45 Ci/mmol). 2-Chloro-5-chloro[ 3 H]methylpyridine was also reacted with ethylenediamine and the product was either refluxed in absolute ethanol with 1,1-bis(methylthio)-2-nitro-ethylene to provide [ 3 H]CH-IMI or reacted in toluene with a solution of cyanogen bromide to produce [ 3 H] desnitro-IMI (each 55 Ci/mmol. (author)
International Nuclear Information System (INIS)
Cottrell, W.B.; Klein, A.
1977-01-01
This index to Nuclear Safety covers articles in Nuclear Safety Vol. 11, No. 1 (Jan.-Feb. 1970), through Vol. 17, No. 6 (Nov.-Dec. 1976). The index includes a chronological list of articles (including abstract) followed by KWIC and Author Indexes. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center, covers all safety aspects of nuclear power reactors and associated facilities. The index lists over 350 technical articles in the last six years of publication
Energy Technology Data Exchange (ETDEWEB)
Cottrell, W.B.; Klein, A.
1977-02-23
This index to Nuclear Safety covers articles in Nuclear Safety Vol. 11, No. 1 (Jan.-Feb. 1970), through Vol. 17, No. 6 (Nov.-Dec. 1976). The index includes a chronological list of articles (including abstract) followed by KWIC and Author Indexes. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center, covers all safety aspects of nuclear power reactors and associated facilities. The index lists over 350 technical articles in the last six years of publication.
Sequence Coding and Search System for licensee event reports: coder's manual. Volume 4
International Nuclear Information System (INIS)
Gallaher, R.B.; Guymon, R.H.; Mays, G.T.; Poore, W.P.; Cagle, R.J.; Harrington, K.H.; Johnson, M.P.
1985-04-01
Operating experience data from nuclear power plants are essential for safety and reliability analyses, especially analyses of trends and patterns. The licensee event reports (LERs) that are submitted to the Nuclear Regulatory Commission (NRC) by the nuclear power plant utilities contain much of this data. The NRC's Office for Analysis and Evaluation of Operational Data (AEOD) has developed, under contract with NSIC, a system for codifying the events reported in the LERs. The primary objective of the Sequence Coding and Search System (SCSS) is to reduce the descriptive text of the LERs to coded sequences that are both computer-readable and computer-searchable. This four volume report documents and describes SCSS in detail. Volume 3 and 4 provide a technical processor, new to SCSS, the information and methodology necessary to capture descriptive data from the LER and to codify that data into a structured format and serve as reference material for the more experienced technical processor, and contains information that is essential for the more advanced user who needs to be familiar with the intricate coding techniques in order to retrieve specific details in a sequence. This volume contains updated material through amendment 1 to revision 1 of the working version of ORNL/NSIC-223, Vol. 4
A. C. conduction behaviour in amorphous WO 3 /CEO 2 thin film ...
African Journals Online (AJOL)
A. C. conduction behaviour in amorphous WO3/CEO2 thin film. B Yagoubi, C A Hogarth, A Boukorrt. Abstract. No Abstract. Technologies Avancees Vol. 17 2005: pp. 5-8. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/ta.v17i1.18478.
DEFF Research Database (Denmark)
Møller, S; Bendtsen, F; Henriksen, Jens Henrik Sahl
1995-01-01
, and arterial pressure were determined before and during a volume expansion induced by infusion of a hyperosmotic galactose solution. RESULTS: During volume expansion, the central and arterial blood volume increased significantly in patients with class A and controls, whereas no significant change was found...... in patients with either class B or class C. Conversely, the noncentral blood volume increased in patients with class B and C. In both patients and controls, the cardiac output increased and the systemic vascular resistance decreased, whereas the mean arterial blood pressure did not change significantly......BACKGROUND & AIMS: Systemic vasodilatation in cirrhosis may lead to hemodynamic alterations with reduced effective blood volume and decreased arterial blood pressure. This study investigates the response of acute volume expansion on hemodynamics and regional blood volumes in patients with cirrhosis...
B16 melanoma tumor growth is delayed in mice in an age-dependent manner
Directory of Open Access Journals (Sweden)
Christina Pettan-Brewer
2012-08-01
Full Text Available A major risk factor for cancer is increasing age, which suggests that syngeneic tumor implants in old mice would grow more rapidly. However, various reports have suggested that old mice are not as permissive to implanted tumor cells as young mice. In order to determine and characterize the age-related response to B16 melanoma, we implanted 5×105 tumor cells into 8, 16, 24, and 32-month-old male C57BL/6 (B6 and C57BL/6×BALB/c F1 (CB6 F1 mice subcutaneously in the inguinal and axillary spaces, or intradermally in the lateral flank. Results showed decreased tumor volume with increasing age, which varied according to mouse genetic background and the implanted site. The B6 strain showed robust tumor growth at 8 months of age at the inguinal implantation site, with an average tumor volume of 1341.25 mm3. The 16, 24, and 32-month age groups showed a decrease in tumor growth with tumor volumes of 563.69, 481.02, and 264.55 mm3, respectively (p≤0.001. The axillary implantation site was less permissive in 8-month-old B6 mice with an average tumor volume of 761.52 mm3. The 24- and 32-month age groups showed a similar decrease in tumor growth with tumor volumes of 440 and 178.19 mm3, respectively (p≤0.01. The CB6F1 strain was not as tumor permissive at 8 months of age as B6 mice with average tumor volumes of 446.96 and 426.91 mm3 for the inguinal and axillary sites, respectively. There was a decrease in tumor growth at 24 months of age at both inguinal and axillary sites with an average tumor volume of 271.02 and 249.12 mm3, respectively (p≤0.05. The strain dependence was not apparent in 8-month-old mice injected intradermally with B16 melanoma cells, with average tumor volumes of 736.82 and 842.85 mm3 for B6 and CB6 F1, respectively. However, a strain difference was seen in 32-month-old B6 mice with an average decrease in tumor volume of 250.83 mm3 (p≤0.01. In contrast, tumor growth significantly decreased earlier in CB6 F1 mice with average
African Journals Online (AJOL)
Items 51 - 100 of 437 ... Vol 13, No 1 (2016), Bird species of Mouau with special emphasis on foraging behavior of the northern ... Vol 11, No 2 (2014), Challenges of E-Waste pollution to soil ... Vol 12, No 3 (2015), Consumer preference for swine offals and its ... ethanolic leaf extracts on packed cell volume of Rattus norvegicus ...
