WorldWideScience

Sample records for vitreoscilla vhb haemoglobin

  1. Menadione knocks out Vitreoscilla haemoglobin (VHb): the current evidence for the role of VHb in recombinant Escherichia coli.

    Science.gov (United States)

    Aydin, Suleyman

    2003-08-01

    Genetically engineering the heterologous bacterial host with the gene (vgb) encoding Vitreoscilla haemoglobin (VHb) has been found to provide typical advantages in growth and production, and it has generally been assumed that VHb is responsible for this effect. Here, using matched strains of Escherichia coli that bear a recombinant R-amylase gene (MK57) or the R-amylase gene and vgb (MK79), we examined this assumption. Menadione, which is known to oxidize haem proteins, was tested over a range of concentrations for its effects on growth, R-amylase production, respiration and VHb function in MK57 and MK79. Active VHb accumulated, and VHb was oxidized to the inactive ferric form with the use of menadione at the concentrations of 0.5-10 mM; concentrations that had a much smaller effect on cytochrome oxidase. This decrease in active VHb in strain MK79 was correlated with a reverse in the advantage regarding R-amylase production of MK79 over MK57 seen at a menadione concentration of 0 mM, thus linking the presence of active VHb with the increase in R-amylase production. It is concluded that vgb, and not any other Vitreoscilla DNA sequences on plasmid pMK79, is the source of the advantages in both the growth and product production of alpha-amylase in this system.

  2. Redox-mediated interactions of VHb (Vitreoscilla haemoglobin) with OxyR: novel regulation of VHb biosynthesis under oxidative stress.

    Science.gov (United States)

    Anand, Arvind; Duk, Brian T; Singh, Sandeep; Akbas, Meltem Y; Webster, Dale A; Stark, Benjamin C; Dikshit, Kanak L

    2010-02-24

    The bacterial haemoglobin from Vitreoscilla, VHb, displays several unusual properties that are unique among the globin family. When the gene encoding VHb, vgb, is expressed from its natural promoter in either Vitreoscilla or Escherichia coli, the level of VHb increases more than 50-fold under hypoxic conditions and decreases significantly during oxidative stress, suggesting similar functioning of the vgb promoter in both organisms. In the present study we show that expression of VHb in E. coli induced the antioxidant genes katG (catalase-peroxidase G) and sodA (superoxide dismutase A) and conferred significant protection from oxidative stress. In contrast, when vgb was expressed in an oxyR mutant of E. coli, VHb levels increased and the strain showed high sensitivity to oxidative stress without induction of antioxidant genes; this indicates the involvement of the oxidative stress regulator OxyR in mediating the protective effect of VHb under oxidative stress. A putative OxyR-binding site was identified within the vgb promoter and a gel-shift assay confirmed its interaction with oxidized OxyR, an interaction which was disrupted by the reduced form of the transcriptional activator Fnr (fumurate and nitrate reductase). This suggested that the redox state of OxyR and Fnr modulates their interaction with the vgb promoter. VHb associated with reduced OxyR in two-hybrid screen experiments and in vitro, converting it into an oxidized state in the presence of NADH, a condition where VHb is known to generate H2O2. These observations unveil a novel mechanism by which VHb may transmit signals to OxyR to autoregulate its own biosynthesis, simultaneously activating oxidative stress functions. The activation of OxyR via VHb, reported in the present paper for the first time, suggests the involvement of VHb in transcriptional control of many other genes as well.

  3. Genetic engineering of an industrial strain of Saccharopolyspora erythraea for stable expression of the Vitreoscilla haemoglobin gene (vhb).

    Science.gov (United States)

    Brünker, P; Minas, W; Kallio, P T; Bailey, J E

    1998-09-01

    Several Actinomycetes/Streptomycetes expression vectors are described for expression of the Vitreoscilla haemoglobin gene (vhb) in an industrial erythromycin-producing strain of Saccharopolyspora erythraea. Cloning of vhb under the control of either the thiostrepton-inducible PtipA promoter or the constitutive PermE* promoter led to the production of chemically active haemoglobin (VHb) in Streptomyces lividans TK24 transformed with these constructs. However, theplasmids could not be transformed into Sac. erythraea. Transformants of Sac. erythraea and/or exconjugants were obtained using a novel Escherichia coli/Streptomyces shuttle vector comprised of vhb under the control of the PermE* promoter, the Streptomyces plasmid pIJ350 origin of replication, the thiostrepton-resistance gene (tsr) for selection, and the oriT region which is necessary for conjugal transfer. Increased plasmid stability in Sac. erythraea was obtained by construction of a vector for chromosomal integration. This vector contained the Streptomyces phage phi C31 attachment site for chromosomal integration and vhb expressed under the PmerR promoter and was stably maintained in the chromosome of Sac. erythraea. Shake-flask cultivations of the transformed Sac. erythraea strain with the chromosomally integrated vhb gene show that vhb is expressed in an active form. The corresponding amount of erythromycin produced in the vhb-expressing strain was approximately 60% higher relative to the original VHb-negative strain.

  4. Endogenous PttHb1 and PttTrHb, and heterologous Vitreoscilla vhb haemoglobin gene expression in hybrid aspen roots with ectomycorrhizal interaction.

    Science.gov (United States)

    Jokipii, Soile; Häggman, Hely; Brader, Günter; Kallio, Pauli T; Niemi, Karoliina

    2008-01-01

    Present knowledge on plant non-symbiotic class-1 (Hb1) and truncated (TrHb) haemoglobin genes is almost entirely based on herbaceous species while the corresponding tree haemoglobin genes are not well known. The function of these genes has recently been linked with endosymbioses between plants and microbes. In this work, the coding sequences of hybrid aspen (Populus tremulaxtremuloides) PttHb1 and PttTrHb were characterized, indicating that the key residues of haem and ligand binding of both genes were conserved in the deduced amino acid sequences. The expression of PttHb1 and PttTrHb was examined in parallel with that of the heterologous Vitreoscilla haemoglobin gene (vhb) during ectomycorrhiza/ectomycorrhizal (ECM) interaction. Both ECM fungi studied, Leccinum populinum and Xerocomus subtomentosus, enhanced root formation and subsequent growth of roots of all hybrid aspen lines, but only L. populinum was able to form mycorrhizas. Real-time PCR results show that the dual culture with the ECM fungus, with or without emergence of symbiotic structures, increased the expression of both PttHb1 and PttTrHb in the roots of non-transgenic hybrid aspens. PttHb1 and PttTrHb had expression peaks 5 h and 2 d after inoculation, respectively, pointing to different functions for these genes during interaction with root growth-improving fungi. In contrast, ECM fungi were not able to enhance the expression of hybrid aspen endogenous haemoglobin genes in the VHb lines, which may be a consequence of the compensating action of heterologous haemoglobin.

  5. Recombinant E. coli expressing Vitreoscilla haemoglobin prefers ...

    Indian Academy of Sciences (India)

    Under these conditions, the expression levels of proteins involved in central metabolic pathways, cellular adaptation and cell division were also found to be altered. These results imply that Vitreoscilla haemoglobin expression alters aerobic metabolism specifically, in addition to altering proteins involved in other pathways, ...

  6. Enhancement of ethanol production from potato-processing wastewater by engineering Escherichia coli using Vitreoscilla haemoglobin.

    Science.gov (United States)

    Abanoz, K; Stark, B C; Akbas, M Y

    2012-12-01

    Ethanologenic Escherichia coli strain FBR5 was transformed with the Vitreoscilla haemoglobin (VHb) gene (vgb) in two constructs (resulting in strains TS3 and TS4). Strains FBR5, TS3 and TS4 were grown at two scales in LB medium supplemented with potato-processing wastewater hydrolysate. Aeration was varied by changes in the medium volume to flask volume ratio. Parameters measured included culture pH, cell growth, VHb levels and ethanol production. VHb expression in strains TS3 and TS4 was consistently correlated with increases in ethanol production (5-18%) under conditions of low aeration, but rarely did this occur with normal aeration. The increase in ethanol yields under low aeration conditions was the result of enhancement of ethanol produced per unit of biomass rather than enhancement of growth. 'VHb technology' may be a useful adjunct in the production of biofuels from food-processing wastewater. Genetic engineering using Vitreoscilla haemoglobin (VHb) has been shown previously to increase ethanol production by Escherichia coli from fermentation of the sugars in corn fibre hydrolysate. The study reported here demonstrates a similar VHb enhancement of ethanol production by fermentation of the glucose from potato waste water hydrolysate and thus extends the list of sugar containing waste products from which ethanol production may be enhanced by this strategy. © 2012 The Society for Applied Microbiology.

  7. Vitreoscilla Hemoglobin (Vhb) is a Useful Molecular Tool for the Improvement of Waterlogging in Maize

    OpenAIRE

    Hewei Du; Yawen Hu; Xiu Zeng

    2016-01-01

    VHb derived from Vitreoscilla has been widely used to improve the waterlogging tolerance in multiple plants. In this study, VHb gene was transformed into maize by bombardment. Under waterlogging treatment, transgenic VHb maize displayed higher shoot height, longer primary root length, more lateral root number, heavier shoot and root dry weight than their WT. With the present of exogenous VHb gene, maize exhibited enhanced tolerance to waterlogging stress.

  8. Constitutive expression of Vitreoscilla haemoglobin in Sphingomonas elodea to improve gellan gum production.

    Science.gov (United States)

    Wu, X C; Chen, Y M; Li, Y D; Li, O; Zhu, L; Qian, C D; Tao, X L; Teng, Y

    2011-02-01

    To improve a commercially used strain for gellan production by exogenous Vitreoscilla haemoglobin (VHb). VHb gene was expressed in Sphingomonas elodea under the control of constitutive bla promoter. Biochemical activity of expressed VHb was confirmed by CO-difference spectra analysis that exhibited a characteristic absorption maximum at 419 nm. During cultivation, not only enhanced cell growth was detected, but also 20% improvement in gellan production was observed after 48 h of incubation, with a maximum yield of 16·82 g l(-1). Moreover, maximum sucrose conversion efficiency (g gellan per g sucrose) was 57·8, 20% higher than that of the parental strain. We further examined the polysaccharide production of VHb-expressing strain at different aeration levels in Erlenmeyer flasks. Again, in all cases, a significant enhancement of gellan production was observed, and the enhancement was more significant under oxygen-limiting conditions (up to 26·8%). VHb exhibited positive effect on cell growth and gellan yield of S. elodea, especially under hypoxic conditions. This is the first application of VHb as an effective metabolic engineering strategy in S. elodea to regulate cell growth and optimize gellan yield. © 2010 The Authors. Journal of Applied Microbiology © 2010 The Society for Applied Microbiology.

  9. Recombinant E. coli expressing Vitreoscilla haemoglobin prefers aerobic metabolism under microaerobic conditions: a proteome-level study.

    Science.gov (United States)

    Ramachandran, Bini; Dikshit, Kanak Lata; Dharmalingam, Kuppamuthu

    2012-09-01

    Vitreoscilla haemoglobin (VHb) expression in heterologous host was shown to enhance growth and oxygen utilization capabilities under oxygen-limited conditions. The exact mechanism by which VHb enhances the oxygen utilization under oxygen-limiting conditions is still unknown. In order to understand the role of VHb in promoting oxygen utilization, changes in the total protein profile of E. coli expressing the vgb gene under its native promoter was analysed. Two-dimensional difference gel electrophoresis (2D DIGE) was employed to quantify the differentially expressed proteins under oxygen-limiting conditions. Overexpression of proteins involved in aerobic metabolic pathways and suppression of proteins involved in non-oxidative metabolic pathways shown in this study indicates that the cells expressing VHb prefer aerobic metabolic pathways even under oxygen limitation. Under these conditions, the expression levels of proteins involved in central metabolic pathways, cellular adaptation and cell division were also found to be altered. These results imply that Vitreoscilla haemoglobin expression alters aerobic metabolism specifically, in addition to altering proteins involved in other pathways, the significance of which is not clear as of now.

  10. Recombinant E. coli expressing Vitreoscilla haemoglobin prefers ...

    Indian Academy of Sciences (India)

    Supplementary section 2. KEGG pathway analysis of proteins that were differentially expressed under aerobic and micro- aerobic conditions in VHb expressing E. coli. Pathway. Aerobiosis. Up. Down. Up. Microaerobiosis. Down. Biosynthesis of secondary metabolites (ecx01110). sdhB, pckA, gnd, icdA. purC, glyA. pckA ...

  11. Chimeric Vitreoscilla Hemoglobin (VHb) Carrying a Flavoreductase Domain Relieves Nitrosative Stress in Escherichia coli: New Insight into the Functional Role of VHb

    OpenAIRE

    Kaur, Ramandeep; Pathania,Ranjana; Sharma, Vishwamitra; Mande, Shekhar C.; Dikshit, Kanak L.

    2002-01-01

    Dimeric hemoglobin (VHb) from the bacterium Vitreoscilla sp. strain C1 displays 30 to 53% sequence identity with the heme-binding domain of flavohemoglobins (flavoHbs) and exhibits the presence of potential sites for the interaction with its FAD/NADH reductase partner. The intersubunit contact region of VHb indicates a small interface between two monomers of the homodimer, suggesting that the VHb dimers may dissociate easily. Gel filtration chromatography of VHb exhibited a 25 to 30% monomeri...

  12. Nitrite inhibition of Vitreoscilla hemoglobin (VHb) in recombinant E. coli: direct evidence that VHb enhances recombinant protein production.

    Science.gov (United States)

    Aydin, S; Webster, D A; Stark, B C

    2000-01-01

    Bacteria engineered with the gene (vgb) encoding Vitreoscilla hemoglobin (VHb) typically produce more protein than unengineered cells, and it has generally been assumed that VHb is responsible for this effect. Here, using matched strains of E. coli that bear a recombinant alpha-amylase gene (MK57) or the alpha-amylase gene and vgb (MK79), we provide evidence supporting this assumption. Sodium nitrite (which is known to inhibit heme proteins) was tested over a range of concentrations regarding effects on growth, alpha-amylase production, respiration, and VHb function in MK57 and MK79. Nitrite concentrations were identified at which respiration of cell membranes was inhibited only slightly and to approximately equal degrees in both strains, while whole cell respiration was inhibited to a greater extent and about twice as much in MK79 as MK57. This suggests that these concentrations inhibit VHb while having a much smaller effect on cytochrome oxidase. Direct measurements of VHb showed, in fact, that the same nitrite concentrations greatly decreased the levels of active (ferrous) and, to a somewhat lesser extent, total (ferrous plus ferric) VHb in MK79. Finally, these same nitrite concentrations reversed the advantage regarding alpha-amylase production of MK79 over MK57 seen at 0 mM nitrite, linking the presence of active VHb with the increase in alpha-amylase production.

  13. Error-prone PCR of Vitreoscilla hemoglobin (VHb) to support the growth of microaerobic Escherichia coli.

    Science.gov (United States)

    Andersson, C I; Holmberg, N; Farrés, J; Bailey, J E; Bülow, L; Kallio, P T

    2000-11-20

    Expression of the gene encoding bacterial hemoglobin (VHb) from Vitreoscilla has been previously used to improve recombinant cell growth and enhance product formation under microaerobic conditions. It is very likely that the properties of VHb are not optimized for foreign hosts; therefore, we used error-prone PCR to generate a number of randomly mutated vhb genes to be expressed and studied in Escherichia coli. In addition, the mutated VHb proteins also contained an extension of eight residues (MTMITPSF) at the amino terminus. VHb mutants were screened for improved growth properties under microaerobic conditions and 15 clones expressing mutated hemoglobin protein were selected for further characterization and cultivated in a microaerobic bioreactor to analyze the physiological effects of novel VHb proteins on cell growth. The expression of four VHb mutants, carried by pVM20, pVM50, pVM104, and pVM134, were able to enhance microaerobic growth of E. coli by approximately 22%, 155%, 50%, and 90%, respectively, with a concomitant decrease of acetate excretion into the culture medium. The vhb gene in pVM20 contains two mutations substituting residues Glu19(A17) and Glu137(H23) to Gly. pVM50 expresses a VHb protein carrying two mutations: His36(C1) to Arg36 and Gln66(E20) to Arg66. pVM104 and pVM134 express VHb proteins carrying the mutations Ala56(E10) to Gly and Ile24(B5) to Thr, respectively. Our experiments also indicate that the positive effects elicited by mutant VHb-expression from pVM20 and pVM50 are linked to the peptide tail. Removal of the N-terminal sequence reduced cell growth approximately 23% and 53%, respectively, relative to wild-type controls. These results clearly demonstrate that it is possible to obtain mutated VHb proteins with improved characteristics for improving microaerobic growth of E. coli by using combined mutation techniques, addition of a peptide tail, and random error-prone PCR. Copyright 2000 John Wiley & Sons, Inc.

  14. Chimeric Vitreoscilla hemoglobin (VHb) carrying a flavoreductase domain relieves nitrosative stress in Escherichia coli: new insight into the functional role of VHb.

    Science.gov (United States)

    Kaur, Ramandeep; Pathania, Ranjana; Sharma, Vishwamitra; Mande, Shekhar C; Dikshit, Kanak L

    2002-01-01

    Dimeric hemoglobin (VHb) from the bacterium Vitreoscilla sp. strain C1 displays 30 to 53% sequence identity with the heme-binding domain of flavohemoglobins (flavoHbs) and exhibits the presence of potential sites for the interaction with its FAD/NADH reductase partner. The intersubunit contact region of VHb indicates a small interface between two monomers of the homodimer, suggesting that the VHb dimers may dissociate easily. Gel filtration chromatography of VHb exhibited a 25 to 30% monomeric population of VHb, at a low protein concentration (0.05 mg/ml), whereas dimeric VHb remained dominant at a high protein concentration (10 mg/ml). The structural characteristics of VHb suggest that the flavoreductase can also associate and interact with VHb in a manner analogous to flavoHbs and could yield a flavo-VHb complex. To unravel the functional relevance of the VHb-reductase association, the reductase domain of flavoHb from Ralstonia eutropha (formerly Alcaligenes eutrophus) was genetically engineered to generate a VHb-reductase chimera (VHb-R). The physiological implications of VHb and VHb-R were studied in an hmp mutant of Escherichia coli, incapable of producing any flavoHb. Cellular respiration the of the hmp mutant was instantaneously inhibited in the presence of 10 microM nitric oxide (NO) but remained insensitive to NO inhibition when these cells produced VHb-R. In addition, E. coli overproducing VHb-R exhibited NO consumption activity that was two to three times slower in cells overexpressing only VHb and totally undetectable in the control cells. A purified preparation of VHb-R exhibited a three- to fourfold-higher NADH-dependent NO uptake activity than that of VHb alone. Overproduction of VHb-R in the hmp mutant of E. coli conferred relief from the toxicity of sodium nitroprusside, whereas VHb alone provided only partial benefit under similar condition, suggesting that the association of VHb with reductase improves its capability to relieve the deleterious

  15. Vitreoscilla hemoglobin (VHb) overexpression increases hypoxia tolerance in zebrafish (Danio rerio).

    Science.gov (United States)

    Guan, Bo; Ma, Hong; Wang, Yaping; Hu, Yuanlei; Lin, Zhongping; Zhu, Zuoyan; Hu, Wei

    2011-04-01

    Aquaculture farming may benefit from genetically engineering fish to tolerate environmental stress. Here, we used the vector pCVCG expressing the Vitreoscilla hemoglobin (vhb) gene driven by the common carp β-actin promoter to create stable transgenic zebrafish. The survival rate of the 7-day-old F(2) transgenic fish was significantly greater than that of the sibling controls under 2.5% O(2) (dissolved oxygen (DO), 0.91 mg/l). Meanwhile, we investigated the relative expression levels of several marker genes (hypoxia-inducible factor alpha 1, heat shock cognate 70-kDa protein, erythropoietin, beta and alpha globin genes, lactate dehydrogenase, catalase, superoxide dismutase, and glutathione peroxidase) of transgenic fish and siblings after hypoxia exposure for 156 h. The expression profiles of the vhb transgenic zebrafish revealed that VHb could partially alleviate the hypoxia stress response to improve the survival rate of the fish. These results suggest that that vhb gene may be an efficient candidate for genetically modifying hypoxia tolerance in fish.

  16. Biochemical and cellular investigation of Vitreoscilla hemoglobin (VHb) variants possessing efficient peroxidase activity.

    Science.gov (United States)

    Isarankura-Na-Ayudhya, Chartchalerm; Tansila, Natta; Worachartcheewan, Apilak; Bülow, Leif; Prachayasittikul, Virapong

    2010-03-01

    Peroxidase-like activity of Vitreoscilla hemoglobin (VHb) has been recently disclosed. To maximize such activity, two catalytically conserved residues (histidine and arginine) found in distal pocket of peroxidases have successfully been introduced into that of the VHb. Fifteen-fold increase in catalytic constant (k(cat)) was obtained in P54R variant, which was presumably attributable to the lower rigidity and higher hydrophilicity of distal cavity arising from substitution of proline to arginine. None of the modifications altered the affinity towards either H(2)O(2) or ABTS substrate. Spectroscopic studies revealed that VHb variants harboring T29H mutation apparently demonstrated the spectral shift in both ferric and ferrous forms (406-408 to 411 nm and 432 to 424-425 nm, respectively). All VHb proteins in ferrous state had lambda(soret) peak at approximately 419 nm following the carbon monoxide (CO) binding. Expression of P54R mutant mediated the down-regulation of iron superoxide dismutase (FeSOD) as identified by 2-dimensional gel electrophoresis (2-DE) and peptide mass fingerprinting (PMF). According to the high peroxidase activity of P54R, it could effectively eliminate autoxidation-derived H2O2, which is a cause of heme degradation and iron release. This decreased the iron availability and consequently reduced the formation of Fe(2+)-ferric uptake regulator protein (Fe(2+)-Fur), an inducer of FeSOD expression.

  17. Chimeric antibody-binding Vitreoscilla hemoglobin (VHb) mediates redox-catalysis reaction: new insight into the functional role of VHb.

    Science.gov (United States)

    Suwanwong, Yaneenart; Kvist, Malin; Isarankura-Na-Ayudhya, Chartchalerm; Tansila, Natta; Bulow, Leif; Prachayasittikul, Virapong

    2006-08-22

    Experimentation was initiated to explore insight into the redox-catalysis reaction derived from the heme prosthetic group of chimeric Vitreoscilla hemoglobin (VHb). Two chimeric genes encoding chimeric VHbs harboring one and two consecutive sequences of Fc-binding motif (Z-domain) were successfully constructed and expressed in E. coli strain TG1. The chimeric ZVHb and ZZVHb were purified to a high purity of more than 95% using IgG-Sepharose affinity chromatography. From surface plasmon resonance, binding affinity constants of the chimeric ZVHb and ZZVHb to human IgG were 9.7 x 10(7) and 49.1 x 10(7) per molar, respectively. More importantly, the chimeric VHbs exhibited a peroxidase-like activity determined by activity staining on native PAGE and dot blotting. Effects of pH, salt, buffer system, level of peroxidase substrate and chromogen substrate were determined in order to maximize the catalytic reaction. From our findings, the chimeric VHbs displayed their maximum peroxidase-like activity at the neutral pH (approximately 7.0) in the presence of high concentration (20-40 mM) of hydrogen peroxide. Under such conditions, the detection limit derived from the calibration curve was at 250 ng for the chimeric VHbs, which was approximately 5-fold higher than that of the horseradish peroxidase. These findings reveal the novel functional role of Vitreoscilla hemoglobin indicating a high trend of feasibility for further biotechnological and medical applications.

  18. Fnr, a global transcriptional regulator of Escherichia coli, activates the Vitreoscilla hemoglobin (VHb) promoter and intracellular VHb expression increases cytochrome d promoter activity.

    Science.gov (United States)

    Tsai, P S; Kallio, P T; Bailey, J E

    1995-01-01

    The oxygen-regulated promoter (Pvhb) of the Vitreoscilla hemoglobin gene has been applied to direct high-level expression of several cloned proteins, including Vitreoscilla hemoglobin (VHb), which improves productivity of many aerobic processes. In an effort to gain a better understanding of the regulation of Pvhb, and to guide further optimization of this technology, we investigated whether the Escherichia coli global regulatory molecules Fnr and the Arc system (ArcA and ArcB), which control the expression of various genes under either aerobic or anaerobic conditions, also regulate Pvhb activity in E. coli. The activity of Pvhb and the expression of VHb in E. coli were activated by Fnr, but were relatively unaffected by the Arc system under microaerobic conditions (DO less than 2% air saturation). We also examined the possibility of VHb affecting cytochrome d promoter activity during microaerobiosis. The presence of VHb increased the activity of beta-galactosidase from a cytochrome d promoter-lacZ fusion by 1.5-fold. This indicates that VHb affects oxygen-regulated transcription of E. coli genes and may contribute to the modified physiology observed in VHb-expressing E. coli.

  19. Heterologous expression of Vitreoscilla hemoglobin (VHb) and cultivation conditions affect the alkaloid profile of Hyoscyamus muticus hairy roots.

    Science.gov (United States)

    Wilhelmson, Annika; Häkkinen, Suvi T; Kallio, Pauli T; Oksman-Caldentey, Kirsi-Marja; Nuutila, Anna Maria

    2006-01-01

    Fast-growing hairy root cultures of Hyoscyamus muticus induced by Agrobacterium rhizogenes offer a potential production system for tropane alkaloids. Oxygen deficiency has been shown to limit growth and biomass accumulation of hairy roots, whereas little experimental data is available on the effect of oxygen on alkaloid production. We have investigated the effect of Vitreoscilla hemoglobin (VHb) expression and cultivation conditions on the complete alkaloid profile of H. muticus hairy roots in shake flasks and in a laboratory scale bioreactor. We optimized the growth medium composition and studied the effects of sucrose, ammonium, nitrate, and phosphate on growth and alkaloid production. Maximum biomass accumulation was achieved with the highest and maximum hyoscyamine content with the lowest sucrose concentration. The optimum nitrate concentration for growth was higher for the VHb line than the control. Neither VHb expression nor aeration improved the hyoscyamine content significantly, thus suggesting that hyoscyamine biosynthesis is not limited by oxygen availability. Interestingly, the effect of VHb expression on the alkaloid profile was slightly different from that of aeration. VHb expression did not affect the concentrations of cuscohygrine, which was increased by aeration. Therefore, the effect of VHb is probably not related only to its ability to increase the intracellular effective oxygen concentration.

  20. Construction and Characterization of Vitreoscilla Hemoglobin (VHb) with Enhanced Peroxidase Activity for Efficient Degradation of Textile Dye.

    Science.gov (United States)

    Zhang, Zidong; Li, Wei; Li, Haichao; Zhang, Jing; Zhang, Yuebin; Cao, Yufeng; Ma, Jianzhang; Li, Zhengqiang

    2015-09-01

    Pollution resulting from the discharge of textile dyes into water systems has become a major global concern. Because peroxidases are known for their ability to decolorize and detoxify textile dyes, the peroxidase activity of Vitreoscilla hemoglobin (VHb) has recently been studied. It is found that VHb and variants of this enzyme show great promise for enzymatic decolorization of dyes and may play a role in achieving their successful removal from industrial wastewater. The level of VHb peroxidase activity correlates with two amino acid residues present within the conserved distal pocket, at positions 53 and 54. In this work, sitedirected mutagenesis of these residues was performed and resulted in improved VHb peroxidase activity. The double mutant, Q53H/P54C, shows the highest dye decolorization and removal efficiency, with 70% removal efficiency within 5 min. UV spectral studies of Q53H/P54C reveals a more compact structure and an altered porphyrin environment (λSoret = 413 nm) relative to that of wild-type VHb (λSoret = 406), and differential scanning calorimetry data indicate that the VHb variant protein structure is more stable. In addition, circular dichroism spectroscopic studies indicate that this variant's increased protein structural stability is due to an increase in helical structure, as deduced from the melting temperature, which is higher than 90°C. Therefore, the VHb variant Q53H/P54C shows promise as an excellent peroxidase, with excellent dye decolorization activity and a more stable structure than wild-type VHb under high-temperature conditions.