African Journals Online (AJOL)
important sources of renewable biological ... The plantain (Musa paradisiaca) and banana chemicals (Nowak et ... fermentable sugars available for bio-ethanol ..... peels. Afr. J. Biochem. Res. 9(9): 104 - 109. 70. Osho et al./ Nig. J. Biotech. Vol.
International Nuclear Information System (INIS)
Glazov, V.M.; Shchelikov, O.D.
1998-01-01
Temperature dependence of specific volume of the A 3 B 5 compounds melts is studied thermometrically and through the method of the penetrating γ radiation. Evaluation of melts thermal expansion coefficients under different temperatures is carried out. Estimates of the Debye characteristic temperatures and mean square dynamic shifts of atoms in the close order structure of the A 3 B 5 compounds melts are conducted on the basis of the obtained results
77 FR 10037 - Temporary Non-Agricultural Employment of H-2B Aliens in the United States
2012-02-21
...-2B Aliens in the United States; Final Rule #0;#0;Federal Register / Vol. 77 , No. 34 / Tuesday... Employment of H-2B Aliens in the United States AGENCY: Employment and Training Administration, and Wage and...
Combining 3d Volume and Mesh Models for Representing Complicated Heritage Buildings
Tsai, F.; Chang, H.; Lin, Y.-W.
2017-08-01
This study developed a simple but effective strategy to combine 3D volume and mesh models for representing complicated heritage buildings and structures. The idea is to seamlessly integrate 3D parametric or polyhedral models and mesh-based digital surfaces to generate a hybrid 3D model that can take advantages of both modeling methods. The proposed hybrid model generation framework is separated into three phases. Firstly, after acquiring or generating 3D point clouds of the target, these 3D points are partitioned into different groups. Secondly, a parametric or polyhedral model of each group is generated based on plane and surface fitting algorithms to represent the basic structure of that region. A "bare-bones" model of the target can subsequently be constructed by connecting all 3D volume element models. In the third phase, the constructed bare-bones model is used as a mask to remove points enclosed by the bare-bones model from the original point clouds. The remaining points are then connected to form 3D surface mesh patches. The boundary points of each surface patch are identified and these boundary points are projected onto the surfaces of the bare-bones model. Finally, new meshes are created to connect the projected points and original mesh boundaries to integrate the mesh surfaces with the 3D volume model. The proposed method was applied to an open-source point cloud data set and point clouds of a local historical structure. Preliminary results indicated that the reconstructed hybrid models using the proposed method can retain both fundamental 3D volume characteristics and accurate geometric appearance with fine details. The reconstructed hybrid models can also be used to represent targets in different levels of detail according to user and system requirements in different applications.
Study of dielectric and piezoelectric properties of CNT reinforced PZT-PVA 0-3 composite
Vyas, Prince; Prajapat, Rampratap; Manmeeta, Saxena, Dhiraj
2016-05-01
Ferroelectric ceramic/polymer composites have the compliance of polymers which overcome the problems of brittleness in ceramics. By imbedding piezoelectric ceramic powder into a polymer matrix, 0-3 composites with good mechanical properties and high dielectric breakdown strength can be developed. The obtained composites of 0-3 connectivity exhibit the piezoelectric properties of ceramics and flexibility, strength and lightness of polymer. These composites can be used in vibration sensing and transducer applications specially as piezoelectric sensors. A potential way to improve piezoelectric& dielectric properties of theses composites is by inclusion of another conductive phase in these composites as reported in the literature. In present work, we prepared PZT-PVA 0-3 composites with 60% ceramic volume fraction reinforced with CNTs with volume ranging from 0 to 1.5 vol%. These CNT reinforced composites were obtained using hot press method with thickness of 200 µm having 0-3 conductivity. These composites were poled applying DC voltage. Dielectric properties of these samples were obtained in a wide frequency range (100 Hz to 1 Mhz) at room temperature. The piezoelectric properties of these composites were analyzed by measuring piezoelectric charge constants (d33). The dielectric and piezoelectric properties of these composites were studied as a function of CNT volume content. In these reinforced composites, CNTs act as a conductive filler dispersed in the matrix which in turn facilitates poling and results in an increase of the piezoelectric properties of the composite due to formation of percolation path through the composites. With a CNT content of 0.3 vol.% in PZT/PVA/CNTs, an increase of 61.3 % was observed in piezoelectric strain factors (d33). In these CNT reinforced composites, a substantial increase (approx. 67%) was also observed in dielectric constant and approximately 89% increase was observed in dielectric loss factor. Results so obtained are in the good
In situ X-ray analysis of MoO3 reduction
International Nuclear Information System (INIS)
Leisegang, T.; Levin, A.A.; Meyer, D.C.; Walter, J.