  1. Functional implications of the proximal site hydrogen bonding network in Vitreoscilla hemoglobin (VHb): role of Tyr95 (G5) and Tyr126 (H12).

    Science.gov (United States)

    Kaur, Ramandeep; Ahuja, Sandhya; Anand, Arvind; Singh, Balwinder; Stark, Benjamin C; Webster, Dale A; Dikshit, Kanak L

    2008-10-15

    Although Vitreoscilla hemoglobin (VHb) carries a conventional globin fold, its proximal site geometry is unique in having a hydrogen-bonding network between proximal site residues, HisF8-TyrG5-GluH23 and TyrG5-TyrH12. TyrG5 and TyrH12 were mutated to study their relevance in VHb function. VHb G5 mutants (Tyr95Phe and Tyr95Leu showed no stable oxyform and nitric oxide dioxygenase activity, whereas, VHb H12 mutants (Tyr126Phe and Tyr126Leu) displayed little change in their oxygen affinity indicating a crucial role of Tyr95 in protein function. The VHb H12 mutant, Tyr126Leu, enhanced the intracellular pool of oxygen and cell growth better than VHb. Molecular modeling suggests that the replacement of tyrosine with leucine in Tyr126Leu creates an opening on the protein surface that may facilitate oxygen diffusion and accumulation.

  2. Intracellular expression of Vitreoscilla hemoglobin (VHb) enhances total protein secretion and improves the production of alpha-amylase and neutral protease in Bacillus subtilis.

    Science.gov (United States)

    Kallio, P T; Bailey, J E

    1996-01-01

    In an attempt to alleviate oxygen limitation during batch cultivations, a heterologous bacterial hemoglobin gene (vhb) of Vitreoscilla was introduced into Bacillus subtilis. Biochemically active VHb, as demonstrated by immunoblot analysis and carbon monoxide binding assay, was intracellularly expressed in B. subtilis from an inducible promoter-repressor (spac-lacI). Expression of VHb in oxygen-limited B. subtilis batch bioreactor cultivations enhanced cell growth, decreased accumulation of acetate, and increased the total protein secreted into the culture medium by approximately 1.5-fold. In addition, VHb-expressing B. subtilis cultures exhibited increases of approximately 30% and 5-17% in neutral protease activity and alpha-amylase activity, respectively, relative to the parental, VHb-free strain.

  3. [Recent advances in the study of Vitreoscilla hemoglobin(VHb) and related proteins - cloning, expression and physiological actions in heterologons hosts and in transgenic tobacco plants].

    Science.gov (United States)

    Chiao, J S

    2003-07-01

    The first bacterial hemoglobin(VHb) was found in a strictly aerobic bacterium, Vitreoscilla strain C1, occurring in marshes low in oxygen, but rich in organic matter. The hemoglobin gene is induced under low oxygen tension and may amount to 20 times as high. The expression of VHb promotes cell growth, protein biosynthesis and primary and secondary metabolism of the host cells, because the increased intracellular oxygen accelerates both the function of respiratory chain and terminal oxidases. The serial action of increased oxygen concentration is elucidated through yeast two hybrid system and a model is proposed. In addition, novel globin proteins known as flavohemoglobins have been isolated from various procaryotes and eucaryotes, with a N-terminal similar to VHb and C-terminal with reductase activity. Primary study shows that flavohemoglobin proteins exhibit similar function as VHb and also protection effect to nitrosative stress. Further work is needed to learn more about the physiology of these flavohemoglobins. The most remarkable physiological effects of VHb are exihibited in transgenic tobacco plants, including accelerated seed germination and growth in plant, increased synthesis of chlorophyll and dry weight. Without doubt, these effects are brought about through the increased oxygen supply to plant cells. It is deemed that VHb transgenic tobacco is a forerunner for transgenic crops and VHb may be a valuable route for staple seed crops.

  4. Effects of carbon source and Vitreoscilla hemoglobin (VHb) on the production of beta-galactosidase in Enterobacter aerogenes.

    Science.gov (United States)

    Khleifat, Khaled M; Abboud, Muayad M; Al-Mustafa, Ahmed H; Al-Sharafa, Khalid Y

    2006-10-01

    At fixed concentration (0.5%), lactose and galactose acted as inducers while glucose and other tested carbon sugars showed repression effects on beta-galactosidase production in Enterobacter aerogenes strain. The expression of Vitreoscilla hemoglobin gene (vgb) in this bacterial strain managed to overcome the repression effects as well as improving the induction of beta-galactosidase formation by carbon sources. In parallel, the bacterial O(2) consumption was increased correspondingly to the vgb induction of beta-galactosidase synthesis. When Enterobacter aerogenes strains were grown at the incubation temperature 42 degrees C, about 5-fold higher enzyme productivity was obtained than with a similar incubation at 37 degrees C. The bacterial growth expressed as biomass yield had a different optimum temperature and was not influenced to the same extent by variations in the carbon sources. These data are discussed in terms of proposed enhancement in beta-galactosidase productivity by vgb expression as well as its significance to improve the technology of whey processing.

  5. THE BIOCHEMISTRY OF VITREOSCILLA HEMOGLOBIN

    Directory of Open Access Journals (Sweden)

    Benjamin C. Stark

    2012-10-01

    Full Text Available The hemoglobin (VHb from Vitreoscilla was the first bacterial hemoglobin discovered. Its structure and function have been extensively investigated, and engineering of a wide variety of heterologous organisms to express VHb has been performed to increase their growth and productivity. This strategy has shown promise in applications as far-ranging as the production of antibiotics and petrochemical replacements by microorganisms to increasing stress tolerance in plants. These applications of “VHb technology” have generally been of the “black box” variety, wherein the endpoint studied is an increase in the levels of a certain product or improved growth and survival. Their eventual optimization, however, will require a thorough understanding of the various functions and activities of VHb, and how VHb expression ripples to affect metabolism more generally. Here we review the current knowledge of these topics. VHb's functions all involve oxygen binding (and often delivery in one way or another. Several biochemical and structure-function studies have provided an insight into the molecular details of this binding and delivery. VHb activities are varied. They include supply of oxygen to oxygenases and the respiratory chain, particularly under low oxygen conditions; oxygen sensing and modulation of transcription factor activity; and detoxification of NO, and seem to require interactions of VHb with “partner proteins”. VHb expression affects the levels of ATP and NADH, although not enormously. VHb expression may affect the level of many compounds of intermediary metabolism, and, apparently, alters the levels of expression of many genes. Thus, the metabolic changes in organisms engineered to express VHb are likely to be numerous and complicated.

  6. The Biochemistry of Vitreoscilla hemoglobin.

    Science.gov (United States)

    Stark, Benjamin C; Dikshit, Kanak L; Pagilla, Krishna R

    2012-01-01

    The hemoglobin (VHb) from Vitreoscilla was the first bacterial hemoglobin discovered. Its structure and function have been extensively investigated, and engineering of a wide variety of heterologous organisms to express VHb has been performed to increase their growth and productivity. This strategy has shown promise in applications as far-ranging as the production of antibiotics and petrochemical replacements by microorganisms to increasing stress tolerance in plants. These applications of "VHb technology" have generally been of the "black box" variety, wherein the endpoint studied is an increase in the levels of a certain product or improved growth and survival. Their eventual optimization, however, will require a thorough understanding of the various functions and activities of VHb, and how VHb expression ripples to affect metabolism more generally. Here we review the current knowledge of these topics. VHb's functions all involve oxygen binding (and often delivery) in one way or another. Several biochemical and structure-function studies have provided an insight into the molecular details of this binding and delivery. VHb activities are varied. They include supply of oxygen to oxygenases and the respiratory chain, particularly under low oxygen conditions; oxygen sensing and modulation of transcription factor activity; and detoxification of NO, and seem to require interactions of VHb with "partner proteins". VHb expression affects the levels of ATP and NADH, although not enormously. VHb expression may affect the level of many compounds of intermediary metabolism, and, apparently, alters the levels of expression of many genes. Thus, the metabolic changes in organisms engineered to express VHb are likely to be numerous and complicated.

  7. Improved poly-gamma-glutamic acid production by chromosomal integration of the Vitreoscilla hemoglobin gene (vgb) in Bacillus subtilis.

    Science.gov (United States)

    Su, Yishan; Li, Xia; Liu, Qingzhi; Hou, Zhongwen; Zhu, Xiqiang; Guo, Xueping; Ling, Peixue

    2010-06-01

    In order to alleviate oxygen limitation and improve the yield of poly-gamma-glutamic acid (gamma-PGA) during fermentation, the Vitreoscilla hemoglobin gene (vgb) was integrated into the chromosome of Bacillus subtilis and expressed during gamma-PGA production. The activity of the expressed Vitreoscilla hemoglobin (VHb) was confirmed by CO-difference spectrum. Expression of VHb enhanced cell growth under high viscosity fermentation conditions 1.26-fold and increased the yield of gamma-PGA 2.07-fold. These results indicate that the expression of VHb could be advantageous in high viscosity fermentation media. (c) 2010 Elsevier Ltd. All rights reserved.

  8. Improvement of Vitreoscilla hemoglobin function by Bacillus licheformis glutamate-specific endopeptidase treatment.

    Science.gov (United States)

    Ye, Wei; Liu, Min; Ma, Yi; Yang, Juan; Wang, Haiying; Wang, Xinhui; Wang, Jufang; Wang, Xiaoning

    2012-11-01

    Vitreoscilla hemoglobin (VHb) was widely used in metabolic engineering to improve oxygen utilization in the low oxygen environment. It is sometimes necessary to remove affinity tags because they may impede functions of target proteins. Here we report an efficient method employing Glutamate-specific endopeptidase from Bacillus licheformis (GSE-BL) to perform the cleavage between VHb and His-tag. The optimal length of GSE-BL treatment was 15min. Results of SDS-PAGE and western blot demonstrated that the His-tag of VHb-His(6) was nearly completely removed, the purity of VHb was enhanced from 74% to 99.5%, and the yield of tagless VHb from VHb-His(6) was 92.2%. Results of CO difference spectrum suggested that tagless VHb was more prone to bind to CO compared with VHb-His(6). It was observed that tagless VHb displayed higher catalase activity than VHb-His(6). The enhancement of welan gum yield was more significant by addition of tagless VHb compared with addition of VHb-His(6). This method can be utilized to mass-produce tagless VHb, thus widening the application of VHb in various industries. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Expression of Vitreoscilla hemoglobin enhances cell growth and dihydroxyacetone production in Gluconobacter oxydans.

    Science.gov (United States)

    Li, Minghua; Wu, Jian; Lin, Jinping; Wei, Dongzhi

    2010-11-01

    Dihydroxyacetone (DHA) is an important ketose sugar, which is extensively used in the cosmetic, chemical, and pharmaceutical industries. DHA has been industrially produced by Gluconobacter oxydans with a high demand of oxygen. To improve the production of DHA, the gene vgb encoding Vitreoscilla hemoglobin (VHb) was successfully introduced into G. oxydans, where it was stably maintained, and expressed at about 76.0 nmol/g dry cell weight. Results indicated that the constitutively expressed VHb improved cell growth and DHA production in G. oxydans under different aeration conditions. Especially at low aeration rates, the VHb-expressing strain (VHb(+)) displayed 23.13% more biomass and 37.36% more DHA production than those of VHb-free strain (VHb(-)) after 32 h fermentation in bioreactors. In addition, oxygen uptake rate (OUR) was also increased in VHb(+) strain relative to the control strain during fermentation processes.

  10. Expression of Vitreoscilla hemoglobin enhances production of arachidonic acid and lipids in Mortierella alpina.

    Science.gov (United States)

    Zhang, Huidan; Feng, Yingang; Cui, Qiu; Song, Xiaojin

    2017-08-30

    Arachidonic acid (ARA, C20:4, n-6), which belongs to the omega-6 series of polyunsaturated fatty acids and has a variety of biological activities, is commercially produced in Mortierella alpina. Dissolved oxygen or oxygen utilization efficiency is a critical factor for Mortierella alpina growth and arachidonic acid production in large-scale fermentation. Overexpression of the Vitreoscilla hemoglobin gene is thought to significantly increase the oxygen utilization efficiency of the cells. An optimized Vitreoscilla hemoglobin (VHb) gene was introduced into Mortierella alpina via Agrobacterium tumefaciens-mediated transformation. Compared with the parent strain, the VHb-expressing strain, termed VHb-20, grew faster under both limiting and non-limiting oxygen conditions and exhibited dramatic changes in cell morphology. Furthermore, VHb-20 produced 4- and 8-fold higher total lipid and ARA yields than those of the wild-type strain under a microaerobic environment. Furthermore, ARA production of VHb-20 was also 1.6-fold higher than that of the wild type under normal conditions. The results demonstrated that DO utilization was significantly increased by expressing the VHb gene in Mortierella alpina. The expression of VHb enhances ARA and lipid production under both lower and normal dissolved oxygen conditions. This study provides a novel strategy and an engineered strain for the cost-efficient production of ARA.

  11. High-efficiency generation of monoclonal antibody for Vitreoscilla hemoglobin protein.

    Science.gov (United States)

    Kim, Eun Mi; Kim, Myung-Hee; Kim, Min-Gon; Kim, Sang-Woo; Ro, Hyeon-Su

    2012-02-01

    Bacterial hemoglobin from Vitreoscilla (VHb) is recognized as a good fusion protein for the soluble expression of foreign protein. In this study, we generated a monoclonal antibody (MAb) against VHb for its detection. For the rapid screening of MAb, a protein chip technology based on the Alexa-488 (A488) dye labeling method was introduced. In order to fabricate the chip, the VHb protein was chemically coupled to the chip surface and then the culture supernatants of 84 hybridoma cell lines were spotted onto the VHb chip. The bound MAbs were measured by A488- modified anti-mouse IgG. A single spot (MAb A10) exhibited significantly high signal intensity. The immunoblot analysis evidenced that the MAb A10 can detect VHb-fused proteins with high specificity.

  12. Effective ethanol production from whey powder through immobilized E. coli expressing Vitreoscilla hemoglobin.

    Science.gov (United States)

    Sar, Taner; Stark, Benjamin C; Yesilcimen Akbas, Meltem

    2017-03-04

    Ethanol production from whey powder was investigated by using free as well as alginate immobilized E. coli and E. coli expressing Vitreoscilla hemoglobin (VHb) in both shake flask and fermenter cultures. Media with varying levels of whey (lactose contents of 3%, 5%, 8% or 15%) and yeast extract (0.3% or 0.5%) were evaluated with fermentation times of 48-96 h. Immobilization and VHb expression resulted in higher ethanol production with all media; the increases ranged from 2% to 89% for immobilization and from 2% to 182% for VHb expression. It was determined that growth medium containing 8% lactose with 0.5% yeast extract yielded the highest ethanol production for free or immobilized strains, with or without VHb expression, in both shake flask and fermenter cultures. Immobilization with alginate was found to be a promising process for ethanol production by VHb-expressing ethanologenic E. coli.

  13. Recombinant E. coli expressing Vitreoscilla haemoglobin prefers ...

    Indian Academy of Sciences (India)

    2012-08-13

    Aug 13, 2012 ... citrate cycle, glycolysis/gluconeogenesis and synthesis of secondary metabolites (supplementary section 2). Succinate dehydrogenase (1.5-fold), isocitrate dehydroge- nase (2.3-fold), phosphoenolpyruvate carboxykinase (1.5- fold) and 6-phosphogluconate dehydrogenase (2.2-fold), involved in ...

  14. Engineering of ethanolic E. coli with the Vitreoscilla hemoglobin gene enhances ethanol production from both glucose and xylose.

    Science.gov (United States)

    Sanny, Tony; Arnaldos, Marina; Kunkel, Stephanie A; Pagilla, Krishna R; Stark, Benjamin C

    2010-11-01

    Escherichia coli strain FBR5, which has been engineered to direct fermentation of sugars to ethanol, was further engineered, using three different constructs, to contain and express the Vitreoscilla hemoglobin gene (vgb). The three resulting strains expressed Vitreoscilla hemoglobin (VHb) at various levels, and the production of ethanol was inversely proportional to the VHb level. High levels of VHb were correlated with an inhibition of ethanol production; however, the strain (TS3) with the lowest VHb expression (approximately the normal induced level in Vitreoscilla) produced, under microaerobic conditions in shake flasks, more ethanol than the parental strain (FBR5) with glucose, xylose, or corn stover hydrolysate as the predominant carbon source. Ethanol production was dependent on growth conditions, but increases were as high as 30%, 119%, and 59% for glucose, xylose, and corn stover hydrolysate, respectively. Only in the case of glucose, however, was the theoretical yield of ethanol by TS3 greater than that achieved by others with FBR5 grown under more closely controlled conditions. TS3 had no advantage over FBR5 regarding ethanol production from arabinose. In 2 L fermentors, TS3 produced about 10% and 15% more ethanol than FBR5 for growth on glucose and xylose, respectively. The results suggest that engineering of microorganisms with vgb/VHb could be of significant use in enhancing biological production of ethanol.

  15. pH-induced quaternary assembly of Vitreoscilla hemoglobin: the monomer exhibits better peroxidase activity.

    Science.gov (United States)

    Li, Wei; Zhang, Yubin; Xu, Haoran; Wu, Lei; Cao, Yufeng; Zhao, Haifeng; Li, Zhengqiang

    2013-10-01

    pH-dependent (pH6.0-8.0) quaternary structural changes of ferric Vitreoscilla hemoglobin (VHb) have been investigated using dynamic light scattering. The VHb exhibits a monomeric state under neutral conditions at pH7.0, while the protein forms distinct homodimeric species at pH6.0 and 8.0, respectively. The dissociation constant obtained using the Bio-Layer Interferometry technology indicates that, at pH7.0, the monomer-monomer dissociation of VHb is about 6-fold or 5-fold higher (KD=6.34μM) compared with that at slightly acidic pH (KD=1.05μM) or slightly alkaline pH (KD=1.22μM). The pH-dependent absorption spectra demonstrate that the heme microenvironment of VHb is sensitive to the changes of pH value. The maximum absorption band of heme group of VHb shifts from 402nm to 407nm when pH changes from 6.0 to 8.0. In addition, the fluorescence emission spectra of VHb, taken at excitation wavelength of 295nm, suggest that the single Trp122 fluorescence quantum yields in VHb are decreased due to the formation of the homodimeric species. However, the circular dichroism spectra data display that the secondary structures of VHb are little affected by pH transitions. The pH-dependent peroxidase activity of VHb was also investigated in this study. The optimum pH for VHb using 2,2'-azino-bis-(3-ethylbenzothiazoline-6-sulfonic acid) as substrate is 7.0, which implies that the monomer state of VHb would exhibit better peroxidase activity than the homodimeric species of VHb at pH6.0 and 8.0. © 2013.

  16. Transgenic tobacco expressing Vitreoscilla hemoglobin exhibits enhanced growth and altered metabolite production.

    Science.gov (United States)

    Holmberg, N; Lilius, G; Bailey, J E; Bülow, L

    1997-03-01

    The gene for Vitreoscilla hemoglobin (VHb) has been introduced and expressed in Nicotiana tabaccum (tobacco). Transgenic tobacco plants expressing VHb exhibited enhanced growth, on average 80-100% more dry weight after 35 days of growth compared to wild-type controls. Furthermore, germination time is reduced from 6-8 days for wild-type tobacco to 3-4 days and the growth phase from germination to flowering was 3-5 days shorter for the VHb-expressing transgenes. Transgenic plants contained, on average, 30-40% more chlorophyll and 34% more nicotine than controls. VHb expression also resulted in an altered distribution of secondary metabolites: In the trangenic tobacco plants anabasine content was decreased 80% relative to control plants.

  17. Applications of the VHb gene vgb for improved microbial fermentation processes.

    Science.gov (United States)

    Wei, Xiao-Xing; Chen, Guo-Qiang

    2008-01-01

    Dissolved oxygen (DO) plays an important role in cell growth, especially in industry-scale microbial production. To alleviate the defects of hypoxic conditions, Vitreoscilla hemoglobin (VHb) has been used to enhance respiration and energy metabolism by promoting oxygen delivery. Heterologous expression of VHb in a variety of hosts has been shown to improve cell growth, protein synthesis, metabolite productivity, and bioremediation under oxygen-restricted conditions. In this chapter, many well-studied areas are presented to illustrate the potential of VHb application in microbial metabolic engineering industry. Also, applications of the vgb promoter have been discussed.

  18. Improved ethanol production from cheese whey, whey powder, and sugar beet molasses by "Vitreoscilla hemoglobin expressing" Escherichia coli.

    Science.gov (United States)

    Akbas, Meltem Yesilcimen; Sar, Taner; Ozcelik, Busra

    2014-01-01

    This work investigated the improvement of ethanol production by engineered ethanologenic Escherichia coli to express the hemoglobin from the bacterium Vitreoscilla (VHb). Ethanologenic E. coli strain FBR5 and FBR5 transformed with the VHb gene in two constructs (strains TS3 and TS4) were grown in cheese whey (CW) medium at small and large scales, at both high and low aeration, or with whey powder (WP) or sugar beet molasses hydrolysate (SBMH) media at large scale and low aeration. Culture pH, cell growth, VHb levels, and ethanol production were evaluated after 48 h. VHb expression in TS3 and TS4 enhanced their ethanol production in CW (21-419%), in WP (17-362%), or in SBMH (48-118%) media. This work extends the findings that "VHb technology" may be useful for improving the production of ethanol from waste and byproducts of various sources.

  19. Intracellular co-expression of Vitreoscilla hemoglobin enhances cell performance and β-galactosidase production in Pichia pastoris.

    Science.gov (United States)

    Wu, Jyh-Ming; Fu, Wei-Chang

    2012-03-01

    Pichia pastoris has been used to produce various recombinant proteins under high oxygen demand conditions. To improve the heterologous production of β-galactosidase, the vgb gene encoding Vitreoscilla hemoglobin (VHb) was co-expressed in the P. pastoris cytoplasm under the control of the methanol-inducible promoter. Co-expression of VHb under different aeration conditions improved cell performance in terms of growth, viability, respiratory rate, and β-galactosidase production. Under limiting aeration conditions, the VHb(+) strain produced 28.2% more biomass but 31.2% less total β-galactosidase activity than the VHb(-) strain. Under non-limiting aeration conditions, the VHb(+) strain showed 20.3% higher cell growth and 9.9% more total β-galactosidase activity than the VHb(-) strain. Moreover, under these conditions, the VHb(+) strain was 7.7% more viable and had a 28.2% higher oxygen uptake rate (OUR) than the VHb(-) strain. Evidently, VHb can enhance the OUR and promote methanol metabolism, thereby improving cell performance and β-galactosidase production. Copyright © 2011 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  20. Aerobic expression of Vitreoscilla hemoglobin improves the growth performance of CHO-K1 cells.

    Science.gov (United States)

    Juárez, Mariana; González-De la Rosa, Claudia H; Memún, Elisa; Sigala, Juan-Carlos; Lara, Alvaro R

    2017-03-01

    Inefficient carbon metabolism is a relevant issue during the culture of mammalian cells for the production of biopharmaceuticals. Therefore, cell engineering strategies to improve the metabolic and growth performance of cell lines are needed. The expression of Vitreoscilla stercoraria hemoglobin (VHb) has been shown to significantly reduce overflow metabolism and improve the aerobic growth of bacteria. However, the effects of VHb on mammalian cells have been rarely studied. Here, the impact of VHb on growth and lactate accumulation during CHO-K1 cell culture was investigated. For this purpose, CHO-K1 cells were transfected with plasmids carrying the vgb or gfp gene to express VHb or green fluorescence protein (GFP), respectively. VHb expression increased the specific growth rate and biomass yields on glucose and glutamine by 60 %, and reduced the amount of lactate produced per cell by 40 %, compared to the GFP-expression controls. Immunofluorescence microscopy showed that VHb is distributed in the cytoplasm and organelles, which support the hypothesis that VHb could serve as an oxygen carrier, enhancing aerobic respiration. These results are useful for the development of better producing cell lines for industrial applications. Copyright © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Improving cellulase production in submerged fermentation by the expression of a Vitreoscilla hemoglobin in Trichoderma reesei.

    Science.gov (United States)

    Lin, Jie; Zhang, Xiamei; Song, Bingran; Xue, Wei; Su, Xiaoyun; Chen, Xiuzhen; Dong, Zhiyang

    2017-11-15

    Trichoderma reesei is well known as an industrial workhorse fungus in cellulase production. The low dissolved oxygen supply in the highly viscous medium of T. reesei remains a major bottleneck that hampers growth and cellulase production in submerged fermentation. Vitreoscilla hemoglobin (VHb) has been demonstrated to improve metabolism and protein production in different heterologous hosts under hypoxic conditions, but the use of VHb in T. reesei remains uninvestigated. This study examines the effect of VHb in improving T. reesei performance in submerged fermentation. The VHb gene (vgb)-expressing cassette was successfully transformed into the TU-6 strain, integrated into the genome of T. reesei, and functionally expressed with biological activity, which was confirmed by carbon monoxide difference analysis. Compared to the parent strain, the expression of VHb increased the glucose consumption rate of the transformant. Moreover, in cellulase-inducing medium total protein secretion of the VHb expressing strain was 2.2-fold of the parental strain and the filter paper cellulase activity was increased by 58% under oxygen-limiting conditions. In summary, our results demonstrate that VHb has beneficial effects on improving total protein secretion and cellulase activity of T. reesei in submerged fermentation.

  2. Intracellular expression of Vitreoscilla hemoglobin improves production of Yarrowia lipolytica lipase LIP2 in a recombinant Pichia pastoris.

    Science.gov (United States)

    Wang, Xiaofeng; Sun, Yongchuan; Shen, Xuguang; Ke, Feng; Zhao, Heyun; Liu, Yun; Xu, Li; Yan, Yunjun

    2012-01-05

    The Yarrowia lipolytica lipase LIP2 (YlLIP2) gene lip2 and Vitreoscilla hemoglobin gene vgb were co-expressed in Pichia pastoris, both under the control of AOX1 promoter, in order to alleviate respiration limitation under conditions of high cell-density fermentation and enhance YlLIP2 production. The results showed that recombinant P. pastoris strains harboring the lip2 and vgb genes (VHb(+)) displayed higher biomass and YlLIP2 activity than control strains (VHb(-)). Compared with VHb(-) cells, the expression levels of YlLIP2 in VHb-expressing cells when oxygen was not a limiting factor were improved 31.5% in shake-flask culture and 22% in a 10-L fermentor. Under non-limiting dissolved oxygen (DO) conditions, the maximum YlLIP2 activity of VHb(+) in a 10-L fermentor reached 33,000 U/mL. Oxygen limitation had a more negative effect on YlLIP2 productivity in VHb(-) cells than in VHb(+) cells. The highest YlLIP2 activity of VHb(+) cells was approximately 1.84-fold higher than that of VHb(-) cells at lower DO levels. Moreover, the recombinant strain VHb(+) exhibited a higher specific oxygen uptake rate and achieved higher cell viability under oxygen limiting and non-limiting conditions compared with VHb(-) cells. Therefore, the above results suggest that intracellular expression of VHb in recombinant P. pastoris has the potential to improve cell growth and industrial enzyme production. Copyright © 2011 Elsevier Inc. All rights reserved.

  3. Engineering of Nitrosomonas europaea to express Vitreoscilla hemoglobin enhances oxygen uptake and conversion of ammonia to nitrite.