2005-01-01
The reduction of MoO 3 to MoO 2 under hydrogen/argon atmosphere (5 vol. % H 2 /95 vol. % Ar) in the temperature range 323 K..623 K was studied in situ by means of wide-angle X-ray scattering. It has been found that the starting material, MoO 3 , consists of two different orthorhombic MoO 3 phases A and B with nearly the same structure parameters. The phase A (fraction of 37.1 wt%) describes the larger crystallites whereas the phase B (fraction of 62.9 wt.%) describes the smaller crystallites. Under the reduction to monoclinic MoO 2 phase during the heating, the thermal evolution of the phase fractions is different. A conclusion is drawn that MoO 2 is formed preferably in big crystallites. About 10 wt. % of MoO 2 has been found to form at 623 K resulting in about 69 wt. % after cooling to room temperature followed by holding in Ar/H 2 atmosphere about 24 h. Additionally, about 4.4 wt. % of the Mo 4 O 11 oxide probably formed in large crystallites was detected in the reduced powder after the cooling. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Revised draft: Northeastern Regional geologic characterization report. Volume 3. Plates
International Nuclear Information System (INIS)
1984-11-01
Volume 7(3) contains the following maps: Index Map; Faults, Ground Acceleration, and In Situ Stress; Rock and Mineral Resources; Drainage Basins and Groundwater Discharge Zones; Groundwater Resources; and Crystalline Rock Bodies
Effect of RE (Nd3+, Sm3+) oxide on structural, optical properties of Na2O-Li2O-ZnO-B2O3 glass system
Hivrekar, Mahesh M.; Bhoyar, D. N.; Mande, V. K.; Dhole, V. V.; Solunke, M. B.; Jadhav, K. M.
2018-05-01
Zinc borate glass activated with rare earth oxide (Nd2O3, Sm2O3) of Na2O-Li2O-ZnO-B2O3 quaternary system has been prepared successfully by melt quenching method. The nucleation and growth of RE oxide were controlled temperature range 950-1000° C and rapid cooling at room temperature. The physical, structural and optical properties were characterized by using X-ray diffraction (XRD), SEM, Ultraviolet-visible spectroscopy (UV-Vis). XRD and SEM studies confirmed the amorphous nature, surface morphology of prepared zinc borate glass. The physical parameters like density, molar volume, molar mass of Nd3+, Sm3+ doped borate glass are summarized in the present article. The optical absorption spectra along with tauc's plot are presented. The optical energy band gap increases due to the addition of rare earth oxide confirming the role of network modifier.
Energy Technology Data Exchange (ETDEWEB)
Kan, Wen Hao, E-mail: wkan6795@uni.sydney.edu.au [School of Civil Engineering, The University of Sydney, NSW 2006 (Australia); Ye, Zi Jie; Zhu, Yue [School of Civil Engineering, The University of Sydney, NSW 2006 (Australia); Bhatia, Vijay Kumar [School of Aerospace, Mechanical and Mechatronic Engineering, The University of Sydney, NSW 2006 (Australia); Australian Centre for Microscopy and Microanalysis, The University of Sydney, NSW 2006 (Australia); Dolman, Kevin; Lucey, Timothy; Tang, Xinhu [Weir Minerals Australia, Artarmon, NSW 2064 (Australia); Proust, Gwénaëlle [School of Civil Engineering, The University of Sydney, NSW 2006 (Australia); Cairney, Julie [School of Aerospace, Mechanical and Mechatronic Engineering, The University of Sydney, NSW 2006 (Australia); Australian Centre for Microscopy and Microanalysis, The University of Sydney, NSW 2006 (Australia)
2016-09-15
AISI 440 stainless steels reinforced with various volume fractions of niobium carbide (NbC) particles of up to 25 vol% were fabricated in-situ using an argon arc furnace and then heat-treated to produce a martensitic matrix. Optical and scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS) and electron back-scatter diffraction (EBSD) techniques were used to analyze the microstructure, phases and composition of these composites. Interestingly, it was found that Chinese-script NbC could nucleate on existing primary NbC particles creating NbC clusters with complex microstructures. Additionally, hardness tests were used to evaluate viability in mining and mineral processing applications. The increase in NbC content resulted in an overall increase in the hardness of the composites while causing a marginal decrease in the amount of Cr in solid solution with the matrix, which could be a concern for corrosion resistance. The latter was due to the fact that the NbC lattice could dissolve a minor amount of Cr. Thermodynamic simulations also attributed this to a slight increase in M{sub 7}C{sub 3} precipitation. Nonetheless, these novel composites show great promise for applications in wear and corrosive environments. - Highlights: •Stainless steels reinforced with NbC particles of up to 25 vol% were fabricated. •NbC was formed in-situ in the steels using an arc melter. •Martensitic transformation of the matrix of each sample was achieved. •NbC reinforcements increased the bulk hardness values of the steels. •Dissolved Cr in the matrix of each sample was sufficient for passivity in theory.
Research Today Volume 3, Issue 2 April 2017 Newsletter
2017-05-05
for your study [ e.g., 59 MDW CRD Graduate Health Sciences Education (GHSE) (SG5 O&M); SG5 R&D; Tri-Service Nursing Research Program (TSNRP); Defense...59 MDW/SGVU SUBJECT: Professional Presentation Approval 1. Your paper, entitled Research Today Volume 3, Issue 2 April 2017 - Newsletter presented...Hall Ambulatory Surgical Center (WHASC) internship and residency programs. 3. Please know that if you are a Graduate Health Sciences Education
Microstructure of in-situ Synthesized (TiB+TiC)/Ti Composites Prepared by Hot-pressing
Institute of Scientific and Technical Information of China (English)
Zhenzhu ZHENG; Lin GENG; Honglin WANG; Weimin ZHOU; Hongyu XU
2003-01-01
In-situ 5 vol.pct TiB whiskers and TiC particulates reinforced Ti composites were fabricated by blending Ti powderand B4C particulates followed by reactive hot-pressing. The microstructure of the composites was investigated byusing differential scanning c
Intracranial MRA: single volume vs. multiple thin slab 3D time-of-flight acquisition.
Davis, W L; Warnock, S H; Harnsberger, H R; Parker, D L; Chen, C X
1993-01-01
Single volume three-dimensional (3D) time-of-flight (TOF) MR angiography is the most commonly used noninvasive method for evaluating the intracranial vasculature. The sensitivity of this technique to signal loss from flow saturation limits its utility. A recently developed multislab 3D TOF technique, MOTSA, is less affected by flow saturation and would therefore be expected to yield improved vessel visualization. To study this hypothesis, intracranial MR angiograms were obtained on 10 volunteers using three techniques: MOTSA, single volume 3D TOF using a standard 4.9 ms TE (3D TOFA), and single volume 3D TOF using a 6.8 ms TE (3D TOFB). All three sets of axial source images and maximum intensity projection (MIP) images were reviewed. Each exam was evaluated for the number of intracranial vessels visualized. A total of 502 vessel segments were studied with each technique. With use of the MIP images, 86% of selected vessels were visualized with MOTSA, 64% with 3D TOFA (TE = 4.9 ms), and 67% with TOFB (TE = 6.8 ms). Similarly, with the axial source images, 91% of selected vessels were visualized with MOTSA, 77% with 3D TOFA (TE = 4.9 ms), and 82% with 3D TOFB (TE = 6.8 ms). There is improved visualization of selected intracranial vessels in normal volunteers with MOTSA as compared with single volume 3D TOF. These improvements are believed to be primarily a result of decreased sensitivity to flow saturation seen with the MOTSA technique. No difference in overall vessel visualization was noted for the two single volume 3D TOF techniques.
On 'light' fermions and proton stability in 'big divisor' D3/D7 large volume compactifications
International Nuclear Information System (INIS)
Misra, Aalok; Shukla, Pramod
2011-01-01
Building on our earlier work (Misra and Shukla, Nucl. Phys. B 827:112, 2010; Phys. Lett. B 685:347-352, 2010), we show the possibility of generating ''light'' fermion mass scales of MeV-GeV range (possibly related to the first two generations of quarks/leptons) as well as eV (possibly related to first two generations of neutrinos) in type IIB string theory compactified on Swiss-Cheese orientifolds in the presence of a mobile space-time filling D3-brane restricted to (in principle) stacks of fluxed D7-branes wrapping the ''big'' divisor Σ B . This part of the paper is an expanded version of the latter half of Sect. 3 of a published short invited review (Misra, Mod. Phys. Lett. A 26:1, 2011) written by one of the authors [AM ]. Further, we also show that there are no SUSY GUT-type dimension-five operators corresponding to proton decay, and we estimate the proton lifetime from a SUSY GUT-type four-fermion dimension-six operator to be 10 61 years. Based on GLSM calculations in (Misra and Shukla, Nucl. Phys. B 827:112, 2010) for obtaining the geometric Kaehler potential for the ''big divisor,'' using further the Donaldson's algorithm, we also briefly discuss in the first of the two appendices the metric for the Swiss-Cheese Calabi-Yau used, which we obtain and which becomes Ricci flat in the large-volume limit. (orig.)
On `light' fermions and proton stability in `big divisor' D3/ D7 large volume compactifications
Misra, Aalok; Shukla, Pramod
2011-06-01
Building on our earlier work (Misra and Shukla, Nucl. Phys. B 827:112, 2010; Phys. Lett. B 685:347-352, 2010), we show the possibility of generating "light" fermion mass scales of MeV-GeV range (possibly related to the first two generations of quarks/leptons) as well as eV (possibly related to first two generations of neutrinos) in type IIB string theory compactified on Swiss-Cheese orientifolds in the presence of a mobile space-time filling D3-brane restricted to (in principle) stacks of fluxed D7-branes wrapping the "big" divisor Σ B . This part of the paper is an expanded version of the latter half of Sect. 3 of a published short invited review (Misra, Mod. Phys. Lett. A 26:1, 2011) written by one of the authors [AM]. Further, we also show that there are no SUSY GUT-type dimension-five operators corresponding to proton decay, and we estimate the proton lifetime from a SUSY GUT-type four-fermion dimension-six operator to be 1061 years. Based on GLSM calculations in (Misra and Shukla, Nucl. Phys. B 827:112, 2010) for obtaining the geometric Kähler potential for the "big divisor," using further the Donaldson's algorithm, we also briefly discuss in the first of the two appendices the metric for the Swiss-Cheese Calabi-Yau used, which we obtain and which becomes Ricci flat in the large-volume limit.
Indian Academy of Sciences (India)
Sadhana. Current Issue : Vol. 43, Issue 3. Current Issue Volume 43 | Issue 3. March 2018. Home · Volumes & Issues · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Sadhana. Current Issue : Vol. 43, Issue 3. Current Issue Volume 43 | Issue 3. March 2018. Home · Volumes & Issues · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Matos, B. R.; Isidoro, R. A.; Santiago, E. I.; Fonseca, F. C.
2014-12-01
The present study reports on the performance enhancement of direct ethanol fuel cell (DEFC) at 130 °C with Nafion-titania composite electrolytes prepared by sol-gel technique and containing high volume fractions of the ceramic phase. It is found that for high volume fractions of titania (>10 vol%) the ethanol uptake of composites is largely reduced while the proton conductivity at high-temperatures is weakly dependent on the titania content. Such tradeoff between alcohol uptake and conductivity resulted in a boost of DEFC performance at high temperatures using Nafion-titania composites with high fraction of the inorganic phase.