    Science.gov (United States)

    Kunkel, Stephanie A; Pagilla, Krishna R; Stark, Benjamin C

    2015-12-01

    Nitrosomonas europaea was transformed with a recombinant plasmid bearing the gene (vgb) encoding the hemoglobin (VHb) from the bacterium Vitreoscilla under control of the N. europaea amoC P1 promoter. Vgb was maintained stably and appeared to be expressed in the transformants at VHb levels of about 0.75 nmol/g wet weight. Expression of VHb in the N. europaea transformants was correlated with an approximately 2 fold increase in oxygen uptake rate by whole cells at oxygen concentrations in the range of 75-100% saturation, but no change in oxygen uptake rate at oxygen concentrations below 25% saturation. VHb expression was also correlated with an increase of as much as about 30% in conversion of ammonia to nitrite by growing cells. The results suggest that engineering of key aerobic wastewater bacteria to express bacterial hemoglobins may be a useful strategy to produce species with enhanced respiratory abilities.

  4. Improvement of amorpha-4,11-diene production by a yeast-conform variant of Vitreoscilla hemoglobin.

    Science.gov (United States)

    Shen, Junhao; Zheng, Haina; Zhi, Xiaohui; Shi, Yanwei; Huang, Yong; Wang, Wei; Chen, Yongqin; Kong, Jianqiang; Zhu, Ping

    2012-01-01

    Amorpha-4,11-diene is the precursor of the antimalarial compound artemisinin. The effect of Vitreoscilla hemoglobin (VHb) and its yeast-conform variant (VHbm) on amorpha-4,11-diene production in engineered Saccharomyces cerevisiae was investigated. First, the VHb gene was mutated to the yeast-conform variant VHbm based on step-by-step extension of a short region of the gene through a series of polymerase chain reactions (PCR). The artificial VHbm gene contained codons preferred by the yeast translation machinery. Two yeast expression vectors containing VHb or VHbm gene were constructed and introduced into the amorpha-4,11-diene-producing strain S. cerevisiae WK1 to form WK1[VHb] and WK1[VHbm], respectively. Western blot and CO-difference spectrum absorbance assay showed that VHb and VHbm were successfully expressed. In shake flasks, VHbm expression conferred higher cell growth than VHb expression. GC-MS results indicated the amorpha-4,11-diene production in WK1[VHbm] and WK1[VHb] was 3- and 2-fold higher than that in WK1, respectively. This suggests that VHb might improve the amorpha-4,11-diene production in engineered S. cerevisiae.

  5. [Expression of Vitreoscilla hemoglobin improves recombinant lipase production in Pichia pastoris].

    Science.gov (United States)

    Wang, Xiaofeng; Sun, Yongchuan; Shen, Xuguang; Ke, Feng; Xu, Li; Liu, Yun; Yan, Yunjun

    2011-12-01

    Yarrowia lipolytica lipase Lip2 (YlLip2) is an important industrial enzyme with many potential applications. To alleviate the dissolved oxygen (DO) limitation and improve YlLip2 production during high-cell density fermentation, the YlLip2 gene lip2 and Vitreoscilla hemoglobin (VHb) gene vgb were co-expressed in Pichiapastoris under the control of AOX1 and PsADH2 promoter, respectively. The PsADH2 promoter from Pichia stipitis could be activated under oxygen limitation. The SDS-PAGE and CO-difference spectrum analysis indicated that VHb and YlLip2 had successfully co-expressed in recombinant strains. Compared with the control cells (VHb-, GS115/9Klip2), the expression levels of YlLip2 in VHb-expressing cells (VHb+, GS115/9Klip2-pZPVT) under oxygen limitation were improved 25% in shake-flask culture and 83% in a 10 L fermentor. Moreover, the VHb+ cells displayed higher biomass than VHb- cells at lower DO levels in a 10 L fermentor. In this study, we also achieved a VHb-expressing clone harboring multicopy lip2 gene (GS115/9Klip2-pZPVTlip2 49#), which showed the maximum lipolytic activity of 33 900 U/mL in a 10 L fermentor under lower DO conditions. Therefore, it can be seen that expression of VHb with PsADH2 promoter in P. pastoris combined with increasing copies of lip2 gene is an effective strategy to improve YlLip2 production.

  6. Lower Temperature Cultures Enlarge the Effects of Vitreoscilla Hemoglobin Expression on Recombinant Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Wei-Chang Fu

    2012-10-01

    Full Text Available An heterologous expression of Vitreoscilla hemoglobin (VHb for improving cell growth and recombinant protein production has been successfully demonstrated in various hosts, including Pichia pastoris. Lower temperature cultures can enhance target protein production in some studies of P. pastoris. In this study, the strategy of combining heterologous VHb expression and lower temperature cultures in P. pastoris showed that final cell density and viability of VHb+ strain at 23 °C were higher than that at 30 °C. In addition, the effects of VHb expression on recombinant β-galactosidase production and oxygen uptake rate were also higher at 23 °C than at 30 °C. Consequently, lower temperature cultures can enlarge VHb effectiveness on cell performance of P. pastoris. This is because VHb activity obtained at 23 °C cultures was twofold higher than that at 30 °C cultures, due to a different heme production. This strategy makes P. pastoris an excellent expression host particularly suitable for increasing the yields of the low-stability and aggregation-prone recombinant proteins.

  7. Lower temperature cultures enlarge the effects of Vitreoscilla hemoglobin expression on recombinant Pichia pastoris.

    Science.gov (United States)

    Wu, Jyh-Ming; Wang, Shin-Yao; Fu, Wei-Chang

    2012-10-15

    An heterologous expression of Vitreoscilla hemoglobin (VHb) for improving cell growth and recombinant protein production has been successfully demonstrated in various hosts, including Pichia pastoris. Lower temperature cultures can enhance target protein production in some studies of P. pastoris. In this study, the strategy of combining heterologous VHb expression and lower temperature cultures in P. pastoris showed that final cell density and viability of VHb+ strain at 23 °C were higher than that at 30 °C. In addition, the effects of VHb expression on recombinant β-galactosidase production and oxygen uptake rate were also higher at 23 °C than at 30 °C. Consequently, lower temperature cultures can enlarge VHb effectiveness on cell performance of P. pastoris. This is because VHb activity obtained at 23 °C cultures was twofold higher than that at 30 °C cultures, due to a different heme production. This strategy makes P. pastoris an excellent expression host particularly suitable for increasing the yields of the low-stability and aggregation-prone recombinant proteins.

  8. [Cloning and expression of VHB gene in D-arabitol producing yeast].

    Science.gov (United States)

    He, P; Lu, D; Wang, Q; Shen, A; Jiang, N

    2001-06-01

    Recombinant plasmid pVgb-EX2 containing Vitreoscilla hemoglobin gene vgb and formaldehyde resistant gene SFA1 was constructed and transformed into D-arabitol producing yeast strain Saccharomyces sp. X-62. The fact that the amount of VHb in transformant cells was considerably higher than that in control cells indicated that gene vgb was expressed in transformant cells. D-arabitol productivity and yield of fermentation by transformants were improved. The most improvement of D-arabitol productivity in repeat experiments reached 27.3%. It appeared that the fermentation productivity of D-arabitol was relative to the amount of VHb in cells under experimental conditions.

  9. Vitreoscilla hemoglobin expression in engineered Escherichia coli: improved performance in high cell-density batch cultivations.

    Science.gov (United States)

    Pablos, Tania E; Mora, Eugenio Meza; Le Borgne, Sylvie; Ramírez, Octavio T; Gosset, Guillermo; Lara, Alvaro R

    2011-08-01

    High cell-density cultivations are the preferred system for biomolecules production by Escherichia coli. It has been previously demonstrated that a strain of E. coli with a modified substrate transport system is able to attain high cell densities in batch mode, due to the very low overflow metabolism displayed. The use of elevated amounts of glucose from the beginning of the cultivation, eliminates the existence of substrate gradients due to deficient mixing at large-scale. However, the large amounts of oxygen demanded resulted in microaerobic conditions after some hours of cultivation, even at small-scale. In this work, the effect of expressing the Vitreoscilla hemoglobin (VHb) in the engineered strain during batch cultures using high-glucose concentrations was tested. Together, the expression of VHb and the modified substrate transport system resulted in a 33% increase of biomass production compared to the parental strain (W3110) lacking the VHb in batch cultivations using 25 g/L of glucose. When 50 g/L of glucose were used, expression of VHb in the modified strain led to 11% higher biomass production compared to W3110. The VHb also increased the growth rates of the strains by about 30% in the aerobic phase and more than 200% in the microaerobic phase of batch cultivation. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Enhancement of natamycin production on Streptomyces gilvosporeus by chromosomal integration of the Vitreoscilla hemoglobin gene (vgb).

    Science.gov (United States)

    Wang, Shaohua; Liu, Fei; Hou, Zhongwen; Zong, Gongli; Zhu, Xiqiang; Ling, Peixue

    2014-04-01

    Oxygen deficiency is a critical factor during the fermentation production of natamycin. In order to alleviate oxygen limitation and enhance the yield of natamycin, the vgb gene, encoding Vitreoscilla hemoglobin (VHb) was inserted into pSET152 with its native promoter and integrated into the chromosome of Streptomyces gilvosporeus (S. gilvosporeus). The expression of VHb was determined by Western blotting. The activity of expressed VHb was confirmed by the observation of VHb-specific CO-difference spectrum with a maximal absorption at 419 nm for the recombinant. Integration of the empty plasmid pSET152 did not affect natamycin production of S. gilvosporeus. While the vgb-harboring strain exhibited high natamycin productivity, reaching 3.31 g/L in shake flasks and 8.24 g/L in 1-L fermenters. Compared to the wild strain, expression of VHb, increased the natamycin yield of the strain bearing vgb by 131.3 % (jar fermenter scale) and 175 % (shake flask scale), respectively, under certain oxygen-limiting condition. Addition of an extra copy of the vgb gene in S. gilvosporeus-vgb2 did not enhance the natamycin production obviously. These results provided a superior natamycin-producing strain which can be directly used in industry and a useful strategy for increasing yields of other metabolites in industrial strains.

  11. [Effect of the gene for bacterial hemoglobin vhb on the effectiveness of the process of Escherichia coli-Streptomyces interspecies conjugation and production of antibiotics in streptomycetes].

    Science.gov (United States)

    Tabakov, V Iu; Emel'ianova, L K; Antonova, S V; Voeĭkova, T A

    2001-03-01

    The bacterial hemoglobin vhb gene was cloned from sliding bacterium Vitreoscilla sp. as an element of the system ensuring survival of this microorganism in an environment that contains insufficient amount of oxygen. The vhb gene was transferred from Escherichia coli to some Streptomyces strains, producers of antibiotics, by the method of intergeneric conjugation using conjugative-integrative plasmid vectors pIH1 and pCH2. The stability of plasmid DNA inheritance was analyzed in the genomes of exconjugants. A positive effect of the vhb gene on processes of conjugation and antibiotic production in a number of examined strains was shown.

  12. Shedding light on the role of Vitreoscilla hemoglobin on cellular catabolic regulation by proteomic analysis.

    Science.gov (United States)

    Isarankura-Na-Ayudhya, Chartchalerm; Panpumthong, Patcharee; Tangkosakul, Teerawit; Boonpangrak, Somchai; Prachayasittikul, Virapong

    2008-03-03

    Heterologous expression of Vitreoscilla hemoglobin (VHb) has been reported to improve cell growth, protein synthesis, metabolite productivity and nitric oxide detoxification. Although it has been proposed that such phenomenon is attributed to the enhancement of respiration and energy metabolism by facilitating oxygen delivery, the mechanism of VHb action remains to be elucidated. In the present study, changes of protein expression profile in Escherichia coli as a consequence of VHb production was investigated by two-dimensional gel electrophoresis (2-DE) in conjunction with peptide mass fingerprinting. Total protein extracts derived from cells expressing native green fluorescent protein (GFPuv) and chimeric VHbGFPuv grown in Luria-Bertani broth were prepared by sonic disintegration. One hundred microgram of proteins was individually electrophoresed in IEF-agarose rod gels followed by gradient SDS-PAGE gels. Protein spots were excised from the gels, digested to peptide fragments by trypsin, and analyzed using matrix-assisted laser desorption ionization-time of flight (MALDI-TOF) mass spectrometry. Results revealed that expression of VHbGFPuv caused an entire disappearance of tryptophanase as well as down-regulated proteins involved in various metabolic pathways, e.g. glycerol kinase, isocitrate dehydrogenase, aldehyde dehydrogenase, and D-glucose-D-galactose binding protein. Phenotypic assay of cellular indole production confirmed the differentially expressed tryptophanase enzymes in which cells expressing chimeric VHbGFP demonstrated a complete indole-negative reaction. Supplementation of delta-aminolevulinic acid (ALA) to the culture medium enhanced expression of glyceraldehyde-3-phosphate dehydrogenase and glycerol kinase. Our findings herein shed light on the functional roles of VHb on cellular carbon and nitrogen consumptions as well as regulation of other metabolic pathway intermediates, possibly by autoregulation of the catabolite repressor regulons.

  13. Improvement of desulfurizing activity of haloalkaliphilic Thialkalivibrio versutus SOB306 with the expression of Vitreoscilla hemoglobin gene.

    Science.gov (United States)

    Mu, Tingzhen; Yang, Maohua; Zhao, Jixiang; Sharshar, Moustafa Mohammed; Tian, Jiangnan; Xing, Jianmin

    2017-03-01

    To construct efficient transformation and expression system and further improve desulfurizing activity of cells through expression of Vitreoscilla hemoglobin (VHb) in haloalkaliphilic Thialkalivibrio versutus SOB306. We transferred plasmids pKT230 and pBBR-smr into T. versutus SOB306 via a conjugation method. We identified four promoters from among several predicted promoters by scoring for streptomycin resistance, and finally selected tac and p3 based on the efficiency of expression of red fluorescent protein (RFP). Expression of RFP when regulated by tac was more than three times that of p3 in SOB306. Further, we expressed VHb under the control of tac promoter in SOB306. Expression of VHb was verified using CO-difference spectra. The results showed that VHb expression can boost sulfur metabolism, as evidenced by an increase of about 11.7 ± 1.8% in the average rate of thiosulfate removal in the presence of VHb. A conjugation transfer and an expression system for Thialkalivibrio, has been developed for the first time and used for expression of VHb to improve desulfurizing activity.

  14. The single-domain globin of Vitreoscilla: augmentation of aerobic metabolism for biotechnological applications.

    Science.gov (United States)

    Frey, Alexander D; Shepherd, Mark; Jokipii-Lukkari, Soile; Häggman, Hely; Kallio, Pauli T

    2011-01-01

    Extensive studies have revealed that large-scale, high-cell density bioreactor cultivations have significant impact on metabolic networks of oxygen-requiring production organisms. Oxygen transfer problems associated with fluid dynamics and inefficient mixing efficiencies result in oxygen gradients, which lead to reduced performance of the bioprocess, decreased product yields, and increased production costs. These problems can be partially alleviated by improving bioreactor configuration and setting, but significant improvements have been achieved by metabolic engineering methods, especially by heterologously expressing Vitreoscilla hemoglobin (VHb). Vast numbers of studies have been accumulating during the past 20 years showing the applicability of VHb to improve growth and product yields in a variety of industrially significant prokaryotic and eukaryotic hosts. The global view on the metabolism of globin-expressing Escherichia coli cells depicts increased energy generation, higher oxygen uptake rates, and a decrease in fermentative by-product excretion. Transcriptome and metabolic flux analysis clearly demonstrate the multidimensional influence of heterologous VHb on the expression of stationary phase-specific genes and on the regulation of cellular metabolic networks. The exact biochemical mechanisms by which VHb is able to improve the oxygen-limited growth remain poorly understood. The suggested mechanisms propose either the delivery of oxygen to the respiratory chain or the detoxification of reactive nitrogen species for the protection of cytochrome activity. The expression of VHb in E. coli bioreactor cultures is likely to assist bacterial growth through providing an increase in available intracellular oxygen, although to fully understand the exact role of VHb in vivo, further analysis will be required. Copyright © 2011 Elsevier Ltd. All rights reserved.

  15. Dicty_cDB: VHB675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB675 (Link to dictyBase) - - - Contig-U16597-1 VHB675P (Link to Original site) VHB675F 617 VHB675Z...VHB675Z 719 VHB675P 1316 - - Show VHB675 Library VH (Link to library) Clone ID VHB675 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB6-D/VHB675Q.Seq.d/ Representative seq. ID VHB675P (Link to Original site)...site) Representative DNA sequence >VHB675 (VHB675Q) /CSM/VH/VHB6-D/VHB675Q.Seq.d/ TTTATTTTTTTTTTGATCGTTC...Value VHB675 (VHB675Q) /CSM/VH/VHB6-D/VHB675Q.Seq.d/ 2339 0.0 VHB251 (VHB251Q) /CSM/VH/VHB2-C/VHB251Q.Seq

  16. Heterologous coexpression of Vitreoscilla hemoglobin and Bacillus megaterium glucanase in Streptomyces lydicus A02 enhanced its production of antifungal metabolites.

    Science.gov (United States)

    Wu, Huiling; Li, Jinjin; Dong, Dan; Liu, Ting; Zhang, Taotao; Zhang, Dianpeng; Liu, Weicheng

    2015-12-01

    Streptomyces lydicus A02 is a novel producer of commercially important polyene macrocyclic antibiotic natamycin and a potential biocontrol agent to several plant fungal diseases, including wilt caused by Fusarium oxysporum f. spp. To improve the natamycin production and the antifungal activity of S. lydicus A02, we coexpressed gene vgb encoding Vitreoscilla hemoglobin (VHb) and bglC encoding Bacillus megaterium L103 glucanase, both under the control of the strong constitutive ermE* promoter, in S. lydicus A02. Our results showed that coexpressing VHb and glucanase improved cell growth, and the engineered strain produced 26.90% more biomass than the wild-type strain after 72h fermentation in YSG medium. In addition, coexpressing genes encoding VHb and glucanase led to increased natamycin production, higher endogenous chitinase activity and exogenous glucanase activity, as well as enhanced antifungal activity in the engineered S. lydicus AVG02 and AGV02, regardless of the position of the two genes on the plasmids. Compared with model strains, few reports have successfully coexpressed VHb and other foreign proteins in industrial strains. Our results illustrated an effective approach for improving antifungal activity in an industrial strain by the rational engineering of combined favorable factors. Copyright © 2015 Elsevier Inc. All rights reserved.

  17. Improved biomass and protein production in solid-state cultures of an Aspergillus sojae strain harboring the Vitreoscilla hemoglobin.

    Science.gov (United States)

    Mora-Lugo, Rodrigo; Madrigal, Marvin; Yelemane, Vikas; Fernandez-Lahore, Marcelo

    2015-11-01

    The biotechnological value of Aspergillus sojae ATCC 20235 (A. sojae) for production of pectinases in solid-state fermentation (SSF) has been demonstrated recently. However, a common drawback of fungal solid-state cultures is the poor diffusion of oxygen into the fungi that limits its growth and biological productivity. The bacterial Vitreoscilla hemoglobin (VHb) has favored the metabolism and productivities of various bacterial and yeast strains besides alleviating hypoxic conditions of its native host, but the use of VHb in filamentous fungi still remains poor explored. Based on the known effects of VHb, this study assessed its applicability to improve A. sojae performance in SSF. The VHb gene (vgb) under control of the constitutive Aspergillus nidulants gpdA promoter was introduced into the genome of A. sojae by Agrobacterium-mediated transformation. Successful fungal transformants were identified by fluorescence microscopy and polymerase chain reaction (PCR) analyses. In solid-state cultures, the content of protease, exo-polygalacturonase (exo-PG), and exo-polymethylgalacturonase (exo-PMG) of the transformed fungus (A. sojae vgb+) improved were 26, 60, and 44 % higher, respectively, in comparison to its parental strain (A. sojae wt). Similarly, biomass content was also 1.3 times higher in the transformant strain. No significant difference was observed in endo-polygalacturonase (endo-PG) content between both fungal strains, suggesting dissimilar effects of VHb towards different enzymatic productions. Overall, our results show that biomass, protease, and exo-pectinase content of A. sojae in SSF can be improved by transformation with VHb.

  18. Crystallographic structure determination of B10 mutants of Vitreoscilla hemoglobin: role of Tyr29 (B10) in the structure of the ligand-binding site.

    Science.gov (United States)

    Ratakonda, Sireesha; Anand, Arvind; Dikshit, Kanak; Stark, Benjamin C; Howard, Andrew J

    2013-03-01

    Site-directed mutants of the gene encoding wild-type Vitreoscilla hemoglobin were made that changed Tyr29 (B10) of the wild-type Vitreoscilla hemoglobin (VHb) to either Phe or Ala. The wild-type and the two mutant hemoglobins were expressed in Escherichia coli and purified to homogeneity. The binding of the two mutants to CO was essentially identical to that of wild-type VHb as determined by CO-difference spectra. Circular-dichroism spectra also showed the two mutants to be essentially the same as wild-type VHb regarding overall helicity. All three VHbs were crystallized and their structures were determined at resolutions of 1.7-1.9 Å, which are similar to that of the original wild-type structure determination. The Tyr29Phe mutant has a structure that is essentially indistinguishable from that of the wild type. However, the structure of the Tyr29Ala mutant has significant differences from that of the wild type. In addition, for the Tyr29Ala mutant it was possible to determine the positions of most of the residues in the D region, which was disordered in the originally reported structure of wild-type VHb as well as in the wild-type VHb structure reported here. In the Tyr29Ala mutant, the five-membered ring of proline E8 (Pro54) occupies the space occupied by the aromatic ring of Tyr29 in the wild-type structure. These results are discussed in the context of the proposed role of Tyr29 in the structure of the oxygen-binding pocket.

  19. Dicty_cDB: VHB686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB686 (Link to dictyBase) - - - Contig-U15722-1 - (Link to Original site) VHB...686F 118 - - - - - - Show VHB686 Library VH (Link to library) Clone ID VHB686 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB6-D/VHB686Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB686 (VHB686Q) /CSM/VH/VHB6-D/VHB686Q.Seq.d/ AGAAGATTATAATATCA...DNA Score E Sequences producing significant alignments: (bits) Value VHB686 (VHB686Q) /CSM/VH/VHB6-D/VHB

  20. Dicty_cDB: VHB211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB211 (Link to dictyBase) - - - Contig-U14188-1 - (Link to Original site) - - VHB...211Z 538 - - - - Show VHB211 Library VH (Link to library) Clone ID VHB211 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-A/VHB211Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB211 (VHB211Q) /CSM/VH/VHB2-A/VHB211Q.Seq.d/ XXXXXXXXXXATTAATG...Score E Sequences producing significant alignments: (bits) Value VHB211 (VHB211Q) /CSM/VH/VHB2-A/VHB

  1. Dicty_cDB: VHB169 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB169 (Link to dictyBase) - - - Contig-U11200-1 - (Link to Original site) - - VHB...169Z 276 - - - - Show VHB169 Library VH (Link to library) Clone ID VHB169 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB169Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB169 (VHB169Q) /CSM/VH/VHB1-C/VHB169Q.Seq.d/ XXXXXXXXXXGTNTNTG...ng significant alignments: (bits) Value VHB169 (VHB169Q) /CSM/VH/VHB1-C/VHB169Q.S

  2. Dicty_cDB: VHB205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB205 (Link to dictyBase) - - - Contig-U16486-1 VHB205P (Link to Original site) VHB205F 655 VHB205Z...VHB205Z 703 VHB205P 1338 - - Show VHB205 Library VH (Link to library) Clone ID VHB205 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB2-A/VHB205Q.Seq.d/ Representative seq. ID VHB205P (Link to Original site)...site) Representative DNA sequence >VHB205 (VHB205Q) /CSM/VH/VHB2-A/VHB205Q.Seq.d/ ATTTAGAATATTTTAGATTAAA...significant alignments: (bits) Value VHB205 (VHB205Q) /CSM/VH/VHB2-A/VHB205Q.Seq.d/ 2613 0.0 VSD867 (VSD867Q)

  3. Dicty_cDB: VHB729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB729 (Link to dictyBase) - - - Contig-U16260-1 VHB729P (Link to Original site) VHB729F 649 VHB729Z...VHB729Z 708 VHB729P 1337 - - Show VHB729 Library VH (Link to library) Clone ID VHB729 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB7-B/VHB729Q.Seq.d/ Representative seq. ID VHB729P (Link to Original site)...site) Representative DNA sequence >VHB729 (VHB729Q) /CSM/VH/VHB7-B/VHB729Q.Seq.d/ ACTCTCGAGTGCAAAAAAAGTA...significant alignments: (bits) Value VHB729 (VHB729Q) /CSM/VH/VHB7-B/VHB729Q.Seq.d/ 2573 0.0 VHO711 (VHO711Q)

  4. Dicty_cDB: VHB347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB347 (Link to dictyBase) - - - - VHB347P (Link to Original site) VHB347F 617 VHB347Z 733 VHB347P...VHB347P 1330 - - Show VHB347 Library VH (Link to library) Clone ID VHB347 (Link to dictyBase) Atlas ID - NBRP...biol.tsukuba.ac.jp/CSM/VH/VHB3-B/VHB347Q.Seq.d/ Representative seq. ID VHB347P (Link to Original site)...site) Representative DNA sequence >VHB347 (VHB347Q) /CSM/VH/VHB3-B/VHB347Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGT...significant alignments: (bits) Value VHB347 (VHB347Q) /CSM/VH/VHB3-B/VHB347Q.Seq.d/ 2484 0.0 CHE746 (CHE746Q)

  5. Dicty_cDB: VHB549 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB549 (Link to dictyBase) - - - - VHB549P (Link to Original site) VHB549F 479 VHB549Z 628 VHB549P...VHB549P 1087 - - Show VHB549 Library VH (Link to library) Clone ID VHB549 (Link to dictyBase) Atlas ID - NBRP...biol.tsukuba.ac.jp/CSM/VH/VHB5-C/VHB549Q.Seq.d/ Representative seq. ID VHB549P (Link to Original site)...site) Representative DNA sequence >VHB549 (VHB549Q) /CSM/VH/VHB5-C/VHB549Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGT...significant alignments: (bits) Value VHB549 (VHB549Q) /CSM/VH/VHB5-C/VHB549Q.Seq.d/ 2046 0.0 VHQ446 (VHQ446Q)

  6. Dicty_cDB: VHB858 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB858 (Link to dictyBase) - - - Contig-U16598-1 VHB858P (Link to Original site) VHB858F 640 VHB858Z...VHB858Z 760 VHB858P 1380 - - Show VHB858 Library VH (Link to library) Clone ID VHB858 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB8-C/VHB858Q.Seq.d/ Representative seq. ID VHB858P (Link to Original site)...site) Representative DNA sequence >VHB858 (VHB858Q) /CSM/VH/VHB8-C/VHB858Q.Seq.d/ CACTGTTGGCCTACGGAATTTA...significant alignments: (bits) Value VHB858 (VHB858Q) /CSM/VH/VHB8-C/VHB858Q.Seq.d/ 2567 0.0 AFL883 (AFL883Q)

  7. Dicty_cDB: VHB715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB715 (Link to dictyBase) - - - - VHB715P (Link to Original site) VHB715F 618 VHB715Z 737 VHB715P...VHB715P 1335 - - Show VHB715 Library VH (Link to library) Clone ID VHB715 (Link to dictyBase) Atlas ID - NBRP...biol.tsukuba.ac.jp/CSM/VH/VHB7-A/VHB715Q.Seq.d/ Representative seq. ID VHB715P (Link to Original site)...site) Representative DNA sequence >VHB715 (VHB715Q) /CSM/VH/VHB7-A/VHB715Q.Seq.d/ GGAACTCTCGAGTGCAAAAAAA...significant alignments: (bits) Value VHB715 (VHB715Q) /CSM/VH/VHB7-A/VHB715Q.Seq.d/ 2522 0.0 VHJ871 (VHJ871Q)