African Journals Online (AJOL)
Items 351 - 391 of 391 ... Issue, Title ... Vol 2, No 3 (1999): Special Edition, The efficacy of low volume application of roundup ... Vol 1, No 1 (1998), The relationships among National Socio-Economic Indicators and Child Health Statistics, Abstract.
Energy Technology Data Exchange (ETDEWEB)
Bauer, Ralf W.; Frellesen, Claudia; Schell, Boris; Lehnert, Thomas; Jacobi, Volkmar; Vogl, Thomas J.; Kerl, J.M. [Clinic of the Goethe University, Department of Diagnostic and Interventional Radiology, Frankfurt (Germany); Renker, Matthias [Clinic of the Goethe University, Department of Diagnostic and Interventional Radiology, Frankfurt (Germany); Medical University of South Carolina, Heart and Vascular Center, Ashley River Tower, Charleston, SC (United States); Ackermann, Hanns [Clinic of the Goethe University, Department of Biostatistics and Mathematical Modelling, Frankfurt (Germany); Schoepf, U.J. [Medical University of South Carolina, Heart and Vascular Center, Ashley River Tower, Charleston, SC (United States)
2011-09-15
To investigate the role of perfusion defect (PD) size on dual energy CT pulmonary blood volume assessment as predictor of right heart strain and patient outcome and its correlation with d-dimer levels in acute pulmonary embolism (PE). 53 patients with acute PE who underwent DECT pulmonary angiography were retrospectively analyzed. Pulmonary PD size caused by PE was measured on DE iodine maps and quantified absolutely (VolPD) and relatively to the total lung volume (RelPD). Signs of right heart strain (RHS) on CT were determined. Information on d-dimer levels and readmission for recurrent onset of PE and death was collected. D-dimer level was mildly (r = 0.43-0.47) correlated with PD size. Patients with RHS had significantly higher VolPD (215 vs. 73 ml) and RelPD (9.9 vs. 2.9%) than patients without RHS (p < 0.003). There were 2 deaths and 1 readmission due of PE in 18 patients with >5% RelPD, while no such events were found for patients with <5% RelPD. Pulmonary blood volume on DECT in acute PE correlates with RHS and appears to be a predictor of patient outcome in this pilot study. (orig.)
Anatomy Journal of Africa - Vol 3, No 3 (2014)
African Journals Online (AJOL)
Castration causes progressive reduction of length of the rabbit penis · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B Olabu, P Gichangi, H Saidi, J Ogeng'o, 412-416 ...
Central African Journal of Medicine - Vol 60, No 9-12 (2016)
African Journals Online (AJOL)
Central African Journal of Medicine - Vol 60, No 9-12 (2016). Journal Home > Archives > Vol 60, No 9-12 (2016). Supplementary Issue. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue ...
Global Ethics Applied: Global Ethics, Economic Ethics
Stückelberger, Christoph
2016-01-01
Global Ethics Applied’ in four volumes is a reader of 88 selected articles from the author on 13 domains: Vol. 1 Global Ethics, Economic Ethics; Vol. 2 Environmental Ethics; Vol. 3 Development Ethics, Political Ethics, Dialogue and Peace Ethics, Innovation and Research Ethics, Information and Communication Ethics; Vol. 4 Bioethics and Medical Ethics, Family Ethics and Sexual Ethics, Leadership Ethics, Theological Ethics and Ecclesiology, Methods of Ethics. It concludes with the extended Bibli...
Mehta, Minal B; Shewale, Swapnil V; Sequeira, Raymond N; Millar, John S; Hand, Nicholas J; Rader, Daniel J
2017-06-23
Maintenance of whole-body glucose homeostasis is critical to glycemic function. Genetic variants mapping to chromosome 8p23.1 in genome-wide association studies have been linked to glycemic traits in humans. The gene of known function closest to the mapped region, PPP1R3B (protein phosphatase 1 regulatory subunit 3B), encodes a protein (G L ) that regulates glycogen metabolism in the liver. We therefore sought to test the hypothesis that hepatic PPP1R3B is associated with glycemic traits. We generated mice with either liver-specific deletion ( Ppp1r3b Δ hep ) or liver-specific overexpression of Ppp1r3b The Ppp1r3b deletion significantly reduced glycogen synthase protein abundance, and the remaining protein was predominantly phosphorylated and inactive. As a consequence, glucose incorporation into hepatic glycogen was significantly impaired, total hepatic glycogen content was substantially decreased, and mice lacking hepatic Ppp1r3b had lower fasting plasma glucose than controls. The concomitant loss of liver glycogen impaired whole-body glucose homeostasis and increased hepatic expression of glycolytic enzymes in Ppp1r3b Δ hep mice relative to controls in the postprandial state. Eight hours of fasting significantly increased the expression of two critical gluconeogenic enzymes, phosphoenolpyruvate carboxykinase and glucose-6-phosphatase, above the levels in control livers. Conversely, the liver-specific overexpression of Ppp1r3b enhanced hepatic glycogen storage above that of controls and, as a result, delayed the onset of fasting-induced hypoglycemia. Moreover, mice overexpressing hepatic Ppp1r3b upon long-term fasting (12-36 h) were protected from blood ketone-body accumulation, unlike control and Ppp1r3b Δ hep mice. These findings indicate a major role for Ppp1r3b in regulating hepatic glycogen stores and whole-body glucose/energy homeostasis. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Northeastern Regional geologic characterization report. Volume 3. Plates. Final report
International Nuclear Information System (INIS)
1985-08-01
Volume 7(3) contains the following maps: index map; faults, ground acceleration, and in situ stress; rock and mineral resources; drainage basins and ground water discharge zones; ground water resources; and crystalline rock bodies
Sustainable Use of Pesticide Applications in Citrus: A Support Tool for Volume Rate Adjustment
Directory of Open Access Journals (Sweden)
Cruz Garcerá
2017-06-01
Full Text Available Rational application of pesticides by properly adjusting the amount of product to the actual needs and specific conditions for application is a key factor for sustainable plant protection. However, current plant protection product (PPP labels registered for citrus in EU are usually expressed as concentration (%; rate/hl and/or as the maximum dose of product per unit of ground surface, without taking into account those conditions. In this work, the fundamentals of a support tool, called CitrusVol, developed to recommend mix volume rates in PPP applications in citrus orchards using airblast sprayers, are presented. This tool takes into consideration crop characteristics (geometry, leaf area density, pests, and product and application efficiency, and it is based on scientific data obtained previously regarding the minimum deposit required to achieve maximum efficacy, efficiency of airblast sprayers in citrus orchards, and characterization of the crop. The use of this tool in several commercial orchards allowed a reduction of the volume rate and the PPPs used in comparison with the commonly used by farmers of between 11% and 74%, with an average of 31%, without affecting the efficacy. CitrusVol is freely available on a website and in an app for smartphones.