  8. Dicty_cDB: VHB819 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB819 (Link to dictyBase) - - - - VHB819P (Link to Original site) VHB819F 668 VHB819Z 545 VHB819P...VHB819P 1193 - - Show VHB819 Library VH (Link to library) Clone ID VHB819 (Link to dictyBase) Atlas ID - NBRP...biol.tsukuba.ac.jp/CSM/VH/VHB8-A/VHB819Q.Seq.d/ Representative seq. ID VHB819P (Link to Original site)...site) Representative DNA sequence >VHB819 (VHB819Q) /CSM/VH/VHB8-A/VHB819Q.Seq.d/ ATAACGCCCTTACTTTTAATTA...significant alignments: (bits) Value VHB819 (VHB819Q) /CSM/VH/VHB8-A/VHB819Q.Seq.d/ 2212 0.0 AFI774 (AFI774Q)

  9. Dicty_cDB: VHB152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB152 (Link to dictyBase) - - - Contig-U16379-1 VHB152P (Link to Original site) VHB152F 725 VHB152Z...VHB152Z 729 VHB152P 1434 - - Show VHB152 Library VH (Link to library) Clone ID VHB152 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB152Q.Seq.d/ Representative seq. ID VHB152P (Link to Original site)...site) Representative DNA sequence >VHB152 (VHB152Q) /CSM/VH/VHB1-C/VHB152Q.Seq.d/ ATTTTTATAATTTCACTTGTTT...significant alignments: (bits) Value VHB152 (VHB152Q) /CSM/VH/VHB1-C/VHB152Q.Seq.d/ 2690 0.0 VHQ305 (VHQ305Q)

  10. Dicty_cDB: VHB485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB485 (Link to dictyBase) - - - Contig-U11181-1 VHB485P (Link to Original site) VHB485F 633 VHB485Z...VHB485Z 816 VHB485P 1429 - - Show VHB485 Library VH (Link to library) Clone ID VHB485 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB4-D/VHB485Q.Seq.d/ Representative seq. ID VHB485P (Link to Original site)...site) Representative DNA sequence >VHB485 (VHB485Q) /CSM/VH/VHB4-D/VHB485Q.Seq.d/ AATTTTTTTAATTTTTTTTCAA...significant alignments: (bits) Value VHB485 (VHB485Q) /CSM/VH/VHB4-D/VHB485Q.Seq.d/ 2498 0.0 VHO522 (VHO522Q)

  11. Dicty_cDB: VHB360 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB360 (Link to dictyBase) - - - Contig-U16473-1 VHB360P (Link to Original site) VHB360F 568 VHB360Z...VHB360Z 779 VHB360P 1327 - - Show VHB360 Library VH (Link to library) Clone ID VHB360 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB3-C/VHB360Q.Seq.d/ Representative seq. ID VHB360P (Link to Original site)...site) Representative DNA sequence >VHB360 (VHB360Q) /CSM/VH/VHB3-C/VHB360Q.Seq.d/ ATTATCCAAAAAACTTTTATTT...significant alignments: (bits) Value VHB360 (VHB360Q) /CSM/VH/VHB3-C/VHB360Q.Seq.d/ 2323 0.0 VHO607 (VHO607Q)

  12. Dicty_cDB: VHB594 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB594 (Link to dictyBase) - - - Contig-U16172-1 VHB594E (Link to Original site) VHB...594F 589 VHB594Z 809 VHB594P 1378 VHB594E 856 Show VHB594 Library VH (Link to library) Clone ID VHB...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB594Q.Seq.d/ Representative seq. ID VHB...594E (Link to Original site) Representative DNA sequence >VHB594 (VHB594Q) /CSM/VH/VHB5-D/VHB... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB594 (VHB594Q) /CSM/VH/VHB5-D/VHB

  13. Dicty_cDB: VHB350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB350 (Link to dictyBase) - - - Contig-U15304-1 VHB350P (Link to Original site) VHB...350F 623 VHB350Z 786 VHB350P 1389 - - Show VHB350 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-C/VHB350Q.Seq.d/ Representative seq. ID VHB...350P (Link to Original site) Representative DNA sequence >VHB350 (VHB350Q) /CSM/VH/VHB3-C/VHB...producing significant alignments: (bits) Value VHB350 (VHB350Q) /CSM/VH/VHB3-C/VHB350Q.Seq.d/ 2016 0.0 VHB

  14. Dicty_cDB: VHB847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB847 (Link to dictyBase) - - - Contig-U16283-1 - (Link to Original site) VHB...847F 640 - - - - - - Show VHB847 Library VH (Link to library) Clone ID VHB847 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB8-B/VHB847Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB847 (VHB847Q) /CSM/VH/VHB8-B/VHB847Q.Seq.d/ ATAGTCCTGATTATTAC...oplasmic 8.0 %: nuclear >> prediction for VHB847 is mit 5' end seq. ID VHB847F 5' end seq. >VHB

  15. Dicty_cDB: VHB266 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB266 (Link to dictyBase) - - - Contig-U16303-1 - (Link to Original site) - - VHB...266Z 713 - - - - Show VHB266 Library VH (Link to library) Clone ID VHB266 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-C/VHB266Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB266 (VHB266Q) /CSM/VH/VHB2-C/VHB266Q.Seq.d/ XXXXXXXXXXCATGGAC... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB266 (VHB266Q) /CSM/VH/VHB

  16. Dicty_cDB: VHB506 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB506 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHB...506Z 712 - - - - Show VHB506 Library VH (Link to library) Clone ID VHB506 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB5-A/VHB506Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB506 (VHB506Q) /CSM/VH/VHB5-A/VHB506Q.Seq.d/ XXXXXXXXXXTCAAGGT...SM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB506 (VHB506Q) /CSM/VH/VHB

  17. Dicty_cDB: VHB460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB460 (Link to dictyBase) - - - - VHB460P (Link to Original site) VHB460F 640 VHB460Z 768 VHB460P...VHB460P 1388 - - Show VHB460 Library VH (Link to library) Clone ID VHB460 (Link to dictyBase) Atlas ID - NBRP...biol.tsukuba.ac.jp/CSM/VH/VHB4-C/VHB460Q.Seq.d/ Representative seq. ID VHB460P (Link to Original site)...site) Representative DNA sequence >VHB460 (VHB460Q) /CSM/VH/VHB4-C/VHB460Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGT...vacuolar >> prediction for VHB460 is cyt 5' end seq. ID VHB460F 5' end seq. >VHB460F.Seq AACTCTCGAGTGCAA

  18. Dicty_cDB: VHB627 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB627 (Link to dictyBase) - - - Contig-U16260-1 VHB627P (Link to Original site) VHB627F 649 VHB627Z...VHB627Z 726 VHB627P 1355 - - Show VHB627 Library VH (Link to library) Clone ID VHB627 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB6-B/VHB627Q.Seq.d/ Representative seq. ID VHB627P (Link to Original site)...site) Representative DNA sequence >VHB627 (VHB627Q) /CSM/VH/VHB6-B/VHB627Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGT...vacuolar >> prediction for VHB627 is cyt 5' end seq. ID VHB627F 5' end seq. >VHB627F.Seq AACTCTCGAGTGCAA

  19. Dicty_cDB: VHB385 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHB385 (Link to dictyBase) - G23342 DDB0219887 Contig-U14527-1 VHB385P (Link to Original...site) VHB385F 637 VHB385Z 769 VHB385P 1386 - - Show VHB385 Library VH (Link to library) Clone ID VHB385 (Link...biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB385Q.Seq.d/ Representative seq. ID VHB385P (Link to Original site)...site) Representative DNA sequence >VHB385 (VHB385Q) /CSM/VH/VHB3-D/VHB385Q.Seq.d/ AAAATTAAATAATTTTTTTTTA...significant alignments: (bits) Value VHB385 (VHB385Q) /CSM/VH/VHB3-D/VHB385Q.Seq.d/ 2020 0.0 VHA187 (VHA187Q)

  20. Dicty_cDB: VHB734 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHB734 (Link to dictyBase) - G22307 DDB0191738 Contig-U13636-1 VHB734P (Link to Original...site) VHB734F 452 VHB734Z 401 VHB734P 833 - - Show VHB734 Library VH (Link to library) Clone ID VHB734 (Link...biol.tsukuba.ac.jp/CSM/VH/VHB7-B/VHB734Q.Seq.d/ Representative seq. ID VHB734P (Link to Original site)...site) Representative DNA sequence >VHB734 (VHB734Q) /CSM/VH/VHB7-B/VHB734Q.Seq.d/ ATTTAAAATTTCTTTAATCTTT.../CSM/VS/VSF5-B/VSF531Q.Seq.d/ 418 e-116 VHB734 (VHB734Q) /CSM/VH/VHB7-B/VHB734Q.Seq.d/ 418 e-116 SSG712 (SSG712Q)

  1. Dicty_cDB: VHB171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB171 (Link to dictyBase) - - - Contig-U16260-1 VHB171P (Link to Original site) VHB171F 646 VHB171Z...VHB171Z 745 VHB171P 1371 - - Show VHB171 Library VH (Link to library) Clone ID VHB171 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB171Q.Seq.d/ Representative seq. ID VHB171P (Link to Original site)...site) Representative DNA sequence >VHB171 (VHB171Q) /CSM/VH/VHB1-C/VHB171Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGT...vacuolar >> prediction for VHB171 is cyt 5' end seq. ID VHB171F 5' end seq. >VHB171F.Seq AACTCTCGAGTGCAA

  2. Dicty_cDB: VHB310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHB310Z 769 -...- - - - Show VHB310 Library VH (Link to library) Clone ID VHB310 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-A/VHB310Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB310 (VHB310Q) /CSM/VH/VHB3-A/VHB310Q.Seq.d/ XXXXXXXXXXCTCATCCAAAG...0.0 VHB840 (VHB840Q) /CSM/VH/VHB8-B/VHB840Q.Seq.d/ 1483 0.0 VHB674 (VHB674Q) /CSM/VH/VHB6-D/VHB674Q.Seq

  3. Dicty_cDB: VHB751 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB751 (Link to dictyBase) - - - Contig-U16283-1 VHB751P (Link to Original site) VHB...751F 554 VHB751Z 583 VHB751P 1117 - - Show VHB751 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB751Q.Seq.d/ Representative seq. ID VHB...751P (Link to Original site) Representative DNA sequence >VHB751 (VHB751Q) /CSM/VH/VHB7-C/VHB...lignments: (bits) Value VHB751 (VHB751Q) /CSM/VH/VHB7-C/VHB751Q.Seq.d/ 2079 0.0 VHN470 (VHN470Q) /CSM/VH/VHN

  4. Dicty_cDB: VHB862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB862 (Link to dictyBase) - - - Contig-U16427-1 VHB862P (Link to Original site) VHB...862F 607 VHB862Z 770 VHB862P 1357 - - Show VHB862 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-C/VHB862Q.Seq.d/ Representative seq. ID VHB...862P (Link to Original site) Representative DNA sequence >VHB862 (VHB862Q) /CSM/VH/VHB8-C/VHB... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB862 (VHB862Q) /CSM/VH/VHB8-C/VHB

  5. Dicty_cDB: VHB869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB869 (Link to dictyBase) - - - Contig-U11129-1 VHB869P (Link to Original site) VHB...869F 614 VHB869Z 788 VHB869P 1382 - - Show VHB869 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-C/VHB869Q.Seq.d/ Representative seq. ID VHB...869P (Link to Original site) Representative DNA sequence >VHB869 (VHB869Q) /CSM/VH/VHB8-C/VHB...cant alignments: (bits) Value VHB869 (VHB869Q) /CSM/VH/VHB8-C/VHB869Q.Seq.d/ 2637

  6. Dicty_cDB: VHB740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB740 (Link to dictyBase) - - - Contig-U16250-1 VHB740P (Link to Original site) VHB...740F 619 VHB740Z 753 VHB740P 1352 - - Show VHB740 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-B/VHB740Q.Seq.d/ Representative seq. ID VHB...740P (Link to Original site) Representative DNA sequence >VHB740 (VHB740Q) /CSM/VH/VHB7-B/VHB...NA Score E Sequences producing significant alignments: (bits) Value VHB740 (VHB740Q) /CSM/VH/VHB7-B/VHB740Q.

  7. Dicty_cDB: VHB458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB458 (Link to dictyBase) - - - Contig-U16260-1 VHB458P (Link to Original site) VHB...458F 609 VHB458Z 730 VHB458P 1319 - - Show VHB458 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-C/VHB458Q.Seq.d/ Representative seq. ID VHB...458P (Link to Original site) Representative DNA sequence >VHB458 (VHB458Q) /CSM/VH/VHB4-C/VHB...ikskknfk kk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB458 (VHB458Q) /CSM/VH/VHB4-C/VHB

  8. Dicty_cDB: VHB772 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB772 (Link to dictyBase) - - - Contig-U15043-1 VHB772P (Link to Original site) VHB...772F 580 VHB772Z 774 VHB772P 1334 - - Show VHB772 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB772Q.Seq.d/ Representative seq. ID VHB...772P (Link to Original site) Representative DNA sequence >VHB772 (VHB772Q) /CSM/VH/VHB7-C/VHB...alignments: (bits) Value VHB772 (VHB772Q) /CSM/VH/VHB7-C/VHB772Q.Seq.d/ 1675 0.0 VFD268 (VFD268Q) /CSM/VF/VF

  9. Dicty_cDB: VHB393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB393 (Link to dictyBase) - - - Contig-U15722-1 VHB393P (Link to Original site) VHB...393F 205 VHB393Z 941 VHB393P 1126 - - Show VHB393 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB393Q.Seq.d/ Representative seq. ID VHB...393P (Link to Original site) Representative DNA sequence >VHB393 (VHB393Q) /CSM/VH/VHB3-D/VHB...ducing significant alignments: (bits) Value VHB393 (VHB393Q) /CSM/VH/VHB3-D/VHB393Q.Seq.d/ 1647 0.0 VHP548 (

  10. Dicty_cDB: VHB688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB688 (Link to dictyBase) - - - Contig-U16303-1 VHB688P (Link to Original site) VHB...688F 300 VHB688Z 488 VHB688P 768 - - Show VHB688 Library VH (Link to library) Clone ID VHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-D/VHB688Q.Seq.d/ Representative seq. ID VHB...688P (Link to Original site) Representative DNA sequence >VHB688 (VHB688Q) /CSM/VH/VHB6-D/VHB6...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB688 (VHB688Q) /CSM/VH/VHB6-D/VHB

  11. Dicty_cDB: VHB531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB531 (Link to dictyBase) - - - Contig-U11964-1 VHB531P (Link to Original site) VHB...531F 652 VHB531Z 627 VHB531P 1259 - - Show VHB531 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-B/VHB531Q.Seq.d/ Representative seq. ID VHB...531P (Link to Original site) Representative DNA sequence >VHB531 (VHB531Q) /CSM/VH/VHB5-B/VHB...re E Sequences producing significant alignments: (bits) Value VHB531 (VHB531Q) /CSM/VH/VHB5-B/VHB531Q.Seq.d/

  12. Dicty_cDB: VHB371 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB371 (Link to dictyBase) - - - Contig-U16260-1 VHB371P (Link to Original site) VHB...371F 609 VHB371Z 729 VHB371P 1318 - - Show VHB371 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-C/VHB371Q.Seq.d/ Representative seq. ID VHB...371P (Link to Original site) Representative DNA sequence >VHB371 (VHB371Q) /CSM/VH/VHB3-C/VHB...lkkilk kk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB371 (VHB371Q) /CSM/VH/VHB3-C/VHB

  13. Dicty_cDB: VHB124 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB124 (Link to dictyBase) - - - Contig-U16597-1 VHB124P (Link to Original site) VHB...124F 619 VHB124Z 722 VHB124P 1321 - - Show VHB124 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-A/VHB124Q.Seq.d/ Representative seq. ID VHB...124P (Link to Original site) Representative DNA sequence >VHB124 (VHB124Q) /CSM/VH/VHB1-A/VHB...NKXINLKITIN Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB124 (VHB124Q) /CSM/VH/VHB1-A/VHB

  14. Dicty_cDB: VHB528 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB528 (Link to dictyBase) - - - Contig-U16429-1 VHB528P (Link to Original site) VHB...528F 406 VHB528Z 707 VHB528P 1093 - - Show VHB528 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-B/VHB528Q.Seq.d/ Representative seq. ID VHB...528P (Link to Original site) Representative DNA sequence >VHB528 (VHB528Q) /CSM/VH/VHB5-B/VHB...roducing significant alignments: (bits) Value VHB528 (VHB528Q) /CSM/VH/VHB5-B/VHB

  15. Dicty_cDB: VHB891 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB891 (Link to dictyBase) - - - Contig-U11082-1 VHB891P (Link to Original site) VHB...891F 632 VHB891Z 770 VHB891P 1382 - - Show VHB891 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-D/VHB891Q.Seq.d/ Representative seq. ID VHB...891P (Link to Original site) Representative DNA sequence >VHB891 (VHB891Q) /CSM/VH/VHB8-D/VHB...ant alignments: (bits) Value VHB891 (VHB891Q) /CSM/VH/VHB8-D/VHB891Q.Seq.d/ 2472

  16. Dicty_cDB: VHB258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB258 (Link to dictyBase) - - - Contig-U16441-1 VHB258P (Link to Original site) VHB...258F 582 VHB258Z 748 VHB258P 1310 - - Show VHB258 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB2-C/VHB258Q.Seq.d/ Representative seq. ID VHB...258P (Link to Original site) Representative DNA sequence >VHB258 (VHB258Q) /CSM/VH/VHB2-C/VHB...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB258 (VHB258Q) /CSM/VH/VHB2-C/VHB

  17. Dicty_cDB: VHB640 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB640 (Link to dictyBase) - - - Contig-U16486-1 VHB640P (Link to Original site) VHB...640F 572 VHB640Z 784 VHB640P 1336 - - Show VHB640 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-B/VHB640Q.Seq.d/ Representative seq. ID VHB...640P (Link to Original site) Representative DNA sequence >VHB640 (VHB640Q) /CSM/VH/VHB6-B/VHB...icant alignments: (bits) Value VHB640 (VHB640Q) /CSM/VH/VHB6-B/VHB640Q.Seq.d/ 2490 0.0 VSD867 (VSD867Q) /CSM

  18. Dicty_cDB: VHB829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB829 (Link to dictyBase) - - - Contig-U16260-1 VHB829P (Link to Original site) VHB...829F 647 VHB829Z 692 VHB829P 1319 - - Show VHB829 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-B/VHB829Q.Seq.d/ Representative seq. ID VHB...829P (Link to Original site) Representative DNA sequence >VHB829 (VHB829Q) /CSM/VH/VHB8-B/VHB...kf*kkn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB829 (VHB829Q) /CSM/VH/VHB8-B/VHB

  19. Dicty_cDB: VHB750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB750 (Link to dictyBase) - - - Contig-U16427-1 VHB750P (Link to Original site) VHB...750F 600 VHB750Z 720 VHB750P 1300 - - Show VHB750 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB750Q.Seq.d/ Representative seq. ID VHB...750P (Link to Original site) Representative DNA sequence >VHB750 (VHB750Q) /CSM/VH/VHB7-C/VHB...s producing significant alignments: (bits) Value VHB750 (VHB750Q) /CSM/VH/VHB7-C/VHB750Q.Seq.d/ 1499 0.0 SHA

  20. Dicty_cDB: VHB557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB557 (Link to dictyBase) - - - Contig-U13028-1 VHB557P (Link to Original site) VHB...557F 598 VHB557Z 728 VHB557P 1306 - - Show VHB557 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-C/VHB557Q.Seq.d/ Representative seq. ID VHB...557P (Link to Original site) Representative DNA sequence >VHB557 (VHB557Q) /CSM/VH/VHB5-C/VHB... Score E Sequences producing significant alignments: (bits) Value VHB557 (VHB557Q) /CSM/VH/VHB5-C/VHB557Q.Se

  1. Dicty_cDB: VHB170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB170 (Link to dictyBase) - - - Contig-U16315-1 VHB170P (Link to Original site) VHB...170F 549 VHB170Z 780 VHB170P 1309 - - Show VHB170 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB170Q.Seq.d/ Representative seq. ID VHB...170P (Link to Original site) Representative DNA sequence >VHB170 (VHB170Q) /CSM/VH/VHB1-C/VHB...CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB170 (VHB170Q) /CSM/VH/VHB1-C/VHB

  2. Dicty_cDB: VHB625 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB625 (Link to dictyBase) - - - Contig-U16260-1 VHB625P (Link to Original site) VHB...625F 646 VHB625Z 798 VHB625P 1424 - - Show VHB625 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-B/VHB625Q.Seq.d/ Representative seq. ID VHB...625P (Link to Original site) Representative DNA sequence >VHB625 (VHB625Q) /CSM/VH/VHB6-B/VHB...producing significant alignments: (bits) Value VHB625 (VHB625Q) /CSM/VH/VHB6-B/VHB625Q.Seq.d/ 2738 0.0 CFC41

  3. Dicty_cDB: VHB529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB529 (Link to dictyBase) - - - Contig-U15722-1 VHB529P (Link to Original site) VHB...529F 630 VHB529Z 937 VHB529P 1547 - - Show VHB529 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-B/VHB529Q.Seq.d/ Representative seq. ID VHB...529P (Link to Original site) Representative DNA sequence >VHB529 (VHB529Q) /CSM/VH/VHB5-B/VHB...ucing significant alignments: (bits) Value VHB529 (VHB529Q) /CSM/VH/VHB5-B/VHB529Q.Seq.d/ 2524 0.0 AHH863 (A

  4. Dicty_cDB: VHB576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB576 (Link to dictyBase) - - - Contig-U16260-1 VHB576P (Link to Original site) VHB...576F 491 VHB576Z 532 VHB576P 1003 - - Show VHB576 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB576Q.Seq.d/ Representative seq. ID VHB...576P (Link to Original site) Representative DNA sequence >VHB576 (VHB576Q) /CSM/VH/VHB5-D/VHB...oducing significant alignments: (bits) Value VHB576 (VHB576Q) /CSM/VH/VHB5-D/VHB576Q.Seq.d/ 1913 0.0 VHQ491

  5. Dicty_cDB: VHB669 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB669 (Link to dictyBase) - - - Contig-U11181-1 VHB669P (Link to Original site) VHB...669F 575 VHB669Z 735 VHB669P 1290 - - Show VHB669 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-C/VHB669Q.Seq.d/ Representative seq. ID VHB...669P (Link to Original site) Representative DNA sequence >VHB669 (VHB669Q) /CSM/VH/VHB6-C/VHB...cant alignments: (bits) Value VHB669 (VHB669Q) /CSM/VH/VHB6-C/VHB669Q.Seq.d/ 2224 0.0 VHO634 (VHO634Q) /CSM/

  6. Dicty_cDB: VHB795 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB795 (Link to dictyBase) - - - Contig-U16430-1 VHB795P (Link to Original site) VHB...795F 585 VHB795Z 798 VHB795P 1363 - - Show VHB795 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-D/VHB795Q.Seq.d/ Representative seq. ID VHB...795P (Link to Original site) Representative DNA sequence >VHB795 (VHB795Q) /CSM/VH/VHB7-D/VHB...tlkkif Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB795 (VHB795Q) /CSM/VH/VHB7-D/VHB

  7. Dicty_cDB: VHB327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB327 (Link to dictyBase) - - - Contig-U11114-1 VHB327P (Link to Original site) VHB...327F 651 VHB327Z 723 VHB327P 1354 - - Show VHB327 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-B/VHB327Q.Seq.d/ Representative seq. ID VHB...327P (Link to Original site) Representative DNA sequence >VHB327 (VHB327Q) /CSM/VH/VHB3-B/VHB...NA Score E Sequences producing significant alignments: (bits) Value VHB327 (VHB327Q) /CSM/VH/VHB3-B/VHB327Q.

  8. Dicty_cDB: VHB392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB392 (Link to dictyBase) - - - Contig-U12327-1 VHB392P (Link to Original site) VHB...392F 608 VHB392Z 807 VHB392P 1395 - - Show VHB392 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB392Q.Seq.d/ Representative seq. ID VHB...392P (Link to Original site) Representative DNA sequence >VHB392 (VHB392Q) /CSM/VH/VHB3-D/VHB...e E Sequences producing significant alignments: (bits) Value VHB392 (VHB392Q) /CSM/VH/VHB3-D/VHB

  9. Dicty_cDB: VHB604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB604 (Link to dictyBase) - - - Contig-U12673-1 VHB604P (Link to Original site) VHB...604F 701 VHB604Z 701 VHB604P 1382 - - Show VHB604 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-A/VHB604Q.Seq.d/ Representative seq. ID VHB...604P (Link to Original site) Representative DNA sequence >VHB604 (VHB604Q) /CSM/VH/VHB6-A/VHB...t alignments: (bits) Value VHB604 (VHB604Q) /CSM/VH/VHB6-A/VHB604Q.Seq.d/ 2391 0.

  10. Dicty_cDB: VHB267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB267 (Link to dictyBase) - - - Contig-U16260-1 VHB267P (Link to Original site) VHB...267F 646 VHB267Z 735 VHB267P 1361 - - Show VHB267 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB2-C/VHB267Q.Seq.d/ Representative seq. ID VHB...267P (Link to Original site) Representative DNA sequence >VHB267 (VHB267Q) /CSM/VH/VHB2-C/VHB...k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB267 (VHB267Q) /CSM/VH/VHB2-C/VHB

  11. Dicty_cDB: VHB853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB853 (Link to dictyBase) - - - Contig-U16260-1 VHB853P (Link to Original site) VHB...853F 616 VHB853Z 766 VHB853P 1362 - - Show VHB853 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-C/VHB853Q.Seq.d/ Representative seq. ID VHB...853P (Link to Original site) Representative DNA sequence >VHB853 (VHB853Q) /CSM/VH/VHB8-C/VHB...lkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB853 (VHB853Q) /CSM/VH/VHB8-C/VHB

  12. Dicty_cDB: VHB483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB483 (Link to dictyBase) - - - Contig-U16430-1 VHB483P (Link to Original site) VHB...483F 591 VHB483Z 765 VHB483P 1336 - - Show VHB483 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-D/VHB483Q.Seq.d/ Representative seq. ID VHB...483P (Link to Original site) Representative DNA sequence >VHB483 (VHB483Q) /CSM/VH/VHB4-D/VHB...cant alignments: (bits) Value VHB483 (VHB483Q) /CSM/VH/VHB4-D/VHB483Q.Seq.d/ 1853 0.0 VHP202 (VHP202Q) /CSM/

  13. Dicty_cDB: VHB805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB805 (Link to dictyBase) - - - Contig-U16305-1 VHB805P (Link to Original site) VHB...805F 618 VHB805Z 754 VHB805P 1352 - - Show VHB805 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-A/VHB805Q.Seq.d/ Representative seq. ID VHB...805P (Link to Original site) Representative DNA sequence >VHB805 (VHB805Q) /CSM/VH/VHB8-A/VHB...A Score E Sequences producing significant alignments: (bits) Value VHB805 (VHB805Q) /CSM/VH/VHB8-A/VHB805Q.S

  14. Dicty_cDB: VHB757 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB757 (Link to dictyBase) - - - Contig-U16441-1 VHB757P (Link to Original site) VHB757...F 575 VHB757Z 121 VHB757P 676 - - Show VHB757 Library VH (Link to library) Clone ID VHB757... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB757Q.Seq.d/ Representative seq. ID VHB757...P (Link to Original site) Representative DNA sequence >VHB757 (VHB757Q) /CSM/VH/VHB7-C/VHB757...quences producing significant alignments: (bits) Value VHB757 (VHB757Q) /CSM/VH/VHB7-C/VHB757

  15. The responses of Vitreoscilla hemoglobin-expressing hybrid aspen (Populus tremula × tremuloides) exposed to 24-h herbivory: expression of hemoglobin and stress-related genes in exposed and nonorthostichous leaves.

    Science.gov (United States)

    Sutela, Suvi; Ylioja, Tiina; Jokipii-Lukkari, Soile; Anttila, Anna-Kaisa; Julkunen-Tiitto, Riitta; Niemi, Karoliina; Mölläri, Tiina; Kallio, Pauli T; Häggman, Hely

    2013-11-01

    The responses of transcriptome and phenolic compounds were determined with Populus tremula L. × Populus tremuloides Michx. expressing the hemoglobin (Hb) of Vitreoscilla (VHb) and non-transformant (wt) line. After 24-h exposure of leaves to Conistra vaccinii L., the transcript levels of endogenous non-symbiotic class 1 Hb (PttHb1) and truncated Hb (PttTrHb) genes were modestly reduced and increased, respectively, in both wt and VHb-expressing line. Besides the herbivory exposed leaves showing the most significant transcriptome changes, alterations were also detected in the transcriptome of nonorthostichous leaves positioned directly above the exposed leaves. Both wt and VHb-expressing line displayed similar herbivory-induced effects on gene expression, although the extent of responses was more pronounced in the wt than in the VHb-expressing line. The contents of phenolic compounds were not altered due to herbivory and they were alike in the wt and VHb-expressing line. In addition, we determined the relative growth rates (RGRs) of Orthosia gothica L., Ectropis crepuscularia Denis & Schiff. and Orgyia antiqua L. larvae, and found no variation in the RGRs between the lines. Thus, VHb-expressing P. tremula × tremuloides lines showed to be comparable with wt in regards to the food quality of leaves.

  16. Dicty_cDB: VHB827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB827 (Link to dictyBase) - - - Contig-U15685-1 - (Link to Original site) - - VHB...827Z 510 - - - - Show VHB827 Library VH (Link to library) Clone ID VHB827 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB8-B/VHB827Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB827 (VHB827Q) /CSM/VH/VHB8-B/VHB827Q.Seq.d/ XXXXXXXXXXGGCTNTC...nsxinsilvmvldsfhtvplv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB827 (VHB

  17. Dicty_cDB: VHB286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB286 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHB...286Z 639 - - - - Show VHB286 Library VH (Link to library) Clone ID VHB286 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-D/VHB286Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB286 (VHB286Q) /CSM/VH/VHB2-D/VHB286Q.Seq.d/ XXXXXXXXXXTGGTTCA...sfqqlqsllqlk*i*lvfknyqiyqd*ngkp Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB286 (VHB

  18. Dicty_cDB: VHB639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB639 (Link to dictyBase) - - - Contig-U16430-1 VHB639P (Link to Original site) VHB...639F 588 VHB639Z 792 VHB639P 1360 - - Show VHB639 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-B/VHB639Q.Seq.d/ Representative seq. ID VHB...639P (Link to Original site) Representative DNA sequence >VHB639 (VHB639Q) /CSM/VH/VHB6-B/VHB...drial 4.0 %: peroxisomal >> prediction for VHB639 is cyt 5' end seq. ID VHB639F 5' end seq. >VHB639F.Seq AAA

  19. Dicty_cDB: VHB412 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB412 (Link to dictyBase) - - - Contig-U13551-1 VHB412P (Link to Original site) VHB...412F 321 VHB412Z 770 VHB412P 1071 - - Show VHB412 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-A/VHB412Q.Seq.d/ Representative seq. ID VHB...412P (Link to Original site) Representative DNA sequence >VHB412 (VHB412Q) /CSM/VH/VHB4-A/VHB...mdkfkhl*niyff** Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB412 (VHB412Q) /CSM/VH/VHB

  20. Dicty_cDB: VHB551 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB551 (Link to dictyBase) - - - Contig-U16390-1 VHB551P (Link to Original site) VHB...551F 647 VHB551Z 682 VHB551P 1309 - - Show VHB551 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-C/VHB551Q.Seq.d/ Representative seq. ID VHB...551P (Link to Original site) Representative DNA sequence >VHB551 (VHB551Q) /CSM/VH/VHB5-C/VHB...ear 4.0 %: vesicles of secretory system >> prediction for VHB551 is exc 5' end seq. ID VHB551F 5' end seq. >VHB

  1. Dicty_cDB: VHB852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB852 (Link to dictyBase) - - - Contig-U16597-1 VHB852P (Link to Original site) VHB...852F 604 VHB852Z 693 VHB852P 1277 - - Show VHB852 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-C/VHB852Q.Seq.d/ Representative seq. ID VHB...852P (Link to Original site) Representative DNA sequence >VHB852 (VHB852Q) /CSM/VH/VHB8-C/VHB...*e**iiinlkin*sin Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB852 (VHB852Q) /CSM/VH/VHB

  2. Dicty_cDB: VHB830 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB830 (Link to dictyBase) - - - Contig-U15304-1 VHB830P (Link to Original site) VHB...830F 597 VHB830Z 789 VHB830P 1366 - - Show VHB830 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-B/VHB830Q.Seq.d/ Representative seq. ID VHB...830P (Link to Original site) Representative DNA sequence >VHB830 (VHB830Q) /CSM/VH/VHB8-B/VHB...difnklsqqq*ex Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB830 (VHB830Q) /CSM/VH/VHB

  3. Dicty_cDB: VHB125 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB125 (Link to dictyBase) - - - Contig-U12673-1 VHB125P (Link to Original site) VHB...125F 350 VHB125Z 676 VHB125P 1006 - - Show VHB125 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-B/VHB125Q.Seq.d/ Representative seq. ID VHB...125P (Link to Original site) Representative DNA sequence >VHB125 (VHB125Q) /CSM/VH/VHB1-B/VHB...a membrane 4.0 %: peroxisomal >> prediction for VHB125 is cyt 5' end seq. ID VHB125F 5' end seq. >VHB125F.Se

  4. Dicty_cDB: VHB430 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB430 (Link to dictyBase) - - - Contig-U16260-1 VHB430P (Link to Original site) VHB...430F 652 VHB430Z 735 VHB430P 1367 - - Show VHB430 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-B/VHB430Q.Seq.d/ Representative seq. ID VHB...430P (Link to Original site) Representative DNA sequence >VHB430 (VHB430Q) /CSM/VH/VHB4-B/VHB...k**snlkkil kkki Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB430 (VHB430Q) /CSM/VH/VHB

  5. Dicty_cDB: VHB287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB287 (Link to dictyBase) - - - Contig-U16260-1 VHB287P (Link to Original site) VHB...287F 646 VHB287Z 151 VHB287P 777 - - Show VHB287 Library VH (Link to library) Clone ID VHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB2-D/VHB287Q.Seq.d/ Representative seq. ID VHB...287P (Link to Original site) Representative DNA sequence >VHB287 (VHB287Q) /CSM/VH/VHB2-D/VHB2....0 %: mitochondrial 4.0 %: vesicles of secretory system >> prediction for VHB287 is nuc 5' end seq. ID VHB287F 5' end seq. >VHB

  6. Dicty_cDB: VHB793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB793 (Link to dictyBase) - G20084 DDB0167697 Contig-U16195-1 VHB...793P (Link to Original site) VHB793F 166 VHB793Z 548 VHB793P 694 - - Show VHB793 Library VH (Link to library) Clone ID VHB...ontig-U16195-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-D/VHB...793Q.Seq.d/ Representative seq. ID VHB793P (Link to Original site) Representative DNA sequence >VHB793 (VHB793Q) /CSM/VH/VHB...ducing significant alignments: (bits) Value VHB793 (VHB793Q) /CSM/VH/VHB7-D/VHB793Q.Seq.d/ 908 0.0 FC-IC1154

  7. Dicty_cDB: VHB431 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB431 (Link to dictyBase) - - - Contig-U16283-1 VHB431P (Link to Original site) VHB...431F 239 VHB431Z 683 VHB431P 902 - - Show VHB431 Library VH (Link to library) Clone ID VHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-B/VHB431Q.Seq.d/ Representative seq. ID VHB...431P (Link to Original site) Representative DNA sequence >VHB431 (VHB431Q) /CSM/VH/VHB4-B/VHB4...*lpklkiii*ysntxkkx Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB431 (VHB431Q) /CSM/VH/VHB

  8. Dicty_cDB: VHB806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB806 (Link to dictyBase) - - - Contig-U16185-1 VHB806P (Link to Original site) VHB...806F 691 VHB806Z 738 VHB806P 1409 - - Show VHB806 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-A/VHB806Q.Seq.d/ Representative seq. ID VHB...806P (Link to Original site) Representative DNA sequence >VHB806 (VHB806Q) /CSM/VH/VHB8-A/VHB... kxkyk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB806 (VHB

  9. Dicty_cDB: VHB238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB238 (Link to dictyBase) - - - Contig-U15541-1 VHB238P (Link to Original site) VHB...238F 614 VHB238Z 813 VHB238P 1407 - - Show VHB238 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB2-B/VHB238Q.Seq.d/ Representative seq. ID VHB...238P (Link to Original site) Representative DNA sequence >VHB238 (VHB238Q) /CSM/VH/VHB2-B/VHB...is Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB238 (VHB

  10. Dicty_cDB: VHB119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB119 (Link to dictyBase) - - - Contig-U15541-1 VHB119P (Link to Original site) VHB...119F 634 VHB119Z 667 VHB119P 1281 - - Show VHB119 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-A/VHB119Q.Seq.d/ Representative seq. ID VHB...119P (Link to Original site) Representative DNA sequence >VHB119 (VHB119Q) /CSM/VH/VHB1-A/VHB...*y*ksfkqqnnxrickqwyskrytic Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB119 (VHB

  11. Dicty_cDB: VHB685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB685 (Link to dictyBase) - - - Contig-U16260-1 VHB685P (Link to Original site) VHB...685F 529 VHB685Z 624 VHB685P 1133 - - Show VHB685 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-D/VHB685Q.Seq.d/ Representative seq. ID VHB...685P (Link to Original site) Representative DNA sequence >VHB685 (VHB685Q) /CSM/VH/VHB6-D/VHB...ar 4.0 %: extracellular, including cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for VHB685 is cyt 5' end seq. ID VHB

  12. Dicty_cDB: VHB507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB507 (Link to dictyBase) - - - Contig-U16441-1 VHB507P (Link to Original site) VHB...507F 656 VHB507Z 597 VHB507P 1233 - - Show VHB507 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-A/VHB507Q.Seq.d/ Representative seq. ID VHB...507P (Link to Original site) Representative DNA sequence >VHB507 (VHB507Q) /CSM/VH/VHB5-A/VHB...ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB507 (VHB

  13. Dicty_cDB: VHB142 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB142 (Link to dictyBase) - - - Contig-U16439-1 VHB142P (Link to Original site) VHB...142F 119 VHB142Z 683 VHB142P 782 - - Show VHB142 Library VH (Link to library) Clone ID VHB... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-B/VHB142Q.Seq.d/ Representative seq. ID VHB...142P (Link to Original site) Representative DNA sequence >VHB142 (VHB142Q) /CSM/VH/VHB1-B/VHB1...YALFTDKKTKEERLKMKISQLYETLSKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB142 (VHB

  14. Dicty_cDB: VHB558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB558 (Link to dictyBase) - - - Contig-U16430-1 VHB558P (Link to Original site) VHB...558F 581 VHB558Z 725 VHB558P 1286 - - Show VHB558 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-C/VHB558Q.Seq.d/ Representative seq. ID VHB...558P (Link to Original site) Representative DNA sequence >VHB558 (VHB558Q) /CSM/VH/VHB5-C/VHB...4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VHB558 is cyt 5' end seq. ID VHB

  15. Dicty_cDB: VHB574 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB574 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHB...574Z 744 - - - - Show VHB574 Library VH (Link to library) Clone ID VHB574 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB574Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB574 (VHB574Q) /CSM/VH/VHB5-D/VHB574Q.Seq.d/ XXXXXXXXXXCTCATCC...6.0 %: cytoplasmic 32.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VHB

  16. Dicty_cDB: VHB288 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB288 (Link to dictyBase) - - - Contig-U13028-1 - (Link to Original site) - - VHB...288Z 795 - - - - Show VHB288 Library VH (Link to library) Clone ID VHB288 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-D/VHB288Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB288 (VHB288Q) /CSM/VH/VHB2-D/VHB288Q.Seq.d/ XXXXXXXXXXTGGTGAA...ochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> prediction for VHB288 is cyt 5' end seq. ID - 5'

  17. Dicty_cDB: VHB377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB377 (Link to dictyBase) - - - Contig-U15688-1 VHB377P (Link to Original site) VHB...377F 673 VHB377Z 679 VHB377P 1332 - - Show VHB377 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB377Q.Seq.d/ Representative seq. ID VHB...377P (Link to Original site) Representative DNA sequence >VHB377 (VHB377Q) /CSM/VH/VHB3-D/VHB...KVSMACKDGVKSPFEPLSPNNLIKKSDIKDFI*xklin Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB

  18. Dicty_cDB: VHB716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB716 (Link to dictyBase) - - - Contig-U12673-1 VHB716P (Link to Original site) VHB...716F 635 VHB716Z 796 VHB716P 1411 - - Show VHB716 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-A/VHB716Q.Seq.d/ Representative seq. ID VHB...716P (Link to Original site) Representative DNA sequence >VHB716 (VHB716Q) /CSM/VH/VHB7-A/VHB...*nkikykik*n Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB

  19. Dicty_cDB: VHB306 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB306 (Link to dictyBase) - - - Contig-U16379-1 VHB306P (Link to Original site) VHB...306F 683 VHB306Z 795 VHB306P 1458 - - Show VHB306 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-A/VHB306Q.Seq.d/ Representative seq. ID VHB...306P (Link to Original site) Representative DNA sequence >VHB306 (VHB306Q) /CSM/VH/VHB3-A/VHB...NWIQSK*k*nllq*ki fvliidxikkxrrklk*tsnycfp Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB

  20. Dicty_cDB: VHB376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB376 (Link to dictyBase) - - - Contig-U11103-1 VHB376P (Link to Original site) VHB...376F 620 VHB376Z 812 VHB376P 1412 - - Show VHB376 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-D/VHB376Q.Seq.d/ Representative seq. ID VHB...376P (Link to Original site) Representative DNA sequence >VHB376 (VHB376Q) /CSM/VH/VHB3-D/VHB...ln*kinkkktnkyn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB

  1. Dicty_cDB: VHB532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB532 (Link to dictyBase) - - - - - (Link to Original site) VHB...532F 628 - - - - - - Show VHB532 Library VH (Link to library) Clone ID VHB532 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-B/VHB...532Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHB...532 (VHB532Q) /CSM/VH/VHB5-B/VHB532Q.Seq.d/ ATTTNTTTATATAATTATTTCATTTTTATATAAATAAAAAAATGT

  2. Dicty_cDB: VHB459 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB459 (Link to dictyBase) - - - - - (Link to Original site) VHB...459F 531 - - - - - - Show VHB459 Library VH (Link to library) Clone ID VHB459 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-C/VHB...459Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHB...459 (VHB459Q) /CSM/VH/VHB4-C/VHB459Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  3. Dicty_cDB: VHB573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available to library) VHB573 (Link to dictyBase) - - - Contig-U15036-1 - (Link to Original site) VHB573F 283 - -...- - - - - Show VHB573 Library VH (Link to library) Clone ID VHB573 (Link to dictyBase) Atlas ID - NBRP...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB573Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB573 (VHB573Q) /CSM/VH/VHB5-D/VHB573Q.Seq.d/ TTGGCCTAGTTAGTTGATTTT...significant alignments: (bits) Value VHB573 (VHB573Q) /CSM/VH/VHB5-D/VHB573Q.Seq.d/ 523 e-148 SLB213 (SLB213Q)

  4. Dicty_cDB: VHB812 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB812 (Link to dictyBase) - - - Contig-U16363-1 - (Link to Original site) - - VHB812Z 664 -...- - - - Show VHB812 Library VH (Link to library) Clone ID VHB812 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-A/VHB812Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB812 (VHB812Q) /CSM/VH/VHB8-A/VHB812Q.Seq.d/ XXXXXXXXXXAAATACCGTTA...significant alignments: (bits) Value VHB812 (VHB812Q) /CSM/VH/VHB8-A/VHB812Q.Seq.d/ 1296 0.0 VHP543 (VHP543Q)

  5. Dicty_cDB: VHB157 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available to library) VHB157 (Link to dictyBase) - - - Contig-U11741-1 - (Link to Original site) VHB157F 687 - -...- - - - - Show VHB157 Library VH (Link to library) Clone ID VHB157 (Link to dictyBase) Atlas ID - NBRP...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB157Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB157 (VHB157Q) /CSM/VH/VHB1-C/VHB157Q.Seq.d/ CCAAGTACCACTCATTACCAA...significant alignments: (bits) Value VHB157 (VHB157Q) /CSM/VH/VHB1-C/VHB157Q.Seq.d/ 1342 0.0 VHE292 (VHE292Q)

  6. Dicty_cDB: VHB648 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB648 (Link to dictyBase) - - - Contig-U11224-1 - (Link to Original site) - - VHB648Z 739 -...- - - - Show VHB648 Library VH (Link to library) Clone ID VHB648 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-B/VHB648Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB648 (VHB648Q) /CSM/VH/VHB6-B/VHB648Q.Seq.d/ XXXXXXXXXXAAAGTATCAAT...significant alignments: (bits) Value VHB648 (VHB648Q) /CSM/VH/VHB6-B/VHB648Q.Seq.d/ 1445 0.0 SLH381 (SLH381Q)

  7. Dicty_cDB: VHB447 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB447 (Link to dictyBase) - - - Contig-U16299-1 - (Link to Original site) - - VHB447Z 677 -...- - - - Show VHB447 Library VH (Link to library) Clone ID VHB447 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-B/VHB447Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB447 (VHB447Q) /CSM/VH/VHB4-B/VHB447Q.Seq.d/ XXXXXXXXXXTATGAAAGAGC...significant alignments: (bits) Value VHB447 (VHB447Q) /CSM/VH/VHB4-B/VHB447Q.Seq.d/ 1316 0.0 VHN460 (VHN460Q)

  8. Dicty_cDB: VHB101 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB101 (Link to dictyBase) - - - Contig-U16299-1 - (Link to Original site) - - VHB101Z 712 -...- - - - Show VHB101 Library VH (Link to library) Clone ID VHB101 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-A/VHB101Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB101 (VHB101Q) /CSM/VH/VHB1-A/VHB101Q.Seq.d/ XXXXXXXXXXTTCTATGAAAG...significant alignments: (bits) Value VHB101 (VHB101Q) /CSM/VH/VHB1-A/VHB101Q.Seq.d/ 1380 0.0 VHP385 (VHP385Q)

  9. Dicty_cDB: VHB439 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHB439 (Link to dictyBase) - - - Contig-U12828-1 - (Link to Original site) - - VHB439Z 656 -...- - - - Show VHB439 Library VH (Link to library) Clone ID VHB439 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB4-B/VHB439Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHB439 (VHB439Q) /CSM/VH/VHB4-B/VHB439Q.Seq.d/ XXXXXXXXXXAATGCTTACTN...significant alignments: (bits) Value VHB439 (VHB439Q) /CSM/VH/VHB4-B/VHB439Q.Seq.d/ 1203 0.0 VHE442 (VHE442Q)

  10. Dicty_cDB: VHB605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB605 (Link to dictyBase) - G00514 DDB0191259 Contig-U11201-1 VHB...605P (Link to Original site) VHB605F 666 VHB605Z 751 VHB605P 1397 - - Show VHB605 Library VH (Link to library) Clone ID VHB...Contig-U11201-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-A/VHB...605Q.Seq.d/ Representative seq. ID VHB605P (Link to Original site) Representative DNA sequence >VHB605 (VHB605Q) /CSM/VH/VHB...6-A/VHB605Q.Seq.d/ AAAATTATTATTTATAAATAATCTTTATCTTTAACTCTATATATATAAAAAATAATGGCC GATTTAA

  11. Dicty_cDB: VHB482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB482 (Link to dictyBase) - - - - VHB482P (Link to Original site) VHB482F 610 VHB...482Z 708 VHB482P 1298 - - Show VHB482 Library VH (Link to library) Clone ID VHB482 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...4-D/VHB482Q.Seq.d/ Representative seq. ID VHB482P (Link to... Original site) Representative DNA sequence >VHB482 (VHB482Q) /CSM/VH/VHB4-D/VHB482Q.Seq.d/ AACTCTCGAGTGCAAA

  12. Dicty_cDB: VHB687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB687 (Link to dictyBase) - - - - VHB687P (Link to Original site) VHB687F 601 VHB...687Z 740 VHB687P 1321 - - Show VHB687 Library VH (Link to library) Clone ID VHB687 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...6-D/VHB687Q.Seq.d/ Representative seq. ID VHB687P (Link to... Original site) Representative DNA sequence >VHB687 (VHB687Q) /CSM/VH/VHB6-D/VHB687Q.Seq.d/ TACTATTCCATATTTT

  13. Dicty_cDB: VHB660 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB660 (Link to dictyBase) - - - Contig-U10723-1 | Contig-U15294-1 VHB...660P (Link to Original site) VHB660F 602 VHB660Z 764 VHB660P 1346 - - Show VHB660 Library VH (Link to library) Clone ID VHB...723-1 | Contig-U15294-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-C/VHB...660Q.Seq.d/ Representative seq. ID VHB660P (Link to Original site) Representative DNA sequence >VHB660 (VHB...660Q) /CSM/VH/VHB6-C/VHB660Q.Seq.d/ CATCAACATCAACATCAACATCAACATCAACATCAACATCAACATCAACACCATTACAAA

  14. Dicty_cDB: VHB212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB212 (Link to dictyBase) - - - Contig-U16430-1 - (Link to Original site) VHB...212F 358 - - - - - - Show VHB212 Library VH (Link to library) Clone ID VHB212 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-A/VHB212Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB212 (VHB212Q) /CSM/VH/VHB2-A/VHB212Q.Seq.d/ ATATTTNATTTTTTTTT...ucing significant alignments: (bits) Value VHB212 (VHB212Q) /CSM/VH/VHB2-A/VHB212Q.Seq.d/ 432 e-120 VHG251 (

  15. Dicty_cDB: VHB733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB733 (Link to dictyBase) - - - - VHB733P (Link to Original site) VHB733F 617 VHB...733Z 690 VHB733P 1287 - - Show VHB733 Library VH (Link to library) Clone ID VHB733 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...7-B/VHB733Q.Seq.d/ Representative seq. ID VHB733P (Link to... Original site) Representative DNA sequence >VHB733 (VHB733Q) /CSM/VH/VHB7-B/VHB733Q.Seq.d/ AACTCTCGAGTGCAAA

  16. Dicty_cDB: VHB260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB260 (Link to dictyBase) - - - Contig-U12017-1 - (Link to Original site) - - VHB...260Z 568 - - - - Show VHB260 Library VH (Link to library) Clone ID VHB260 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-C/VHB260Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB260 (VHB260Q) /CSM/VH/VHB2-C/VHB260Q.Seq.d/ XXXXXXXXXXCTTTGAA...E Sequences producing significant alignments: (bits) Value VHB260 (VHB260Q) /CSM/VH/VHB2-C/VHB260Q.Seq.d/ 10

  17. Dicty_cDB: VHB666 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB666 (Link to dictyBase) - - - Contig-U12649-1 | Contig-U16394-1 VHB...666P (Link to Original site) VHB666F 303 VHB666Z 359 VHB666P 642 - - Show VHB666 Library VH (Link to library) Clone ID VHB...49-1 | Contig-U16394-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-C/VHB...666Q.Seq.d/ Representative seq. ID VHB666P (Link to Original site) Representative DNA sequence >VHB666 (VHB...666Q) /CSM/VH/VHB6-C/VHB666Q.Seq.d/ AAAAAAAAACCAACAATAGCAATAATAATTATAATAATAATAAATAATAATAATAATAAT

  18. Dicty_cDB: VHB436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB436 (Link to dictyBase) - - - - VHB436P (Link to Original site) VHB436F 590 VHB...436Z 731 VHB436P 1301 - - Show VHB436 Library VH (Link to library) Clone ID VHB436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...4-B/VHB436Q.Seq.d/ Representative seq. ID VHB436P (Link to... Original site) Representative DNA sequence >VHB436 (VHB436Q) /CSM/VH/VHB4-B/VHB436Q.Seq.d/ AACTCTCGAGTGCAAA

  19. Dicty_cDB: VHB167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB167 (Link to dictyBase) - - - Contig-U10801-1 | Contig-U12701-1 VHB...167P (Link to Original site) VHB167F 663 VHB167Z 719 VHB167P 1362 - - Show VHB167 Library VH (Link to library) Clone ID VHB...801-1 | Contig-U12701-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB...167Q.Seq.d/ Representative seq. ID VHB167P (Link to Original site) Representative DNA sequence >VHB167 (VHB...167Q) /CSM/VH/VHB1-C/VHB167Q.Seq.d/ GTNNTCCTTACAATAATAAAATAATAATAAATAATGGATAATACAGNATTAGTTATTAAT

  20. Dicty_cDB: VHB577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB577 (Link to dictyBase) - G23344 DDB0218553BP Contig-U16194-1 VHB...577P (Link to Original site) VHB577F 672 VHB577Z 655 VHB577P 1307 - - Show VHB577 Library VH (Link to library) Clone ID VHB...tig Contig-U16194-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB...577Q.Seq.d/ Representative seq. ID VHB577P (Link to Original site) Representative DNA sequence >VHB577 (VHB577Q) /CSM/VH/VHB...5-D/VHB577Q.Seq.d/ AGTAATTTATGAAATAACGATGAACAATATTCATAAATTTTCTAAAAATTCTTTTGCTGA AGT

  1. Dicty_cDB: VHB348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB348 (Link to dictyBase) - G02675 DDB0229897 Contig-U10996-1 VHB...348P (Link to Original site) VHB348F 616 VHB348Z 809 VHB348P 1405 - - Show VHB348 Library VH (Link to library) Clone ID VHB...Contig-U10996-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-B/VHB...348Q.Seq.d/ Representative seq. ID VHB348P (Link to Original site) Representative DNA sequence >VHB348 (VHB348Q) /CSM/VH/VHB...3-B/VHB348Q.Seq.d/ TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCCTTTTATTTGTTTAATAAACA TAATTTA

  2. Dicty_cDB: VHB512 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB512 (Link to dictyBase) - - - Contig-U15938-1 - (Link to Original site) VHB...512F 243 - - - - - - Show VHB512 Library VH (Link to library) Clone ID VHB512 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB5-A/VHB512Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB512 (VHB512Q) /CSM/VH/VHB5-A/VHB512Q.Seq.d/ ATTTCATTTTTCATATA...7 8e-32 VHC487 (VHC487Q) /CSM/VH/VHC4-D/VHC487Q.Seq.d/ 137 8e-32 VHB512 (VHB512Q) /CSM/VH/VHB5-A/VHB

  3. Dicty_cDB: VHB240 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB240 (Link to dictyBase) - - - Contig-U10749-1 | Contig-U16540-1 VHB...240P (Link to Original site) VHB240F 505 VHB240Z 185 VHB240P 670 - - Show VHB240 Library VH (Link to library) Clone ID VHB...49-1 | Contig-U16540-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB2-B/VHB...240Q.Seq.d/ Representative seq. ID VHB240P (Link to Original site) Representative DNA sequence >VHB240 (VHB...240Q) /CSM/VH/VHB2-B/VHB240Q.Seq.d/ ACTCTAACGTACCTAAAAATGAAAAGAAACACTAACGTCAGCTCATCCCGTAGAAAGTCA

  4. Dicty_cDB: VHB661 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB661 (Link to dictyBase) - - - Contig-U16292-1 | Contig-U16400-1 VHB...661P (Link to Original site) VHB661F 116 VHB661Z 689 VHB661P 785 - - Show VHB661 Library VH (Link to library) Clone ID VHB...92-1 | Contig-U16400-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB6-C/VHB...661Q.Seq.d/ Representative seq. ID VHB661P (Link to Original site) Representative DNA sequence >VHB661 (VHB...661Q) /CSM/VH/VHB6-C/VHB661Q.Seq.d/ TGGCCTACTGGAAAATAAACACTCACTCGATAGTGTAAAAGAAAAAAAAAAAAAAAAAAA