Theoretical study of B3-to-B1 phase transition in ZnS
International Nuclear Information System (INIS)
Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong
2016-01-01
The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3–B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa. - Highlights: • The phase transformation from B3 to B1 structures in ZnS is studied using first-principle method. • The predicted transition pressure is within the range of 16.33 to 19.04 GPa. • The transition process can be viewed as the appearance and disappearance of very slight lattice distortion. • Physical driving force of the transition is a coupling effect between the mechanical instability and softening phonon. • For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Sadhana. Current Issue : Vol. 43, Issue 3 · Current Issue Volume 43 | Issue 3. March 2018. Home · Volumes & Issues · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
Biomass-based gasifiers for internal combustion (IC) engines—A ...
Indian Academy of Sciences (India)
Sadhana. Current Issue : Vol. 43, Issue 3 · Current Issue Volume 43 | Issue 3. March 2018. Home · Volumes & Issues · Special Issues · Search · Editorial Board · Information for Authors · Subscription ...
A complex relationship between TRAF3 and non-canonical NF-κB2 activation in B lymphocytes
Directory of Open Access Journals (Sweden)
Wai Wai Lin
2013-12-01
Full Text Available The adaptor protein TRAF3 restrains BAFF receptor (BAFFR and CD40-mediated activation of the NF-κB2 pathway in B cells. Mice lacking TRAF3 specifically in B cells revealed the critical role of TRAF3 in restraining homeostatic B cell survival. Furthermore, loss- of-function mutations of the traf3 gene have been associated with human B cell malignancies, especially multiple myeloma (MM. It has been proposed that receptor-induced TRAF3 degradation leads to stabilization of the NF-B inducing kinase NIK, and subsequent NF-κB2 activation. However, it is unclear how receptor-mediated TRAF3 degradation or loss of function contributes to B cell-specific NF-κB2 activation. In the current study, we employed two complementary models to address this question. One utilized a mutant traf3 gene found in a human MM-derived cell line called LP1. The LP1 mutant TRAF3 protein lacks the TRAF-N and TRAF-C domains. Consistent with the paradigm described, expression of LP1 TRAF3 in B cells promoted higher basal levels of NF-κB2 activation compared to Wt TRAF3. However, LP1 did not associate with TRAF2, CD40, or BAFFR, and no LP1 degradation was observed following receptor engagement. Interestingly, LP1 showed enhanced NIK association. Thus, TRAF3 degradation becomes dispensable to activate NF-κB2 when it is unable to associate with TRAF2. In a second model, we examined several mutant forms of BAFFR that are unable to induce NF-κB2 activation in B cells. Signaling to B cells by each of these BAFFR mutants, however, induced levels of TRAF3 degradation similar to those induced by Wt BAFFR. Thus, in B cells, receptor-mediated TRAF3 degradation is not sufficient to promote NF-B2 activation. We thus conclude that there is not a simple linear relationship in B lymphocytes between relative levels of cellular TRAF3, induced TRAF3 degradation, NIK activation and NF-B2 activation.
Clinics in Mother and Child Health - Vol 5, No 1 (2008)
African Journals Online (AJOL)
Clinics in Mother and Child Health - Vol 5, No 1 (2008). Journal Home > Archives > Vol 5, No 1 (2008). Special Edition - Congress Abstracts. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue ...
Ghana Journal of Geography - Vol 9, No 3 (2017)
African Journals Online (AJOL)
This issue/volume was produced with financial support from the Carnegie Corporation of New York through the University of Ghana Building the Next Generation of Academics in Africa (BANGA-Africa) Project. Table of Contents. Articles. Gender Aspects of Street Crossing Behaviour among Undergraduates: An ...