  5. Dicty_cDB: VHB776 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB776 (Link to dictyBase) - - - - VHB776P (Link to Original site) VHB776F 646 VHB...776Z 161 VHB776P 787 - - Show VHB776 Library VH (Link to library) Clone ID VHB776 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...7-D/VHB776Q.Seq.d/ Representative seq. ID VHB776P (Link to ...Original site) Representative DNA sequence >VHB776 (VHB776Q) /CSM/VH/VHB7-D/VHB776Q.Seq.d/ AACTCTCGAGTGCAAAA

  6. Dicty_cDB: VHB344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB344 (Link to dictyBase) - - - Contig-U11701-1 - (Link to Original site) - - VHB...344Z 659 - - - - Show VHB344 Library VH (Link to library) Clone ID VHB344 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB3-B/VHB344Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB344 (VHB344Q) /CSM/VH/VHB3-B/VHB344Q.Seq.d/ XXXXXXXXXXATTTTTA...Sequences producing significant alignments: (bits) Value VHB344 (VHB344Q) /CSM/VH/VHB3-B/VHB344Q.Seq.d/ 1287

  7. Dicty_cDB: VHB717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB717 (Link to dictyBase) - G22306 DDB0215360 Contig-U12406-1 VHB...717P (Link to Original site) VHB717F 655 VHB717Z 757 VHB717P 1392 - - Show VHB717 Library VH (Link to library) Clone ID VHB...Contig-U12406-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-A/VHB...717Q.Seq.d/ Representative seq. ID VHB717P (Link to Original site) Representative DNA sequence >VHB717 (VHB717Q) /CSM/VH/VHB...7-A/VHB717Q.Seq.d/ AATTACACACCAACTTCAATTCATTCCATCAGCTGATCATATAGTTGTTGTTGATAATGG TAAATTA

  8. Dicty_cDB: VHB325 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB325 (Link to dictyBase) - - - Contig-U10979-1 - (Link to Original site) VHB...325F 606 - - - - - - Show VHB325 Library VH (Link to library) Clone ID VHB325 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB3-B/VHB325Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB325 (VHB325Q) /CSM/VH/VHB3-B/VHB325Q.Seq.d/ ATTTTATTTTGATTTAA...ng significant alignments: (bits) Value VHB325 (VHB325Q) /CSM/VH/VHB3-B/VHB325Q.Seq.d/ 920 0.0 VFL219 (VFL21

  9. Dicty_cDB: VHB552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB552 (Link to dictyBase) - - - Contig-U13942-1 - (Link to Original site) - - VHB...552Z 158 - - - - Show VHB552 Library VH (Link to library) Clone ID VHB552 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB5-C/VHB552Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB552 (VHB552Q) /CSM/VH/VHB5-C/VHB552Q.Seq.d/ XXXXXXXXXXAANTGGT...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB552 (VHB552Q) /CSM/VH/VHB5-C/VHB

  10. Dicty_cDB: VHB802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB802 (Link to dictyBase) - - - Contig-U10871-1 | Contig-U12693-1 VHB...802P (Link to Original site) VHB802F 719 VHB802Z 785 VHB802P 1484 - - Show VHB802 Library VH (Link to library) Clone ID VHB...871-1 | Contig-U12693-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-A/VHB...802Q.Seq.d/ Representative seq. ID VHB802P (Link to Original site) Representative DNA sequence >VHB802 (VHB...802Q) /CSM/VH/VHB8-A/VHB802Q.Seq.d/ TTCATTTTTACCACCACAACACCAACACCACCACCACCATTCAAATTTATCACAATCATT

  11. Dicty_cDB: VHB890 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB890 (Link to dictyBase) - - - - VHB890P (Link to Original site) VHB890F 510 VHB...890Z 730 VHB890P 1220 - - Show VHB890 Library VH (Link to library) Clone ID VHB890 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...8-D/VHB890Q.Seq.d/ Representative seq. ID VHB890P (Link to... Original site) Representative DNA sequence >VHB890 (VHB890Q) /CSM/VH/VHB8-D/VHB890Q.Seq.d/ AACTCTCGAGTGCAAA

  12. Dicty_cDB: VHB141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB141 (Link to dictyBase) - - - Contig-U11418-1 | Contig-U13542-1 VHB...141P (Link to Original site) VHB141F 615 VHB141Z 765 VHB141P 1360 - - Show VHB141 Library VH (Link to library) Clone ID VHB...418-1 | Contig-U13542-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-B/VHB...141Q.Seq.d/ Representative seq. ID VHB141P (Link to Original site) Representative DNA sequence >VHB141 (VHB...141Q) /CSM/VH/VHB1-B/VHB141Q.Seq.d/ AGATTAACAAGCACTTCACACCAAATCACCAATGATGACCATACAAAAGATATTCTCTTT

  13. Dicty_cDB: VHB775 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB775 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHB...775F 646 - - - - - - Show VHB775 Library VH (Link to library) Clone ID VHB775 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB7-D/VHB775Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB775 (VHB775Q) /CSM/VH/VHB7-D/VHB775Q.Seq.d/ AACTCTCGAGTGCAAAA... alignments: (bits) Value VHB775 (VHB775Q) /CSM/VH/VHB7-D/VHB775Q.Seq.d/ 1221 0.0 VFA695 (VFA695Q) /CSM/VF/V

  14. Dicty_cDB: VHB595 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB595 (Link to dictyBase) - - - Contig-U15950-1 - (Link to Original site) - - VHB...595Z 616 - - - - Show VHB595 Library VH (Link to library) Clone ID VHB595 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB5-D/VHB595Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB595 (VHB595Q) /CSM/VH/VHB5-D/VHB595Q.Seq.d/ XXXXXXXXXXGTCAATT...core E Sequences producing significant alignments: (bits) Value VHB595 (VHB595Q) /CSM/VH/VHB5-D/VHB595Q.Seq.

  15. Dicty_cDB: VHB846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB846 (Link to dictyBase) - - - - VHB846P (Link to Original site) VHB846F 606 VHB...846Z 724 VHB846P 1310 - - Show VHB846 Library VH (Link to library) Clone ID VHB846 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB...8-B/VHB846Q.Seq.d/ Representative seq. ID VHB846P (Link to... Original site) Representative DNA sequence >VHB846 (VHB846Q) /CSM/VH/VHB8-B/VHB846Q.Seq.d/ ATTATTGTTAAAATAA

  16. Dicty_cDB: VHB351 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB351 (Link to dictyBase) - - - Contig-U15599-1 - (Link to Original site) - - VHB...351Z 781 - - - - Show VHB351 Library VH (Link to library) Clone ID VHB351 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB3-C/VHB351Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB351 (VHB351Q) /CSM/VH/VHB3-C/VHB351Q.Seq.d/ XXXXXXXXXXCTCAAAA...ces producing significant alignments: (bits) Value VHB351 (VHB351Q) /CSM/VH/VHB3-C/VHB351Q.Seq.d/ 1423 0.0 A

  17. Dicty_cDB: VHB285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB285 (Link to dictyBase) - - - Contig-U11212-1 - (Link to Original site) VHB...285F 617 - - - - - - Show VHB285 Library VH (Link to library) Clone ID VHB285 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-D/VHB285Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB285 (VHB285Q) /CSM/VH/VHB2-D/VHB285Q.Seq.d/ AAAGATATTGATTTCAC... Score E Sequences producing significant alignments: (bits) Value VHB285 (VHB285Q) /CSM/VH/VHB2-D/VHB285Q.Se

  18. Dicty_cDB: VHB513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB513 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHB...513F 648 - - - - - - Show VHB513 Library VH (Link to library) Clone ID VHB513 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB5-A/VHB513Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB513 (VHB513Q) /CSM/VH/VHB5-A/VHB513Q.Seq.d/ AACTCTCGAGTGCAAAA...f secretory system >> prediction for VHB513 is cyt 5' end seq. ID VHB513F 5' end seq. >VHB513F.Seq AACTCTCGA

  19. Dicty_cDB: VHB741 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB741 (Link to dictyBase) - - - Contig-U13473-1 - (Link to Original site) VHB...741F 610 - - - - - - Show VHB741 Library VH (Link to library) Clone ID VHB741 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB7-B/VHB741Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB741 (VHB741Q) /CSM/VH/VHB7-B/VHB741Q.Seq.d/ AAAAAGACCATCATAAT...es producing significant alignments: (bits) Value VHH188 (VHH188Q) /CSM/VH/VHH1-D/VHH188Q.Seq.d/ 850 0.0 VHB741 (VHB741Q) /CSM/VH/VHB

  20. Dicty_cDB: VHB626 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB626 (Link to dictyBase) - - - Contig-U15592-1 - (Link to Original site) VHB...626F 122 - - - - - - Show VHB626 Library VH (Link to library) Clone ID VHB626 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB6-B/VHB626Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB626 (VHB626Q) /CSM/VH/VHB6-B/VHB626Q.Seq.d/ AGTAGTAGTAGTAGTAG...ial 12.0 %: nuclear 8.0 %: cytoplasmic >> prediction for VHB626 is mit 5' end seq. ID VHB626F 5' end seq. >VHB

  1. Dicty_cDB: VHB413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB413 (Link to dictyBase) - - - Contig-U15763-1 - (Link to Original site) - - VHB...413Z 802 - - - - Show VHB413 Library VH (Link to library) Clone ID VHB413 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB4-A/VHB413Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB413 (VHB413Q) /CSM/VH/VHB4-A/VHB413Q.Seq.d/ XXXXXXXXXXTCNTTTG...kekh*kiykxker Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB413 (VHB413Q) /CSM/VH/VHB

  2. Dicty_cDB: VHB833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB833 (Link to dictyBase) - - - Contig-U16597-1 VHB833P (Link to Original site) VHB833F...(Link to library) Clone ID VHB833 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U16597-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB8-B/VHB833Q.Seq.d/ Representative...Representative seq. ID VHB833P (Link to Original site) Representative DNA sequence >VHB833 (VHB833Q) /CSM/VH/VHB8-B/VHB833Q...d/ AAAATNAATTTCCTTTAAAGATAGTTTTTTAAAGAAAAATGGCACCACCAACAAAAGAAT TAACAAATAAAGAGATTACAGCAATCAAGGGTATTTCA

  3. Dicty_cDB: VHB534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB534 (Link to dictyBase) - - - Contig-U15608-1 VHB534P (Link to Original site) VHB534F...(Link to library) Clone ID VHB534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U15608-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB5-B/VHB534Q.Seq.d/ Representative...Representative seq. ID VHB534P (Link to Original site) Representative DNA sequence >VHB534 (VHB534Q) /CSM/VH/VHB5-B/VHB534Q...d/ AGTTATCGTATTGATATTCCCATACTATTTATTCAAAAATATTTAGCCAAACCATAAAAT GGAATACGATTTAACCAAACAAATATGTTCATTCTTA

  4. Dicty_cDB: VHB365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB365 (Link to dictyBase) - - - Contig-U16152-1 VHB365P (Link to Original site) VHB365F...(Link to library) Clone ID VHB365 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U16152-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB3-C/VHB365Q.Seq.d/ Representative...Representative seq. ID VHB365P (Link to Original site) Representative DNA sequence >VHB365 (VHB365Q) /CSM/VH/VHB3-C/VHB365Q...AAAAGTAATTGAAAATTGTATTTTATTTATTAAAGAATGAATAAAATTATTTATTTGTTT GTTATTTTATTAATTTTTGGATATTTTAATGGTAAAATAATTTGCCAAAATGTTCCACCA

  5. Dicty_cDB: VHB305 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB305 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHB...305Z 676 - - - - Show VHB305 Library VH (Link to library) Clone ID VHB305 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB3-A/VHB305Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB305 (VHB305Q) /CSM/VH/VHB3-A/VHB305Q.Seq.d/ XXXXXXXXXXAGAATAA...chondrial 32.0 %: nuclear 16.0 %: cytoplasmic 8.0 %: vacuolar 4.0 %: cytoskeletal 4.0 %: endoplasmic reticulum >> prediction for VHB

  6. Dicty_cDB: VHB451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB451 (Link to dictyBase) - - - Contig-U15638-1 VHB451P (Link... to Original site) VHB451F 651 VHB451Z 251 VHB451P 882 - - Show VHB451 Library VH (Link to library) Clone ID VHB451 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15638-1 Original site URL http://dict...SSNLLVQSQTLTNITKYPDTSQLQYDQSYLRICTNLF EQIVNFNTTLSVEFVYDACYTCEYQNLVVLDSSSSKYIIMPSTFGYKFNISVLYNGKAQD DILYLSFHE...o Acid sequence (All Frames) Frame A: ecvpt*KLKMNKVILLFFLFITYSSNLLVQSQTLTNITKYPDTSQLQYDQSYLRICTNLF EQIVNFNTT

  7. Vitreoscilla hemoglobin promotes Salecan production by Agrobacterium sp. ZX09.

    Science.gov (United States)

    Chen, Yun-mei; Xu, Hai-yang; Wang, Yang; Zhang, Jian-fa; Wang, Shi-ming

    2014-11-01

    Salecan is a novel exopolysaccharide produced by the strain Agrobacterium sp. ZX09, and it is composed of only glucose monomers. The unique chemical composition and excellent physicochemical properties make Salecan a promising material for applications in coagulation, lubrication, protection against acute liver injury, and alleviating constipation. In this study, we cloned the Vitreoscilla hemoglobin gene into a broad-host-range plasmid pCM158. Without antibiotic selection, there was negligible loss of the plasmid in the host Agrobacterium sp. ZX09 after one passage of cultivation. The expression of Vitreoscilla hemoglobin was demonstrated by carbon monoxide (CO) difference spectrum. The engineered strain Agrobacterium sp. ZX09 increased Salecan yield by 30%. The other physiological changes included its elevated respiration rate and cellular invertase activity.

  8. Dicty_cDB: VHB545 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB545 (Link to dictyBase) - - - Contig-U11170-1 - (Link to Original site) VHB545F...VHB545F 133 - - - - - - Show VHB545 Library VH (Link to library) Clone ID VHB545 (Link to dictyBase) Atlas...CW939189 |CW939189.1 TcB19.2_H09_T7 Tribolium BAC library Tribolium castaneum genomic, genomic survey sequence...CG766104 |CG766104.1 TcB40.3_C02_T7 Tribolium BAC library Tribolium castaneum genomic, genomic survey sequence

  9. Dicty_cDB: VHB317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB317 (Link to dictyBase) - - - Contig-U11361-1 VHB317P (Link... to Original site) VHB317F 646 VHB317Z 748 VHB317P 1374 - - Show VHB317 Library VH (Link to library) Clone ID VHB317 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11361-1 Original site URL http://dict...E133491.1 SiJWH07ADU Lausanne fire ant library Solenopsis invicta cDNA, mRNA sequence. 46 3e-11 4 DT662586 |...milar to UniRef90_UPI000051A2A9 Cluster related to UPI000051A2A9; PREDICTED: similar to CG8939-PA. Score = 3

  10. Vitreoscilla hemoglobin gene ( vgb) improves lutein production in Chlorella vulgaris

    Science.gov (United States)

    Ma, Ruijuan; Lin, Xiangzhi

    2014-03-01

    Vitreoscilla hemoglobin is an oxygen-binding protein that promotes oxygen delivery and reduces oxygen consumption under low oxygen conditions to increase the efficiency of cell respiration and metabolism. In this study, we introduced a Vitreoscilla hemoglobin gene ( vgb) into Chlorella vulgaris by Agrobacterium tumefaciens -mediated transformation (ATMT). PCR analysis confirmed that the vgb gene was successfully integrated into the Chlorella vulgaris genome. Analysis of biomass obtained in shake flasks revealed transformant biomass concentrations as high as 3.28 g/L, which was 38.81% higher than that of the wild-type strain. Lutein content of transformants also increased slightly. Further experiments recovered a maximum lutein yield of 2.91 mg/L from the transformants, which was 36.77% higher than that of the wild-type strain. The above results suggest that integrated expression of the vgb gene may improve cell growth and lutein yield in Chlorella vulgaris, with applications to lutein production from Chlorella during fermentation.

  11. Relationship between mean corpuscular haemoglobin ...

    African Journals Online (AJOL)

    Relationship between mean corpuscular haemoglobin concentration and placental alkaline phosphatase activity among pregnant women in Nigeria. ... Socio-demographic data implicate illiteracy, low household income, poor diet and inadequate antenatal care for the observed reduction in MCHC among the group A ...

  12. Identification of the haemoglobin scavenger receptor

    DEFF Research Database (Denmark)

    Kristiansen, M; Graversen, Jonas Heilskov; Jacobsen, C

    2001-01-01

    Intravascular haemolysis is a physiological phenomenon as well as a severe pathological complication when accelerated in various autoimmune, infectious (such as malaria) and inherited (such as sickle cell disease) disorders. Haemoglobin released into plasma is captured by the acute phase protein...... of haemoglobin and dimeric haptoglobin (the 1-1 phenotype). Specific CD163-mediated endocytosis of haptoglobin-haemoglobin complexes is measurable in cells transfected with CD163 complementary DNA and in CD163-expressing myelo-monocytic lymphoma cells....

  13. Bone disease in haemoglobin disorders

    Directory of Open Access Journals (Sweden)

    Ersi Voskaridou

    2013-03-01

    Full Text Available Bone disease represents a prominent cause of morbidity in patients with thalassaemia and other haemoglobin disorders. The delay in sexual maturation, the presence of diabetes and hypothyroidism, the parathyroid gland dysfunction, the haemolytic anaemia, the progressive marrow expansion, the iron toxicity on osteoblasts, the iron chelators, and the deficiency of growth hormone or insulin growth factors have been identified as major causes of osteoporosis in thalassaemia. Adequate hormonal replacement, effective iron chelation, improvement of hemoglobin levels, calcium and vitamin D administration, physical activity, and smoking cessation are the main to-date measures for the management of the disease. During the last decade, novel pathogenetic data suggest that the reduced osteoblastic activity, which is believed to be the basic mechanism of bone loss in thalassemia, is accompanied by a comparable or even greater increase in bone resorption. Therefore, potent inhibitors of osteoclast activation, such as the aminobisphosphonates, arise as key drugs for the management of osteoporosis in thalassaemia patients and other haemoglobin disorders.

  14. Repeated batch fermentation of immobilized E. coli expressing Vitreoscilla hemoglobin for long-term use.

    Science.gov (United States)

    Sar, Taner; Seker, Gamze; Erman, Ayse Gokce; Stark, Benjamin C; Yesilcimen Akbas, Meltem

    2017-09-03

    This study describes an efficient and reusable process for ethanol production from medium containing whey powder, using alginate immobilized ethanologenic E. coli strains either expressing (TS3) or not expressing (FBR5) Vitreoscilla hemoglobin. Reuseabilities of the FBR5 and TS3 strains were investigated regarding their ethanol production capacities over the course of 15 successive 96-h batch fermentations. The ethanol production was fairly stable over the entire duration of the experiment, with strain TS3 maintaining a substantial advantage over strain FBR5. Storage of both strains in 2 different solutions for up to 60 d resulted in only a modest loss of ethanol production, with strain TS3 consistently outperforming strain FBR5 by a substantial amount. Strains stored for 15 or 30 d maintained their abilities to produce ethanol without dimunition over the course of 8 successive batch fermentations; again strain TS3 maintained a substantial advantage over strain FBR5 throughout the entire experiment. Thus, immobilization is a useful strategy to maintain the advantage in ethanol productivity afforded by expression of Vitreoscilla hemoglobin over long periods of time and large numbers of repeated batch fermentations, including, as in this case, using media with food processing wastes as the carbon source.

  15. Structure of the haptoglobin-haemoglobin complex

    DEFF Research Database (Denmark)

    Andersen, Christian Brix Folsted; Torvund-Jensen, Morten; Nielsen, Marianne Jensby

    2012-01-01

    Red cell haemoglobin is the fundamental oxygen-transporting molecule in blood, but also a potentially tissue-damaging compound owing to its highly reactive haem groups. During intravascular haemolysis, such as in malaria and haemoglobinopathies, haemoglobin is released into the plasma, where...

  16. Misleading presentation of haemoglobin electrophoresis data | Adu ...

    African Journals Online (AJOL)

    Haemoglobinopathies are common in sub-Saharan Africa. As such haemoglobin electrophoresis are required to inform clinical decision making. However, haemoglobin electrophoresis is an assay that detects protein at either alkaline or acidic pH. Such assays do not interrogate gene sequences but rather the product of a ...

  17. Structural and functional comparison of trematode haemoglobins.

    Science.gov (United States)

    Rashid, K A; Haque, M; Siddiqi, A H

    1995-03-01

    Haemoglobins from three different species of trematodes (Gastrothylax crumenifer, Paramphistomum epiclitum and Isoparorchis hypselobagri) and their respective hosts were digested with papain. Peptides so produced were separated on 10-15% SDS-PAGGE. The probability of coincidence of the peptides was analysed statistically. Oxygen affinity curves of trematode haemoglobins were found to be a rectangular hyperbolic. The Hill coefficient values of all the trematode haemoglobins were found to be 1. The P50 values, at 25 degrees C in 0.2M phosphate buffer pH 7.4, ranged from 0.8 to 1.6 mmHg.

  18. Molecular evolution of plant haemoglobin: two haemoglobin genes in Nymphaeaceae Euryale ferox.

    Science.gov (United States)

    Guldner, E; Desmarais, E; Galtier, N; Godelle, B

    2004-01-01

    We isolated and sequenced two haemoglobin genes from the early-branching angiosperm Euryale ferox (Nymphaeaceae). The two genes belong to the two known classes of plant haemoglobin. Their existence in Nymphaeaceae supports the theory that class 1 haemoglobin was ancestrally present in all angiosperms, and is evidence for class 2 haemoglobin being widely distributed. These sequences allowed us to unambiguously root the angiosperm haemoglobin phylogeny, and to corroborate the hypothesis that the class 1/class 2 duplication event occurred before the divergence between monocots and eudicots. We addressed the molecular evolution of plant haemoglobin by comparing the synonymous and nonsynonymous substitution rates in various groups of genes. Class 2 haemoglobin genes of legumes (functionally involved in a symbiosis with nitrogen-fixing bacteria) show a higher nonsynonymous substitution rate than class 1 (nonsymbiotic) haemoglobin genes. This suggests that a change in the selective forces applying to plant haemoglobins has occurred during the evolutionary history of this gene family, potentially in relation with the evolution of symbiosis.

  19. Relationship between glycated Haemoglobin and glucose levels in ...

    African Journals Online (AJOL)

    Glycated haemoglobin, which is the non-enzymatic addition of a glucose molecule to one or both of the N-terminal valine of β chain of haemoglobin, is expressed as the percentage of adult haemoglobin that is glycated. Objective: To determine the relationship between fasting plasma glucose and glycated haemoglobin in a ...

  20. FOETAL HAEMOGLOBIN (HbF) STATUS IN ADULT SICKLE CELL ...

    African Journals Online (AJOL)

    increase in haemoglobin F inhibits polymerization of sickle haemoglobin. The varying levels of foetal haemoglobin in erythro- cytes account for a larger part of clinical heterogene-. FOETAL HAEMOGLOBIN (HbF) STATUS IN ADULT SICKLE CELL ANAEMIA. PATIENTS IN IBADAN, NIGERIA. *J.A. Olaniyi; +O.G Arinola; ...

  1. Comparative spectral, electrophoretic and isoelectric properties of trematode haemoglobins.

    Science.gov (United States)

    Rashid, K A; Haque, M; Siddiqi, A H

    1993-09-01

    A comparative study of the spectral, electrophoretic and isoelectric properties of the haemoglobins of three trematodes, Paramphistomum epiclitum, Gigantocotyle explanatum and Gastrothylax crumenifer was carried out. A high absorption in the beta band region indicates that trematode haemoglobins have high oxygen affinities. Electrophoretic mobilities of all trematode and their host haemoglobins were different. The isoelectric points of trematode haemoglobins were found to focus in the acidic range except that of G. crumenifer haemoglobin I, which focused at an alkaline pH.

  2. Relationship between glycated haemoglobin and fasting plasma ...

    African Journals Online (AJOL)

    Background: Glycated haemoglobin (HbA1c) measurement provides an accurate result of glycaemic levels from blood drawn at any time of day without reference to prandial state. We established the relationship between HbA1c and fasting plasma glucose (FPG) in diabetic out-patients among diabetic outpatients in Lusaka ...

  3. fasting blood glucose and glycosylated haemoglobin levels

    African Journals Online (AJOL)

    Prince Acheampong

    ABSTRACT. This work involved the measurement of fasting blood glucose (FBG) and glycosylated haemoglobin. (HbA1c) levels of diabetes mellitus patients as an index of glycaemic control. It was a prospective case- finding study using laboratory and general practice records. The subjects were confirmed diabetic patients ...

  4. Predicting postoperative haemoglobin changes after burn surgery ...

    African Journals Online (AJOL)

    Background. Burn surgery is associated with significant blood loss and fluid shifts that cause rapid haemoglobin (Hb) changes during and after surgery. Understanding the relationship between intraoperative and postoperative (day 1) Hb changes may assist in avoiding postoperative anaemia and unnecessary ...

  5. Is glycosylated haemoglobin a marker of fertility?

    DEFF Research Database (Denmark)

    Hjollund, N H; Jensen, Tina Kold; Bonde, Jens Peter

    1999-01-01

    We performed a follow-up study of time to pregnancy in a population of first-time pregnancy planners without previous reproductive experience. The objective of this paper is to report and discuss a finding of a strong relationship between glycosylated haemoglobin (HbA1C) and fertility. A total of...

  6. Changing reference intervals for haemoglobin in Denmark

    DEFF Research Database (Denmark)

    Ryberg-Nørholt, Judith; Frederiksen, Henrik; Nybo, Mads

    2017-01-01

    INTRODUCTION: Based on international experiences and altering demography the reference intervals (RI) for haemoglobin (Hb) concentrations in blood were changed in Denmark in 2013 from 113 - 161 g/L to 117 - 153 g/L for women and from 129 - 177 g/L to 134 - 170 g/L for men. The aim of this study w...

  7. Haematocrit, Haemoglobin, Total Protein And Whole Blood ...

    African Journals Online (AJOL)

    The study was performed on a total of one hundred and nineteen apparently healthy mallards, reared under the traditional extensive management system with the aim of establishing the base-line values of packed cell volume (PCV), haemoglobin (Hb), total protein (TP) and whole blood coagulation time (WBCT) of these ...

  8. Predicting postoperative haemoglobin changes after burn surgery

    African Journals Online (AJOL)

    Burn surgery is associated with significant peri-operative haemoglobin. (Hb) changes. During surgery, blood loss mainly occurs owing to wound debridement and skin harvesting. However, administration of clear fluid, required to maintain intravascular volume status during anaesthesia and surgery, leads to haemodilution ...

  9. Factors associated with anaemia status and haemoglobin ...

    African Journals Online (AJOL)

    The data presented here includes anthropometry, malaria parasitism, concentrations of haemoglobin (Hb) and serum transferrin receptor (STfR), and ... These results shed light on the specific causes of anaemia in the Zambian context, and illustrate the importance of improving dietary quality, specifically the intake of iron, ...

  10. Glycated haemoglobin and associated variables in diabetics: Ilorin ...

    African Journals Online (AJOL)

    DCCT) have confirmed the important role of glycated haemoglobin estimation in the long~term moni- toring of diabetic patients“. The extent of haemoglobin glycation has been positively correlated with fasting blood sugar in vari- ous studies?

  11. Prevalence of haemoglobin variants among the Ika ethnic nationality ...

    African Journals Online (AJOL)

    Background: Haemoglobin genotype is an important blood component that determines haemoglobinopathies. Distribution of haemoglobin variants was investigated among the Ika ethnic nationality of Delta State, Nigeria. Aim: The resent study was conducted to determine the prevalence of haemoglobin variants and also to ...

  12. Pre-stretch induced leakage current in VHB electroactive polymers

    Science.gov (United States)

    Hammami, S.; Jean-Mistral, C.; Jomni, F.; Sylvestre, A.

    2016-04-01

    Dielectric elastomers generators (DEGs) constitute promising systems due to their high energy density. This latter is influenced by viscoelasticity and the leakage current. An understanding of this leakage current and how it can be influenced by the stretch state of material is required to predict or optimize DEGs. In this context, our work consisted in studying the evolution of the leakage current in commercial electroactive polymer (3 M VHB4910) using silver grease as electrodes. This analysis has been performed in order to evaluate the influence of three different factors: the biaxial prestretch (λ2 = 4, 9 and 16), the temperature (from 20°C to 80°C) and the high electric field (from 1MVm-1 to 20MVm-1). Main results are (i) the increase in the leakage current at higher pre-stretch due to the increase of the electric field, (ii) a predominant Schottky conduction mechanism (iii) a lower current at room temperature for asymmetric pre-stretch compared to an equivalent area surface ratio with symmetric pre-stretch, (iv) the point iii fails when the material works at temperatures higher than room temperature. Probable changes in the molecular chains with strain explain these results.

  13. Comparative evaluation of haemoglobin estimation amongst ...

    African Journals Online (AJOL)

    Administrator

    2006-05-30

    May 30, 2006 ... Comparative evaluation of haemoglobin estimation ... fréquentaient le service de consultation prénatale au Centre Hospitalier Universtaire d' Ibadan, Nigéria, entre le le avril et le 30 mai ... rurales promouvant ainsi l´ accès á la qualité de soin dans les pays qui ne disposent pas d´assez de ressources. (Rev.

  14. How does static stretching decrease the dielectric constant of VHB 4910 elastomer?

    Science.gov (United States)

    Vu-Cong, T.; Nguyen-Thi, N.; Jean-Mistral, C.; Sylvestre, A.

    2014-03-01

    Subject to a voltage, dielectric elastomers deform by the effect of Maxwell stress which is depended directly on the dielectric constant of the material. The combination of large strain, soft elastic response and good dielectric properties has established VHB 4910 elastomer as the most used material for dielectric elastomer actuators. However, the effect of stretch on the dielectric constant for this elastomer is much debated topic while controversy results are demonstrated in the literature. The dielectric constant of this material is studied and demonstrated that it decreases slightly or hugely among the stretch but any pertinent response and any physic explications are validated by the scientific community. In this paper, we presented a detail study about dielectric behavior of VHB 4910 elastomer versus a broadband of stretch and temperature. We found that the dielectric constant of this material depends strongly on the stretch following a polynomial law. Among all the explanations of stretch dependence of the dielectric constant of VHB 4910 in the literature: the crystallization, the change of glass transition temperature, the decrease of dipole orientation, the electrostriction effect under stress; and based on our experimental result, we conclude that the decrease of dipole orientation seems the main reason to the drop of dielectric constant of VHB 4910 elastomer versus the stretch. We proposed also an accurate model describing the dielectric constant of this material for a large range of stretch and temperature.

  15. Is glycosylated haemoglobin a marker of fertility?

    DEFF Research Database (Denmark)

    Hjollund, N H; Jensen, T K; Bonde, J P

    1999-01-01

    We performed a follow-up study of time to pregnancy in a population of first-time pregnancy planners without previous reproductive experience. The objective of this paper is to report and discuss a finding of a strong relationship between glycosylated haemoglobin (HbA1C) and fertility. A total...... concentration of inhibin A. No association was found between HbA1C and psychosocial distress. The reduced fertility among women with high HbA1C may be due to an association with subclinical polycystic ovaries as indicated by the hormonal profile....

  16. The dielectric constant of 3M VHB: a parameter in dispute

    Science.gov (United States)

    McKay, Thomas G.; Calius, Emilio; Anderson, Iain A.

    2009-03-01

    Dielectric Elastomer (DE) transducers are essentially compliant capacitors fabricated from highly flexible materials that can be used as sensors, actuators and generators. The energy density of DE is proportional to their dielectric constant (ɛr), therefore an understanding of the dielectric constant and how it can be influenced by the stretch state of the material is required to predict or optimize DE device behavior. DE often operate in a stretched state. Wissler and Mazza, Kofod et al., and Choi et al. all measured an ɛr of approximately 4.7 for virgin VHB, but their results for prestretched DE showed that the dielectric constant decayed to varying degrees. Ma and Cross measured a dielectric constant of 6 for the same material with no mention of prestretch. In an attempt to resolve this discrepancy, ɛr measurements were performed on parallel plate capacitors consisting of virgin and stretched VHB4905 tape electroded with either gold sputtered coatings or Nyogel 756G carbon grease. For an unstretched VHB tape, an ɛr of 4.5 was measured with both electrode types, but the measured ɛr of equibiaxially stretched carbon specimens was lower by between 10 to 15%. The dielectric constant of VHB under high fields was assessed using blocked force measurements from a dielectric elastomer actuator. Dielectric constants ranging from 4.6-6 for stretched VHB were calculated using the blocked force tests. Figure of merits for DE generators and actuators that incorporate their nonlinear behavior were used to assess the sensitivity of these systems to the dielectric constant.

  17. Haemoglobins in cattle and buffalo. Haemoglobin types of Bos taurus, Bos indicus, Bos banteng and Bubalis bubalis in northern Australia.

    Science.gov (United States)

    Bachmann, A W; Campbell, R S; Yellowlees, D

    1978-10-01

    The frequency of haemoglobin types in several major breeds of cattle in northern Austrailia was determined. In all Boss taurus cattle examined only the three common bovine haemoglobin types (AA, AB, BB) were found. F2 Africander cross-breeds showed only AA patterns. The frequency of haemoglobin B was significantly higher in Bos indicus type cattle than in Bos taurus breeds. In the pure breed Banteng cattle (Bos banteng) three genotypes (BB, CB, CC) were present. The eleven buffaloes types each showed two haemoglobins (A1 and A2) in proporotions of 71 to 29 respectively.

  18. Characterization of haemoglobin from Actinorhizal plants–An in ...

    Indian Academy of Sciences (India)

    Plant haemoglobins (Hbs), found in both symbiotic and non-symbiotic plants, are heme proteins and members of the globin superfamily. Hb genes of actinorhizal Fagales mostly belong to the non-symbiotic type of haemoglobin; however, along with the non-symbiotic Hb, Casuarina sp. posses a symbiotic one (symCgHb), ...

  19. Intravenous iron in clinical concentrations does not impair haemoglobin measurement.

    Science.gov (United States)

    O'Loughlin, Edmond; Garnett, Peter Bj; Falkner, Nathalie M; Williams, Robin

    2016-03-01

    Intravenous iron is commonly administered to anaemic patients to treat iron deficiency, but due to its ferric colouration, it may interfere with the spectrophotometric assessment of haemoglobin concentrations. This paper investigates the potential interference of three clinically used intravenous iron preparations on the measurement of haemoglobin. Haemoglobin concentration was measured for neat and Hartmann's solution-diluted iron polymaltose, carboxymaltose and sucrose solutions using bedside (Radiometer HemoCue®), point-of-care (Radiometer ABL800 Flex) and laboratory (Abbott CellDyne Sapphire™) devices. Haemoglobin concentration was then assessed with the same devices utilizing anaemic whole blood with the iron solutions added. Neat iron preparations registered clinically significant haemoglobin concentrations on bedside and laboratory measurements. When intravenous iron preparations were diluted to clinical concentrations, their effect on haemoglobin measurements, either in isolation or mixed with anaemic blood, was negligible. Although neat preparations of intravenous iron do interfere with spectrophotometric analysis of haemoglobin, concentrations likely to be seen post iron infusion do not significantly interfere with haemoglobin measurement. © The Author(s) 2015.

  20. Field evaluation of a novel haemoglobin measuring device ...

    African Journals Online (AJOL)

    Objective. To evaluate the use of a robust, cheap method for haemoglobin estimation by non-laboratory-trained personnel in a ruraJ setting. Design. Comparative study. Setting. TIntswalo Hospital. Acomhoek. Participants. 7 nursing sisters, 4 medical students, 2 lay persons. Outcome measures. Haemoglobin estimates ...

  1. The effects of maternal haemoglobin as an indicator of maternal ...

    African Journals Online (AJOL)

    Background: Maternal measles antibodies (MMA) are actively transferred through the placenta from mother to foetus. A relationship could exist between MMA of mother-infant pairs and maternal nutritional indicator (haemoglobin). Objectives: This study reviewed the effects of maternal haemoglobin (Hb) on MMA of ...

  2. Haemoglobin F levels in healthy Nigerian adults | Kotila | West ...

    African Journals Online (AJOL)

    The association between HbF and high Persistence of fetal haemoglobin (HPFH) and the thalassaemias are discussed. Key words: HbF, Hereditary persistence of fetal haemoglobin, Thalassaemias, Healthy adults. Résumé La maladie de la drépanocytose est un désordre génétique majeur dans le tropique de l'Afrique, ...

  3. Field evaluation of a novel haemoglobin measuring device ...

    African Journals Online (AJOL)

    Objective. To evaluate the use of a robust, cheap method for haemoglobin estimation by non-laboratory-trained personnel in a rural setting. Design. Comparative study. Setting. Tintswalo Hospital. Acomhoek. Participants. 7 nursing sisters, 4 medical students, 2 lay persons. Outcome measures. Haemoglobin estimates ...

  4. Haemoglobin, a new major allergen of Anisakis simplex.

    Science.gov (United States)

    González-Fernández, Juan; Daschner, Alvaro; Nieuwenhuizen, Natalie E; Lopata, Andreas L; Frutos, Consolación De; Valls, Ana; Cuéllar, Carmen

    2015-05-01

    Gastro-allergic anisakiasis and Anisakis sensitisation associated chronic urticaria are diseases which differ in their IgE and IgG4 responses against both crude extract and specific allergens. Anisakis and Ascaris are closely related nematodes that usually cause problems with specificity in immunodiagnostics. In this study we measured IgE and IgG4 antibodies against Anisakis simplex sensu lato (s. l.) and Ascaris suum haemoglobins in sera of 21 gastro-allergic anisakiasis and 23 chronic urticaria patients. We used a capture ELISA with the anti-Anisakis haemoglobin monoclonal antibody 4E8g, which also recognises Ascaris haemoglobin. In addition, we determined specific IgE and IgG4 to both nematodes by indirect ELISA and immunoblotting. Anti-A. simplex s. l. haemoglobin IgE and IgG4 levels were higher in gastro-allergic anisakiasis than in chronic urticaria patients (P=0.002 and 0.026, respectively). Surprisingly, no patient had detectable IgE levels against A. suum haemoglobin. Finally, we carried out an in silico study of the B-cell epitopes of both haemoglobin molecules. Five epitopes were predicted in Anisakis pegreffii and four in A. suum haemoglobin. The epitope propensity values of Anisakis haemoglobin in the equivalent IgE binding region of the allergenic haemoglobin Chi t 1 from Chironomus thummi, were higher those of the Ascaris haemoglobin. In conclusion, we describe A. simplex haemoglobin as a new major allergen (Ani s 13), being recognised by a large number (64.3%) of sensitised patients and up to 80.9% in patients with gastro-allergic anisakiasis. The presence of a specific epitope and the different values of epitope propensity between Anisakis and Ascaris haemoglobin could explain the lack of cross-reactivity between the two molecules. The absence of IgE reactivity to Ascaris haemoglobin in Anisakis patients makes Anisakis haemoglobin (Ani s 13) a potential candidate for developing more specific diagnosis tools. Copyright © 2015 Australian Society for

  5. Reference values of glycosylated haemoglobin and fructosamin in dogs

    Directory of Open Access Journals (Sweden)

    Olair Carlos Beltrame

    2014-09-01

    Full Text Available Glycated haemoglobin and fructosamin levels are not commonly used to diagnosis Diabetes mellitus in dogs due to a lack of reference values. To estabilish the reference values and determination methods of glycated haemoglobin and frutosamine, both male and females, healthy dogs, 2-8 years old (n=100 were used. The methodologies used were the ionic resin and the kinetic method by the reduction of blue nitrotetrazolium, respectively. Medium values of glycated haemoglobin of 5.3-7.01% and 277.52-387. 30 for fructosamin established by Brazilian Diabetes Society methods can be adopted for dogs, both males and females.

  6. Fetal haemoglobin induction in sickle cell disease.

    Science.gov (United States)

    Paikari, Alireza; Sheehan, Vivien A

    2018-01-01

    Fetal haemoglobin (HbF, α2γ2) induction has long been an area of investigation, as it is known to ameliorate the clinical complications of sickle cell disease (SCD). Progress in identifying novel HbF-inducing strategies has been stymied by limited understanding of gamma (γ)-globin regulation. Genome-wide association studies (GWAS) have identified variants in BCL11A and HBS1L-MYB that are associated with HbF levels. Functional studies have established the roles of BCL11A, MYB, and KLF1 in γ-globin regulation, but this information has not yielded new pharmacological agents. Several drugs are under investigation in clinical trials as HbF-inducing agents, but hydroxycarbamide remains the only widely used pharmacologic therapy for SCD. Autologous transplant of edited haematopoietic stem cells holds promise as a cure for SCD, either through HbF induction or correction of the causative mutation, but several technical and safety hurdles must be overcome before this therapy can be offered widely, and pharmacological therapies are still needed. © 2017 John Wiley & Sons Ltd.

  7. The change of haemoglobin during blood donation, and an assessment of a photometrical method for non-invasive haemoglobin analysis

    OpenAIRE

    Nilsson, Helen

    2013-01-01

    In Sweden, lowest acceptable haemoglobin levels in blood donators are 125g/L for women and 135g/L for men for a test sample taken in the beginning of the blood donation. Levels, which are 10g/L lower, are accepted if the sample is taken after the blood donation. Earlier studies show that the haemoglobin level decreases for a person that is lying down. The two aims of this study were to examine how much the haemoglobin levels change during blood donation and to examine if the photometrical ins...

  8. Validation of the haemoglobin colour scale for screening blood ...

    African Journals Online (AJOL)

    blood donors for anaemia, using the WHO Haemoglobin Colour. Scale (HCS) for initial ... Anaemia is a major public health concern in Malawi and most low and middle income .... not have prior knowledge of the HCS results. The donor had.

  9. Biophysical characterization of Artemia salina (L.) extracellular haemoglobins.

    Science.gov (United States)

    Wood, E J; Barker, C; Moens, L; Jacob, W; Heip, J; Kondo, M

    1981-01-01

    Sedimentation coefficients (s0 20,w) of 11.57 +/- 0.10 S and 11.52 +/- 0.09 S were assigned for Artemia salina (L.) extracellular haemoglobins II and III respectively. These values are not significantly different. The molecular weights, M0w and M0z, of the native haemoglobins as determined by the high-speed sedimentation-equilibrium method were for haemoglobin II 239 400 +/- 7200 and 240 400 +/- 2600 respectively, and for haemoglobin III 216 300 +/- 6500 and 219 300 +/- 4500 respectively. The observed increase of Mapp. with concentration suggested that association was occurring over the concentration range investigated. Exposure of haemoglobin II to either 6 M-guanidinium chloride or to low pH (pH 4) resulted in dissociation to units of approximately half the size of the native protein, with molecular weights approx. 115 000. Electron-microscopic observations indicated a molecular structure composed of two stacked lobed discs. These results strongly support the dimeric model for Artemia haemoglobins proposed by Moens & Kondo [(1978) Eur. J. Biochem. 82, 65-72].

  10. Investigation of haemoglobin polymorphism in Ogaden cattle

    Directory of Open Access Journals (Sweden)

    Sanjoy Kumar Pal

    2014-04-01

    Full Text Available Background and Aim: The Ogaden cattle is one among the tropical cattle breeds (Bos indicus widely distributed in eastern and south eastern part of Ethiopia. The breed has been evolved in arid and semi arid agro-ecological setup, but later on distributed and adapted to the wide agro-ecological zones. Because of its multi-purpose role, the Ogaden cattle have been used for milk, beef, and income generation. Information on the inherent genetic diversity is important in the design of breeding improvement programmes, making rational decisions on sustainable utilization and conservation of Animal Genetic Resources. Limited information is available about genetic variation of Ogaden breed at molecular level. The present investigation was aimed to study the biochemical polymorphism at the Hemoglobin (Hb locus. Materials and Methods: Blood samples collected from 105 Ogaden cattle maintained at Haramaya beef farm by jugular vein puncture were subjected to agarose gel electrophoresis [pH range 8.4-8.5] to study the polymorphic activities of haemoglobin. Results: Three types of phenotypes were detected i.e. a slow moving (AA band, fast moving (BB band and a combination of slow + fast moving bands (AB. The frequency of the fast moving band was less [13 (12.3%] than the slow moving band [57 (54.2%]. Both slow & fast moving phenotype was observed in 35 (33.3% animals. The gene frequency of HBA allele was 0.709 and that of HBB allele 0.291. Conclusion: The distribution of phenotypes was in agreement with codominant single gene inheritance. The Chi-square (χ2 test revealed that the population is under Hardy-Weinberg equilibrium.

  11. Exercise and sports in haemoglobin disorders

    Directory of Open Access Journals (Sweden)

    D. Yazman

    2011-12-01

    Full Text Available Anaemia causes lower oxygen transport to tissues, interfering with normal physical development and may interfere with exercise and sports in thalassemia and Sickle-Cell-Disease (SCD l. Moreover, in SCD, the abnormal haemoglobin alters the erythrocyte shape and leads to pulmonary parenchymal damage, impaired vascular function and micro vascular complications. However, we now accept that, with regular blood transfusions and efficient oral or parenteral chelation modalities, many patients lead a normal development and life with little or no change from the lifestyle of their unaffected friends, although there are cognitive and emotional factors leading behaviour for participation in the social life and exercise, as studied by many scientists in Italy, United Kingdom, Greece and India. 贫血导致组织供氧不足,妨碍身体的正常发育,并可能干扰地中海贫血和镰状细胞病(SCD)患者的体育运动。更严重的是,在镰状细胞病患者体内,异常血红蛋白能改变红细胞形态,造成肺薄壁组织损害、血管功能损伤,并引起微血管并发症。 然而,意大利、英国、希腊和印度的多位科学家的研究表明:尽管认知因子和情感因子是参加社会生活和运动的主导行为,但只要患者定期输血和采用高效的口服或非口服螯合疗法,很多人都可以正常发育和生活,与未受感染的人群并无大的区别。

  12. Production of Antimicrobial Metabolites by Streptomyces lavendulocolor VHB-9 Isolated from Granite Mines

    Directory of Open Access Journals (Sweden)

    Hima Bindu B.S.S.N

    2017-06-01

    Full Text Available ABSTRACT The actinobacterial strain Streptomyces lavendulocolor VHB-9 was isolated from granite mine soil samples of Khammam district, Telangana state, India. The strain was identified based on detailed microorphological, cultural and phylogenetic analysis. Bioactive guided isolation of the secondary metabolites of the strain was carried out by growing the strain in optimized medium (0.5% lactose, 0.5% peptone, 0.05% K2HPO4, 0.2% CaCO3 with pH adjusted to 7.0. Separation and purification of the active fractions from the crude ethyl acetate extract was carried out by silica gel column chromatography and resulted in the isolation of two active fractions. Structural elucidation of the two (B2 and B3 active compounds was carried out by FT-IR, Mass and NMR spectroscopy and were identified as Bis (7-methyloctyl phthalate and (Z-3-aminoacrylic acid. The antimicrobial activity of the bioactive compounds produced by S. lavendulocolor VHB-9 was expressed in terms of minimum inhibitory concentration against opportunistic pathogenic bacteria and fungi. Both fractions exhibited good antimicrobial potential against the bacteria and fungi tested.

  13. A Survey of ABO, Rhesus (D) Antigen and Haemoglobin Genes ...

    African Journals Online (AJOL)

    Summary: A survey of ABO and Rhesus (Rh D) antigens and variants of haemoglobin genes (HbGen) in Oyo state was carried out. This longitudinal study involved the determination of ABO and Rh(D) antigens in 3241 and HbGen in 2622 male and female adults (aged 26-65years) respectively using standard methods.

  14. Distribution of abo, rhesus blood groups and haemoglobin ...

    African Journals Online (AJOL)

    Summary: The distribution of ABO, Rhesus blood groups and haemoglobin electrophoresis among 200 undergraduate students of Niger Delta University, Bayelsa State, Nigeria randomly selected were studied. Blood samples were collected by venepuncture from the antecubital vein. The blood sample were transferred into ...

  15. The Frequency and Clinical Significance of Structural Haemoglobin ...

    African Journals Online (AJOL)

    The Haemoglobin (Hb) genotypes of 1672 healthy blood donors at the university of Maiduguri Teaching hospital (UMTH) during the year 1999 were analysed. Hb AA, AS and SC were detected in 78.94%, 21% and 0.06% of the donor population respectively. There is the need for strict application of Hb electrophoresis on all ...

  16. Blood pressure variations in Subjects with different Haemoglobin ...

    African Journals Online (AJOL)

    Dr Olaleye Samuel

    variations in blood pressures as well as relating the blood pressures in different haemoglobin. (HB) genotypes to each other. Blood pressures in 20 steady and crisis states SCD patients respectively with 40 apparently healthy heterozygous HB AS and HB AA genotype (age and sex –matched). They were aged between 20 ...

  17. Lack of association of glycated haemoglobin with blood pressure ...

    African Journals Online (AJOL)

    2013-04-12

    Apr 12, 2013 ... Original Research: Lack of association of glycated haemoglobin with blood pressure and subclinical atherosclerosis. 148 ..... A-HP meds: anti-hypertensive medication, β: beta, DPB: diastolic blood pressure, GGT: gamma glutamyl transferase, HDL: high-density lipoprotein, M: men, PP: pulse pressure, SBP:.

  18. Glycosylated haemoglobin is markedly elevated in new and known ...

    African Journals Online (AJOL)

    There was a tendency to significantly positive correlation between blood glucose and HbA1c in new diabetes patients. Conclusions: In our setting, DKA is associated with markedly elevated HbA1c levels in known type 1, known type 2 and new onset diabetes. Key words: Glycosylated haemoglobin, ketoacidosis, Known and ...

  19. Association of foetal haemoglobin with pancreatic enzymes in sickle ...

    African Journals Online (AJOL)

    Background/Aim: There are conflicting reports on the potential protective effects of foetal haemoglobin (HbF) in the elimination of symptoms of Sickle cell disease in the patients and reports which correlate the levels of HbF with pancreatic enzymes in SCD are scarce in the literature.This study correlates the levels of HbF on ...

  20. Effect Of Acute Caprine Trypanosomiasis On Haemoglobin, Urea ...

    African Journals Online (AJOL)

    Haemoglobin concentation of the infected goats was only slightly decreased. However, the serum urea level was significantly increased (P <0.05) while Cl, K+ and HCO3 levels were slightly increased above pre-infection values by week two post infection (PI). Serum Na+ increased only in the first week PI but returned to ...

  1. Glycosylated haemoglobin is markedly elevated in new and known ...

    African Journals Online (AJOL)

    Background: Glycosylated haemoglobin (HbA1c) and random blood glucose are markers of chronic and acute hyperglycaemia respectively. Objective: We compared HbA1c levels in ketoacidosis (DKA) occurring in known and newly diagnosed diabetes. Methods: Retrospective review of medical records for 83 DKA ...

  2. Fasting blood glucose and glycosylated haemoglobin levels in ...

    African Journals Online (AJOL)

    This work involved the measurement of fasting blood glucose (FBG) and glycosylated haemoglobin (HbA1c) levels of diabetes mellitus patients as an index of glycaemic control. It was a prospective case-finding study using laboratory and general practice records. The subjects were confirmed diabetic patients, attending a ...

  3. Haemoglobin genotype of children with severe malaria seen at the ...

    African Journals Online (AJOL)

    Prof Ezechukwu

    2011-10-23

    Oct 23, 2011 ... Abstract: Introduction: Types of haemoglobin (Hb) genotype have been found to be crucial to the rate of red blood cell parasite invasion, multiplication, and destruction as well as outcome of malaria disease. In a bid to provide more informa- tion on the relationship between Hb genotype and level of ...

  4. Haemoglobins with multiple reactive sulfhydryl groups: reactions of ...

    African Journals Online (AJOL)

    Haemoglobins with multiple reactive sulfhydryl groups: reactions of 5 ... The intermediate phase, where it exists, is about 3-4 times faster than the slow phase. ... The pH dependence profile of kapp, the apparent second-order rate constant, ...

  5. Haemoglobins with multiple reactive sulfhydryl groups: reactions of ...

    African Journals Online (AJOL)

    2-nitrobenzoate) with CysF9[93] and CysH3[125] of guinea pig haemoglobin. ... which has a maximum of about 15% of the total signal amplitude, becomes negligible as it approaches pH 7, so that the kinetics eventually becomes biphasic.

  6. Dietary pattern, haemoglobin and haematocrit status of pregnant ...

    African Journals Online (AJOL)

    Background: Pregnancy is a normal physiologic process that increases a woman's vulnerability to nutritional problems particularly anaemia. This study examined the dietary pattern, haemoglobin and haematocrit status of pregnant women in Ogbaru Local Government Area (LGA) of Anambra State, Nigeria. Methods: Three ...

  7. Effect of Ramadan fasting on glucose, glycosylated haemoglobin ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-01-04

    Jan 4, 2010 ... along with some degrees of gluconeogenesis maintain serum glucose within normal limits. From the period be- fore the fasting to Ramadan period, the results showed a significant reduction (P > 0.05) of the rate of glycosylated haemoglobin (HbA1c) among diabetic patients treated with Biguanides. Several ...

  8. Prevalence Of Sickle Haemoglobin And Glucose–6–Phosphate ...

    African Journals Online (AJOL)

    Hereditary disorders of erythrocytes are common in many areas of the world, including Cameroon Limited knowledge on the consequences of high incidences of sickle haemoglobin (HbS) and glucose-6-phosphate dehydrogenase (G6PD) deficiency genes in the Cameroons might have been responsible for the ...

  9. Levels Of Haemoglobin And Packed Cell Volumes In Umbilical Cord ...

    African Journals Online (AJOL)

    Blood samples were taken from 121 umbilical cords at time of birth, and were analysed for haemoglobin concentration (Hb) and packed cell volume (PCV). The Hb concentration was determined by the indirect colorimetric method, and the PCV by the microhaematocrit centrifuge method. The mean values obtained were Hb ...

  10. The impact of haemoglobin level and concomitant infections on ...

    African Journals Online (AJOL)

    Haemoglobin level correlated significantly (p<0.05) and negatively with malaria intensity and had strong impact on the onset of paroxysm during Plasmodium infection. Likewise, the presence of concomitant infections in the clinically ill subjects quickened the on-set of clinical signs. The need for proper laboratory diagnosis ...

  11. 173 original article glycated haemoglobin levels in patients

    African Journals Online (AJOL)

    boaz

    effect on glycaemic changes in patients with MDR-TB. Keywords: Diabetes mellitus, Glycaemic change, Glycated haemoglobin, Multidrug resistant tuberculosis therapy. L'HÉMOGLOBINE GLYQUÉE CHEZ LES PATIENTS PRÉSENTANT UNE INFECTION À LA TUBERCULOSE. MULTIRÉSISTANTE AU COURS DES 6 ...

  12. A Comparison of Measured and Predicted Haemoglobin Genotype ...

    African Journals Online (AJOL)

    Cellulose acetate electrophoresis technique has been used to estimate haemoglobin genotype and the predicted values from the estimate in accordance with the population genetics studies (Fleming and Lehman 1982) were evaluated in 850 subjects (386 males and 464 females) selected randomly from Bonny, in Rivers ...

  13. Point-of-care estimation of haemoglobin concentration in neonates ...

    African Journals Online (AJOL)

    Objective. The HemoCue is a point-of-care analytical system for haemoglobin concentration (Hb) measurement. Point-of-care testing has been validated in hospitals and outpatient departments to assist with urgent patient management by providing rapid laboratory test results. Method. In this prospective study we compared ...