Winkelman, John W; Benson, Kathleen L; Buxton, Orfeu M; Lyoo, In Kyoon; Yoon, Sujung; O'Connor, Shawn; Renshaw, Perry F
2010-06-01
A recent pilot study reported that hippocampal volume (HV) was reduced in patients with primary insomnia (PI) relative to normal sleepers. Loss of HV in PI might be due to chronic hyperarousal and/or chronic sleep debt. The aim of this study was to replicate the earlier pilot report while employing a larger sample, more rigorous screening criteria, and objective sleep data. This cross-sectional design included community recruits meeting DSM-IV criteria for PI (n=20, 10 males, mean age 39.3+/-8.7) or good sleeper controls (n=15, 9 males, mean age 38.8+/-5.3). All subjects were unmedicated and rigorously screened to exclude comorbid psychiatric and medical illness. PI subjects underwent overnight polysomnography to screen for sleep-related breathing and movement disorders. HV and total brain volumes were derived by MRI employing a Siemens/Trio scanner operating at 3 Tesla. Data also included 2 weeks of sleep diaries and wrist actigraphy. Mean HV was 4322.0+/-299.7 mm(3) for the good sleeper controls and 4601.55+/-537.4 mm(3) for the PI group. The dependent variable, HV, was analyzed by ANCOVA. Main effects were diagnosis and gender; whole brain volume served as the covariate. Although the overall model was significant (F=6.3, p=0.001), the main effects of diagnosis (F=2.14) and gender (F=0.04) were not significant. The covariate of whole brain volume was significant (F=5.74, p=0.023) as was the interaction of diagnosis with gender (F=10.22, p=0.003), with male insomniacs having larger HVs than male controls. This study did not replicate a previously published report of HV loss in primary insomnia. Differences between our finding and the previous report might be due to sample composition and method of MRI assessment. Furthermore, we demonstrated no objective differences between the controls and PIs in actigraphic measures of sleep maintenance. Within the PIs, however, actigraphic measures of poor sleep maintenance were associated with smaller HV. Copyright 2010
B7-H3 is a potent inhibitor of human T cell activation: No evidence for B7-H3 and TREML2 interaction
Leitner, Judith; Klauser, Christoph; Pickl, Winfried F.; Stöckl, Johannes; Majdic, Otto; Bardet, Anaïs F.; Kreil, David P.; Dong, Chen; Yamazaki, Tomohide; Zlabinger, Gerhard; Pfistershammer, Katharina; Steinberger, Peter
2010-01-01
B7-H3 belongs to the B7 superfamily, a group of molecules that costimulate or down-modulate T cell responses. Although it was shown that B7-H3 can inhibit T cell responses, several studies - most of them performed in murine systems - found B7-H3 to act in a costimulatory manner. In this study we have specifically addressed a potential functional dualism of human B7-H3 by assessing the effect of this molecule under varying experimental conditions as well as on different T cell subsets. We show that B7-H3 does not costimulate human T cells. In presence of strong activating signals, B7-H3 potently and consistently down-modulated human T cell responses. This inhibitory effect was evident when analyzing proliferation and cytokine production and affected naïve as well as pre-activated T cells. We furthermore demonstrate that B7-H3 - T cell interaction is characterized by an early suppression of IL-2 and that T cell inhibition can be reverted by exogenous IL-2. Since TREML2 has been recently described as costimulatory receptor of murine B7-H3 we have extensively analysed interaction of human B7-H3 with TREML2 (TLT2). In these experiments we found no evidence for such an interaction. Furthermore our data do not point to a role for murine TREML2 as a receptor for murine B7-H3. PMID:19544488
System 80+{trademark} Standard Design: CESSAR design certification. Volume 3: Amendment I
Energy Technology Data Exchange (ETDEWEB)
1990-12-21
This report, entitled Combustion Engineering Standard Safety Analysis Report - Design Certification (CESSAR-DC), has been prepared in support of the industry effort to standardize nuclear plant designs. These documents describe the Combustion Engineering, Inc. System 80+{sup TM} Standard Design. This report, Volume 3, in conjunction with Volume 2, provides the design of structures, components, equipment and systems.
18 CFR 3b.5 - Legal guardians.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Legal guardians. 3b.5... INFORMATION General § 3b.5 Legal guardians. For the purposes of this part, the parent of any minor, or the legal guardian of any individual who has been declared to be incompetent due to physical or mental...
Energy Technology Data Exchange (ETDEWEB)
None
1980-08-01
The Sixth International Conference on Fluidized Bed Combustion was held at the Atlanta Hilton, Atlanta, Georgia, April 9-11, 1980. The papers in this volume involved presentation of the research and development programs of the US (US DOE, TVA, EPRI and US EPA), United Kingdom, Federal Republic of Germany and the People's Republic of China. Eight papers from Vol. 1 (Plenary Sessions) of the proceedings have been entered individually into EDB and ERA. (LTN)
International Nuclear Information System (INIS)
Johansen, S; Reinertsen, KV; Knutstad, K; Olsen, DR; Fosså, SD
2011-01-01
To relate the development of post-treatment hypothyroidism with the dose distribution within the thyroid gland in breast cancer (BC) patients treated with loco-regional radiotherapy (RT). In two groups of BC patients postoperatively irradiated by computer tomography (CT)-based RT, the individual dose distributions in the thyroid gland were compared with each other; Cases developed post-treatment hypothyroidism after multimodal treatment including 4-field RT technique. Matched patients in Controls remained free for hypothyroidism. Based on each patient's dose volume histogram (DVH) the volume percentages of the thyroid absorbing respectively 20, 30, 40 and 50 Gy were then estimated (V20, V30, V40 and V50) together with the individual mean thyroid dose over the whole gland (MeanTotGy). The mean and median thyroid dose for the included patients was about 30 Gy, subsequently the total volume of the thyroid gland (VolTotGy) and the absolute volumes (cm 3 ) receiving respectively < 30 Gy and ≥ 30 Gy were calculated (Vol < 30 and Vol ≥ 30) and analyzed. No statistically significant inter-group differences were found between V20, V30, V40 and V50Gy or the median of MeanTotGy. The median VolTotGy in Controls was 2.3 times above VolTotGy in Cases (ρ = 0.003), with large inter-individual variations in both groups. The volume of the thyroid gland receiving < 30 Gy in Controls was almost 2.5 times greater than the comparable figure in Cases. We concluded that in patients with small thyroid glands after loco-radiotherapy of BC, the risk of post-treatment hypothyroidism depends on the volume of the thyroid gland
International Nuclear Information System (INIS)
Baek, Jihye; Huh, Jangyoung; Hyun An, So; Oh, Yoonjin; Kim, Myungsoo; Kim, DongYoung; Chung, Kwangzoo; Cho, Sungho; Lee, Rena
2013-01-01
Purpose: To evaluate the accuracy of measuring volumes using three-dimensional ultrasound (3D US), and to verify the feasibility of the replacement of CT-MR fusion images with CT-3D US in radiotherapy treatment planning. Methods: Phantoms, consisting of water, contrast agent, and agarose, were manufactured. The volume was measured using 3D US, CT, and MR devices. A CT-3D US and MR-3D US image fusion software was developed using the Insight Toolkit library in order to acquire three-dimensional fusion images. The quality of the image fusion was evaluated using metric value and fusion images. Results: Volume measurement, using 3D US, shows a 2.8 ± 1.5% error, 4.4 ± 3.0% error for CT, and 3.1 ± 2.0% error for MR. The results imply that volume measurement using the 3D US devices has a similar accuracy level to that of CT and MR. Three-dimensional image fusion of CT-3D US and MR-3D US was successfully performed using phantom images. Moreover, MR-3D US image fusion was performed using human bladder images. Conclusions: 3D US could be used in the volume measurement of human bladders and prostates. CT-3D US image fusion could be used in monitoring the target position in each fraction of external beam radiation therapy. Moreover, the feasibility of replacing the CT-MR image fusion to the CT-3D US in radiotherapy treatment planning was verified.
Energy Technology Data Exchange (ETDEWEB)
Ohlsson, O.
1994-07-01
This report contains the data resulting from the co-firing of b-dRDF pellets and coal in a 440-MW{sub e} cyclone-fired combustor. These tests were conducted under a Collaborative Research and Development Agreement (CRADA). The CRADA partners included the U.S. Department of Energy (DOE), National Renewable Energy Laboratory (NREL), Argonne National Laboratory (ANL), Otter Tail Power Company, Green Isle Environmental, Inc., XL Recycling Corporation, and Marblehead Lime Company. The report is made up of three volumes. This volume contains other supporting information, along with quality assurance documentation and safety and test plans. With this multi-volume approach, readers can find information at the desired level of detail, depending on individual interest or need.
Synthesis of pyrano[2,3-c]carbazoles, pyrano[3,2-b]carbazoles and ...
Indian Academy of Sciences (India)
2,3-c]carbazoles, pyrano[3,2-b]carbazoles and furo[3,2-b]carbazole derivatives via iodocyclization. KRISHNA CHAITANYA TALLURI and RAJAGOPAL NAGARAJAN. ∗. School of Chemistry, University of Hyderabad, Hyderabad 500046, India.
Numerical study on heat transfer characteristics of thermosyphon heat pipes using nanofluids
International Nuclear Information System (INIS)
Huminic, Gabriela; Huminic, Angel
2013-01-01
Highlights: • Numerical study of nanofluid heat transfer in thermosyphon heat pipes is performed. • Effect of nanoparticle concentration and operating temperature are studied. • Fe 2 O 3 –water nanofluid with 5.3% volume concentration shows the best performance. • Results show the improvement the thermal performances of thermosyphon heat pipe with nanofluids. - Abstract: In this work, a three-dimensional analysis is used to investigate the heat transfer of thermosyphon heat pipe using water and nanofluids as the working fluid. The study focused mainly on the effects of volume concentrations of nanoparticles and the operating temperature on the heat transfer performance of the thermosyphon heat pipe using the nanofluids. The analysis was performed for water and γ-Fe 2 O 3 nanoparticles, three volume concentrations of nanoparticles (0 vol.%, 2 vol.% and 5.3 vol.%) and four operating temperatures (60, 70, 80 and 90 °C). The numerical results show that the volume concentration of nanoparticles had a significant effect in reducing the temperature difference between the evaporator and condenser. Experimental and numerical results show qualitatively that the thermosyphon heat pipe using the nanofluid has better heat transfer characteristics than the thermosyphon heat pipe using water
Birefringence Bragg Binary (3B) grating, quasi-Bragg grating and immersion gratings
Ebizuka, Noboru; Morita, Shin-ya; Yamagata, Yutaka; Sasaki, Minoru; Bianco, Andorea; Tanabe, Ayano; Hashimoto, Nobuyuki; Hirahara, Yasuhiro; Aoki, Wako
2014-07-01
A volume phase holographic (VPH) grating achieves high angular dispersion and very high diffraction efficiency for the first diffraction order and for S or P polarization. However the VPH grating could not achieve high diffraction efficiency for non-polarized light at a large diffraction angle because properties of diffraction efficiencies for S and P polarizations are different. Furthermore diffraction efficiency of the VPH grating extinguishes toward a higher diffraction order. A birefringence binary Bragg (3B) grating is a thick transmission grating with optically anisotropic material such as lithium niobate or liquid crystal. The 3B grating achieves diffraction efficiency up to 100% for non-polarized light by tuning of refractive indices for S and P polarizations, even in higher diffraction orders. We fabricated 3B grating with liquid crystal and evaluated the performance of the liquid crystal grating. A quasi-Bragg (QB) grating, which consists long rectangle mirrors aligned in parallel precisely such as a window shade, also achieves high diffraction efficiency toward higher orders. We fabricated QB grating by laminating of silica glass substrates and glued by pressure fusion of gold films. A quasi-Bragg immersion (QBI) grating has smooth mirror hypotenuse and reflector array inside the hypotenuse, instead of step-like grooves of a conventional immersion grating. An incident beam of the QBI grating reflects obliquely at a reflector, then reflects vertically at the mirror surface and reflects again at the same reflector. We are going to fabricate QBI gratings by laminating of mirror plates as similar to fabrication of the QB grating. We will also fabricate silicon and germanium immersion gratings with conventional step-like grooves by means of the latest diamond machining methods. We introduce characteristics and performance of these gratings.