  14. Validation of the haemoglobin colour scale for screening blood ...

    African Journals Online (AJOL)

    In 2009 Malawi introduced a new protocol to screen potential blood donors for anaemia, using the WHO Haemoglobin Colour ... Colour Scale (HCS) compared to HemoCue, all were subjects that were wrongly accepted as donors when their ..... Performance of the Hae- moglobin Colour Scale in diagnosing severe and very ...

  15. Impact Of Polyparasitism On The Haemoglobin Values Of Primary ...

    African Journals Online (AJOL)

    Impact Of Polyparasitism On The Haemoglobin Values Of Primary School Children In Akpet Central Biasenigeria. ... The relationship between parasitic infections and development of anemia was investigated among pupils of Presbyterian primary school, and Government primary School Akpet Central in Biase Local ...

  16. Primary sequence of the beta-chain of Badger haemoglobin.

    Science.gov (United States)

    Hombrados, I; Ducastaing, S; Iron, A; Neuzil, E; Debuire, B; Han, K K

    1976-03-18

    Badger (Meles meles) haemoglobin was purified by paper electrophoresis and converted into globin. Chain separation was carried out on a CM-cellulose column in the presence of 8 M urea. The beta-chain was aminoethylated, purified by gel filtration and submitted to tryptic digestion. A fingerprint obtained with the enzymic digests showed 17 distinct ninhydrin-positive spots from which 20 pure peptides were isolated by further electrochromatographic separations. These peptides were sequenced using Dansyl-Edman and Ptc-Edman degradation techniques. The presence of amide residues was confirmed after aminopeptidase M hydrolysis. Taking human haemoglobin beta-chain as a model, the covalent structure could be completely resolved without the help of any further overlapping technique. The following substitutions were noted (badger/human, position): Ala/Pro5, Ser/Ala13, Tyr/Phe41, Asp/Glu43, Ser/Ala70, Glu/Asp73, Lys/Ala76, Asn/His77, Lys/Thr87, Lys/Arg104 and Gln/Pro125. A comparison with other haemoglobin beta-chains already sequenced shows a greater similarity with dog haemoglobin, the only example of beta-chain of known structure in the order of Carnivores.

  17. Two novel haemoglobin variants that affect haemoglobin A1c measurement by ion-exchange chromatography.

    Science.gov (United States)

    Bots, Michael; Stroobants, An K; Delzenne, Barend; Soeters, Maarten R; de Vries, Johan E; Weykamp, Cas W; Norg, Roelf J C; Veldthuis, Martijn; Zwieten, Rob van

    2015-08-01

    Haemoglobin (Hb) variants are well-known factors interfering with accurate HbA1c testing. This report describes two novel Hb variants leading to inappropriate quantification of HbA1c by ion-exchange chromatography. Glycated forms of novel Hb variants were recognised in the blood of two patients with diabetes mellitus screened by HbA1c ion-exchange chromatography. Dedicated high-resolution cation-exchange chromatography and subsequent DNA sequencing revealed the exact nature of the variants. Other common techniques for quantifying HbA1c were applied on both samples and haematological parameters were determined to judge possible pathology associated with the novel Hb variants. A fraction of 15% of abnormal Hb was observed in a 37-year-old female. DNA sequencing revealed a heterozygous mutation in the α1-globin gene, resulting in a leucine-to-phenylalanine amino-acid substitution (HBA1: c.301C>T, p.Leu101Phe). We named this variant Hb Weesp. The other novel variant, Hb Haelen, presented as a 40% fraction in a 63-year-old male and resulted from a heterozygous amino acid substitution in the β-globin gene (HBB: c.335T>C, p.Val112Gly). The presence of both Hb variants resulted in aberrant separation of the Hb components, leading to an inadequate quantification of HbA1c. Close examination of HbA1c chromatograms revealed two novel, clinically silent Hb variants that interfere with HbA1c quantification. Healthcare providers need to be aware of the potential of such Hb variants when interpreting HbA1c results.

  18. A Cross-Reactive Monoclonal Antibody to Nematode Haemoglobin Enhances Protective Immune Responses to Nippostrongylus brasiliensis

    Science.gov (United States)

    Nieuwenhuizen, Natalie E.; Meter, Jeanne M.; Horsnell, William G.; Hoving, J. Claire; Fick, Lizette; Sharp, Michael F.; Darby, Matthew G.; Parihar, Suraj P.; Brombacher, Frank; Lopata, Andreas L.

    2013-01-01

    Background Nematode secreted haemoglobins have unusually high affinity for oxygen and possess nitric oxide deoxygenase, and catalase activity thought to be important in protection against host immune responses to infection. In this study, we generated a monoclonal antibody (48Eg) against haemoglobin of the nematode Anisakis pegreffii, and aimed to characterize cross-reactivity of 4E8g against haemoglobins of different nematodes and its potential to mediate protective immunity against a murine hookworm infection. Methodology/Principal Findings Immunoprecipitation was used to isolate the 4E8g-binding antigen in Anisakis and Ascaris extracts, which were identified as haemoglobins by peptide mass fingerprinting and MS/MS. Immunological cross-reactivity was also demonstrated with haemoglobin of the rodent hookworm N. brasiliensis. Immunogenicity of nematode haemoglobin in mice and humans was tested by immunoblotting. Anisakis haemoglobin was recognized by IgG and IgE antibodies of Anisakis-infected mice, while Ascaris haemoglobin was recognized by IgG but not IgE antibodies in mouse and human sera. Sequencing of Anisakis haemoglobin revealed high similarity to haemoglobin of a related marine nematode, Psuedoterranova decipiens, which lacks the four –HKEE repeats of Ascaris haemoglobin important in octamer assembly. The localization of haemoglobin in the different parasites was examined by immunohistochemistry and associated with the excretory-secretary ducts in Anisakis, Ascaris and N. brasiliensis. Anisakis haemoglobin was strongly expressed in the L3 stage, unlike Ascaris haemoglobin, which is reportedly mainly expressed in adult worms. Passive immunization of mice with 4E8g prior to infection with N. brasiliensis enhanced protective Th2 immunity and led to a significant decrease in worm burdens. Conclusion The monoclonal antibody 4E8g targets haemoglobin in broadly equivalent anatomical locations in parasitic nematodes and enhances host immunity to a hookworm

  19. Characterization of blood donors with high haemoglobin concentration

    DEFF Research Database (Denmark)

    Magnussen, K; Hasselbalch, H C; Ullum, H

    2013-01-01

    Background and Objectives  The literature contains little on the prevalence and causes of high predonation haemoglobin levels among blood donors. This study aimed to characterize and develop an algorithm to manage would-be donors with polycythaemia. Materials and Methods  Between November 2009...... and November 2011, we offered haematology consultations to blood donors with repeated haemoglobin concentration (Hb) above the WHO limit for polycythaemia vera (PV) (10·2 and 11·5 mm/16·5 and 18·5 g/dl for women and men, respectively). Investigation of such donors included Hb, haematocrit, mean cell volume......, erythropoietin, ferritin, platelet count and leucocyte count, JAK2 V617 and JAK2 exon12 analysis, as well as other routine measurements. Results  Among 46 such donors, 39 had a history of smoking, which contributes to erythrocytosis. Two had PV, five had severe hypertension, one of them because of renal artery...

  20. Higher vs. lower haemoglobin threshold for transfusion in septic shock

    DEFF Research Database (Denmark)

    Rygård, S L; Holst, L B; Wetterslev, J

    2017-01-01

    BACKGROUND: Using a restrictive transfusion strategy appears to be safe in sepsis, but there may be subgroups of patients who benefit from transfusion at a higher haemoglobin level. We explored if subgroups of patients with septic shock and anaemia had better outcome when transfused at a higher vs....... a lower haemoglobin threshold. METHODS: In post-hoc analyses of the full trial population of 998 patients from the Transfusion Requirements in Septic Shock (TRISS) trial, we investigated the intervention effect on 90-day mortality in patients with severe comorbidity (chronic lung disease, haematological...... malignancy or metastatic cancer), in patients who had undergone surgery (elective or acute) and in patients with septic shock as defined by the new consensus definition: lactate above 2 mmol/l and the need for vasopressors to maintain a mean arterial pressure above 65 mmHg. RESULTS: The baseline...

  1. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  2. The effects of maternal haemoglobin as an indicator of maternal ...

    African Journals Online (AJOL)

    EB

    mean maternal Hb was 11.01 ± 1.00 (95% CI, 10.85 – 11.17) g/dl . A positive significant .... Table 2: Correlation of maternal haemoglobin and maternal measles antibodies of mother-infant pairs. Maternal. Mothers MMA. Newborns MMA. Hb (g/dl). (U/ml). (U/ml). Maternal Hb ... 147.000. 0.480 0.010. Roy's Largest Root 0.010.

  3. A comparison of Glycosylated Haemoglobin (GHL) in Obesity and ...

    African Journals Online (AJOL)

    A comparison of Glycosylated Haemoglobin (GHL) in Obesity and Diabetes Mellitus in Enugu Metropolis. ... International Journal of Medicine and Health Development ... Results: In obese subjects, the following results were obtained GHb 55.40±3.9 mm0l/L fructose, FBG 6.3±1.07 mmol/L, PCV 0.38±0.03 L/L while in ...

  4. SERUM MAGNESIUM, LIPID PROFILE AND GLYCATED HAEMOGLOBIN IN DIABETIC RETINOPATHY

    Directory of Open Access Journals (Sweden)

    Sunanda Vusikala

    2016-07-01

    Full Text Available BACKGROUND Diabetic retinopathy is one of the important microvascular complications of diabetes mellitus of long duration. Alterations in trace metals like magnesium and lipid profile was observed in diabetic retinopathy with hyperglycaemic status. AIM The study was taken up to assess the role of magnesium, lipid profile and glycated haemoglobin in diabetic retinopathy. MATERIALS AND METHODS A total of 80 subjects between 40-65 years were included in the study. Group 1 includes 20 age and sex matched healthy controls. Group 2 includes 30 cases of Diabetes mellitus without retinopathy. Group 3 includes 30 cases of Diabetes mellitus with retinopathy. RESULTS Magnesium was found to be significantly low in the diabetic group with retinopathy. Serum cholesterol and triglycerides were significantly elevated in the diabetic group with retinopathy. Fasting and Postprandial plasma glucose and glycated haemoglobin (HbA1c levels confirmed the glycaemic status of each of the groups. CONCLUSIONS Hypomagnesemia, hypercholesterolaemia, hypertriglyceridemia was observed in diabetic retinopathy along with increased levels of glycated haemoglobin in our study.

  5. Characterization of the extracellular haemoglobin of Haemopsis sanguisuga (L.).

    Science.gov (United States)

    Wood, E J; Mosby, L J; Robinson, M S

    1976-01-01

    The haemoglobin from the blood of the horseleech, Haemopsis sanguisuga (L.), had a sedimentation coefficient, SO20, w, of 59.11 +/- 0.55 S, and a molecular weight as determined by sedimentation equilibrium of 3.71 X 10(6)+/-9904 X 10(6). In the electron microscope the molecule appeared to be made up of two hexagonal plates, as is found with other worm haemoglobins, with dimensions 24.4+/-2.0 nm (across the hexagon) and 15.2+/-1.4 nm (height). The amino acid composition and spectrum were closely similar to those of the haemoglobins of other annelids (e.g. Lumbricus). The alpha-helical content, calculated from circular-dichroism measurements in the far-u.v. region, was 56-63%. The haem content was 2.49%, corresponding to a minimum molecular weight per haem group of 24 800, but detergent-gel electrophoresis indicated the presence of polypeptide chains of mol.wts. 12 600, 14 800, 15 500 and 25 100. The pH-induced dissociation of the native molecule yielded compotosol of Soya-bean root nodules. Images PLATE 1 PMID:942373

  6. Heterologous expression of VHb can improve the yield and quality of biocontrol fungus Paecilomyces lilacinus, during submerged fermentation.

    Science.gov (United States)

    Zhang, Shumeng; Wang, Jieping; Wei, Yale; Tang, Qing; Ali, Maria Kanwal; He, Jin

    2014-10-10

    Paecilomyces lilacinus is an egg-parasitic fungus which is effective against plant-parasitic nematodes and it has been successfully commercialized for the control of many plant-parasitic nematodes. However, during the large-scale industrial fermentation process of the filamentous fungus, the dissolved oxygen supply is a limiting factor, which influences yield, product quality and production cost. To solve this problem, we intended to heterologously express VHb in P. lilacinus ACSS. After optimizing the vgb gene, we fused it with a selection marker gene nptII, a promoter PgpdA and a terminator TtrpC. The complete expression cassette PgpdA-nptII-vgb-TtrpC was transferred into P. lilacinus ACSS by Agrobacterium tumefaciens-mediated transformation. Consequently, we successfully screened an applicable fungus strain PNVT8 which efficiently expressed VHb. The submerged fermentation experiments demonstrated that the expression of VHb not only increased the production traits of P. lilacinus such as biomass and spore production, but also improved the beneficial product quality and application value, due to the secretion of more protease and chitinase. It can be speculated that the recombinant strain harboring vgb gene will have a growth advantage over the original strain under anaerobic conditions in soil and therefore will possess higher biocontrol efficiency against plant-parasitic nematodes. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Low-grade inflammation is associated with lower haemoglobin levels in healthy individuals

    DEFF Research Database (Denmark)

    Kotzé, S. R.; Pedersen, O. B.; Petersen, M. S.

    2016-01-01

    Background and Objectives: Chronic inflammation can lead to anaemia of chronic disease due to the sequestration of iron caused by inflammatory cytokines and the protein hepcidin. However, the effect of low-grade inflammation (LGI) on haemoglobin among healthy individuals is not known. This study...... examines the effect of LGI on haemoglobin among Danish blood donors. Materials and Methods: We performed multivariable linear regression to assess the effect of LGI (i.e. high-sensitivity C-reactive protein above 3 mg/l but below 10 mg/l) on haemoglobin in 17 322 Danish blood donors. We also performed......% CI: 0·06–0·18). Conclusion: In this first study of LGI and haemoglobin in healthy individuals, there was a negative association between LGI and haemoglobin in non-smokers. The association was positive in smokers, probably because smoking leads to both increased inflammation and increased haemoglobin...

  8. Is VHB-JOURQUAL2 a Good Measure of Scientific Quality? Assessing the Validity of the Major Business Journal Ranking in German-Speaking Countries

    Directory of Open Access Journals (Sweden)

    Martin Eisend

    2011-12-01

    Full Text Available This study examines the question of whether the journal ranking VHB-JOURQUAL 2 can be considered as a good measure for the construct “scientific quality”. Various rankings in business research provide the database for the analysis. The correlations between theses rankings are used to assess the validity of VHB-JOURQUAL 2 along various validity criteria. The correlations with rankings that measure the same construct based on different methods show that VHB-JOURQUAL 2 has acceptable, but moderate convergent validity. The validity varies considerably across disciplines, showing that the heterogeneity of business administration is not sufficiently represented by this overall ranking. The variability is related to the variation in members per discipline represented by the German Association for Business Research. Furthermore, the measure shows a weak correlation with acceptance rates as an indicator of nomological validity in some disciplines.

  9. Crystal structure of haemoglobin from donkey (Equus asinus) at 3A resolution.

    Science.gov (United States)

    Balasundaresan, D; Saraboji, K; Ponnuswamy, M N

    2006-06-01

    Haemoglobin from donkey was purified and crystallized in space group C2. The present donkey haemoglobin model comprises of two subunits alpha and beta. These alpha and beta subunits comprise of 141 and 146 amino acid residues, respectively, and the haem groups. The donkey haemoglobin differs from horse only in two amino acids of alpha-chain (His20 to Asn and Tyr24 to Phe) and these substitutions do not significantly change the secondary structural features of donkey haemoglobin. The haem group region and subunit contacts are closely resemble with that of horse methaemoglobin.

  10. Seasonal changes in cell mediated immune responses to soluble Plasmodium falciparum antigens in children with haemoglobin AA and haemoglobin AS

    DEFF Research Database (Denmark)

    Abu-Zeid, Y A; Abdulhadi, N H; Theander, T G

    1992-01-01

    In this longitudinal study peripheral blood mononuclear cells (PBMC) were obtained before and during the malaria season from healthy HbAA and HbAS children. Cells were compared for proliferation in response to stimulation by soluble Plasmodium falciparum antigens (SPAg) or purified derivative...... of tuberculin (PPD). The lymphoproliferative responses to SPAg of the paired PBMC samples showed 2 distinct seasonal changes in relation to the haemoglobin phenotype. In HbAA children, the lymphoproliferative responses to SPAg were suppressed during the malaria season. In contrast, they were enhanced in Hb...

  11. VHB-JOURQUAL2: Method, Results, and Implications of the German Academic Association for Business Research's Journal Ranking

    Directory of Open Access Journals (Sweden)

    Ulf Schrader

    2009-12-01

    Full Text Available VHB-JOURQUAL represents the official journal ranking of the German Academic Association for Business Research. Since its introduction in 2003, the ranking has become the most influential journal evaluation approach in German-speaking countries, impacting several key managerial decisions of German, Austrian, and Swiss business schools. This article reports the methodological approach of the ranking’s second edition. It also presents the main results and additional analyses on the validity of the rating and the underlying decision processes of the respondents. Selected implications for researchers and higher-education institutions are discussed.

  12. The structure of α-haemoglobin in complex with a haemoglobin-binding domain from Staphylococcus aureus reveals the elusive α-haemoglobin dimerization interface.

    Science.gov (United States)

    Kumar, Kaavya Krishna; Jacques, David A; Guss, J Mitchell; Gell, David A

    2014-08-01

    Adult haemoglobin (Hb) is made up of two α and two β subunits. Mutations that reduce expression of the α- or β-globin genes lead to the conditions α- or β-thalassaemia, respectively. Whilst both conditions are characterized by anaemia of variable severity, other details of their pathophysiology are different, in part owing to the greater stability of the β chains that is conferred through β self-association. In contrast, α subunits interact weakly, and in the absence of stabilizing quaternary interactions the α chain (α) is prone to haem loss and denaturation. The molecular contacts that confer weak self-association of α have not been determined previously. Here, the first structure of an α2 homodimer is reported in complex with one domain of the Hb receptor from Staphylococcus aureus. The α2 dimer interface has a highly unusual, approximately linear, arrangement of four His side chains within hydrogen-bonding distance of each other. Some interactions present in the α1β1 dimer interface of native Hb are preserved in the α2 dimer. However, a marked asymmetry is observed in the α2 interface, suggesting that steric factors limit the number of stabilizing interactions that can form simultaneously across the interface.

  13. Potential Probiotic Escherichia coli 16 Harboring the Vitreoscilla Hemoglobin Gene Improves Gastrointestinal Tract Colonization and Ameliorates Carbon Tetrachloride Induced Hepatotoxicity in Rats

    Directory of Open Access Journals (Sweden)

    Prasant Kumar

    2014-01-01

    Full Text Available The present study describes the beneficial effects of potential probiotic E. coli 16 (pUC8:16gfp expressing Vitreoscilla hemoglobin (vgb gene, associated with bacterial respiration under microaerobic condition, on gastrointestinal (GI colonization and its antioxidant activity on carbon tetrachloride (CCl4 induced toxicity in Charles Foster rats. In vitro, catalase activity in E. coli 16 (pUC8:16gfp was 1.8 times higher compared to E. coli 16 (pUC-gfp control. In vivo, E. coli 16 (pUC8:16gfp not only was recovered in the fecal matter after 70 days of oral administration but also retained antibacterial activities, whereas E. coli 16 (pUC-gfp was not detected. Oral administration of 200 and 500 μL/kg body weight of CCl4 to rats at weekly interval resulted in elevated serum glutamyl pyruvate transaminase (SGPT and serum glutamyl oxalacetate transaminase (SGOT levels compared to controls. Rats prefed with E. coli 16 (pUC8:16gfp demonstrated near to normal levels for SGPT and SGOT, whereas the liver homogenate catalase activity was significantly increased compared to CCl4 treated rats. Thus, pUC8:16gfp plasmid encoding vgb improved the growth and GI tract colonization of E. coli 16. In addition, it also enhanced catalase activity in rats harboring E. coli 16 (pUC8:16gfp, thereby preventing the absorption of CCl4 to GI tract.

  14. IMPACT OF HAEMOGLOBIN LEVELS ON OUTCOMES IN ACUTE CORONARY SYNDROME

    Directory of Open Access Journals (Sweden)

    Shrirang Kishor Bhurchandi

    2017-07-01

    Full Text Available BACKGROUND It is observed that anaemia is a common problem in patients hospitalised for acute coronary syndromes. There have been reports in worldwide studies of an association between anaemia and poor prognosis in patients with Acute Coronary Syndromes (ACS. MATERIALS AND METHODS All consecutive patients having ST-elevation myocardial infarction, non-ST elevation myocardial infarction and unstable angina who were admitted in medicine ward, Medicine Intensive Care Unit (MICU, Cardiology Department (CRD, Cardiovascular and Thoracic Surgery (CVTS Department and incidentally found in other departments of Acharya Vinoba Bhave Rural Hospital admitted from 1st November 2014 to 31st December 2015 at AVBRH. Total 200 patients were included in the study. RESULTS Our study showed an association between haemoglobin levels and mean age (p=0.0001, gender (p=0.0001, risk factors like smoking (p=0.035, tobacco (p=0.001 and Killip’s class I (p=0.0001, III (p=0.0001 and IV (p=0.0001. On distribution of the MACE’s during hospital stay stratified with Hb levels, the results of analysis by Chi-square test showed that there were statistically significant differences at various haemoglobin levels in MACE’s as post-infarction angina, heart failure, VT/VF and death (p<0.05 for all. On distribution of the MACE’s during follow up on 30th day and on 180th day stratified with Hb levels, the results of analysis by Chi-square test showed that there were statistically significant differences at various haemoglobin levels in MACE’s as post-infarction angina, re-infarction, heart failure, VT/VF and death (p<0.05 for all. CONCLUSION To conclude our study results, it was found during the study that anaemia as an important risk factor was strongly associated with major adverse outcomes in patients with ACS. Our study suggested that there was a statistically significant correlation between the low Hb levels and MACE’s (post-infarction angina, re-infarction, heart

  15. Differences in iron acquisition from human haemoglobin among strains of Actinobacillus actinomycetemcomitans

    DEFF Research Database (Denmark)

    Hayashida, H.; Poulsen, Knud; Kilian, Mogens

    2002-01-01

    a functional hgpA gene which, according to insertion mutagenesis experiments, was responsible for the ability of these strains to utilize haemoglobin as a source of iron. Thus, the presence of an hgpA pseudogene and the inability to use human haemoglobin as an iron source discriminate the high-toxic JP2 clone...

  16. Non-symbiotic haemoglobins-What's happening beyond nitric oxide scavenging?

    Science.gov (United States)

    Hill, Robert D

    2012-01-01

    Non-symbiotic haemoglobins have been an active research topic for over 30 years, during which time a considerable portfolio of knowledge has accumulated relative to their chemical and molecular properties, and their presence and mode of induction in plants. While progress has been made towards understanding their physiological role, there remain a number of unanswered questions with respect to their biological function. This review attempts to update recent progress in this area and to introduce a hypothesis as to how non-symbiotic haemoglobins might participate in regulating hormone signal transduction. Advances have been made towards understanding the structural nuances that explain some of the differences in ligand association characteristics of class 1 and class 2 non-symbiotic haemoglobins. Non-symbiotic haemoglobins have been found to function in seed development and germination, flowering, root development and differentiation, abiotic stress responses, pathogen invasion and symbiotic bacterial associations. Microarray analyses under various stress conditions yield uneven results relative to non-symbiotic haemoglobin expression. Increasing evidence of the role of nitric oxide (NO) in hormone responses and the known involvement of non-symbiotic haemoglobins in scavenging NO provide opportunities for fruitful research, particularly at the cellular level. Circumstantial evidence suggests that non-symbiotic haemoglobins may have a critical function in the signal transduction pathways of auxin, ethylene, jasmonic acid, salicylic acid, cytokinin and abscisic acid. There is a strong need for research on haemoglobin gene expression at the cellular level relative to hormone signal transduction.

  17. Ethylene, nitric oxide and haemoglobins in plant tolerance to flooding

    DEFF Research Database (Denmark)

    Mur, Luis A J; Gupta, Kapuganti J; Chakraborty, U

    2015-01-01

    As much as 12% of the world's soils may suffer excess water so that flooding is a major limiting factor on crop production in many areas. Plants attempt to deal with submergence by forming root aerenchyma to facilitate oxygen diffusion from the shoot to the root, initiating a hyponastic response......-tolerant species Rumex palustris and the model plant Arabidopsis thaliana have been extensively exploited to reveal some key molecular events. Our groups have recently demonstrated that nitric oxide (NO) triggers the biosynthesis of ethylene during stress and that NO plays key roles in PCD and the hyponastic....... This chapter will detail our understanding of the roles of ethylene, NO and haemoglobin in flooding stress....

  18. Net haemoglobin increase from reinfusion of refrigerated vs. frozen red blood cells after autologous blood transfusions

    DEFF Research Database (Denmark)

    Ashenden, M; Mørkeberg, Jakob Sehested

    2011-01-01

    BACKGROUND AND OBJECTIVES  Two main blood storage procedures can be used for storing red blood cells: refrigeration and freezing. Nevertheless, the efficiency of these procedures measured as the increase in haemoglobin after reinfusion compared with baseline has never been examined. The main...... objective was to examine which storage procedure yielded the largest increase in circulating haemoglobin after reinfusion compared to baseline. MATERIALS AND METHODS  Equal volumes of blood from 15 men were withdrawn and stored either frozen or refrigerated as packed red blood cells. Serial measures...... freezing. Nevertheless, frozen storage allowed haemoglobin to fully recover before reinfusion, while the haemoglobin was 10% lower in the refrigerated group compared with baseline. After reinfusion, the haemoglobin levels were 11·5% higher than the baseline values in the group reinfused with frozen blood...

  19. The impact of prematurity on fetal haemoglobin and how it can bias measurement of glycated haemoglobin

    DEFF Research Database (Denmark)

    Zachariassen, Gitte; Esberg, Gitte; Grytter, Carl

    Background: The extent to which fetal hemoglobin (HbF) concentrations are increased in premature infants at the age of six to eight months is only sporadically described. The influence of HbF on measurement of glycated haemoglobin (HbA1c) has not been investigated in this population. Methods......: As part of a nutritional study on premature children, HbF and HbA1c were measured in 46 premature infants at the age of six to eight months. Results: Median HbF percentage was 10.3% (range 2.0 to 39.2%). In a multiple regression model only birth weight (P = 0.002) and post-conceptional age (P ... significantly from unadjusted values (4.4±0.4%), (P premature infants at six to eight months of age. The clinical implication of this work is a renewed attention on the prolonged Hb...

  20. Pseudomonas fluorescens ATCC 13525 containing an artificial oxalate operon and Vitreoscilla hemoglobin secretes oxalic acid and solubilizes rock phosphate in acidic alfisols.

    Directory of Open Access Journals (Sweden)

    Kavita Yadav

    Full Text Available Oxalate secretion was achieved in Pseudomonas fluorescens ATCC 13525 by incorporation of genes encoding Aspergillus niger oxaloacetate acetyl hydrolase (oah, Fomitopsis plaustris oxalate transporter (FpOAR and Vitreoscilla hemoglobin (vgb in various combinations. Pf (pKCN2 transformant containing oah alone accumulated 19 mM oxalic acid intracellularly but secreted 1.2 mM. However, in the presence of an artificial oxalate operon containing oah and FpOAR genes in plasmid pKCN4, Pf (pKCN4 secreted 13.6 mM oxalate in the medium while 3.6 mM remained inside. This transformant solubilized 509 μM of phosphorus from rock phosphate in alfisol which is 4.5 fold higher than the Pf (pKCN2 transformant. Genomic integrants of P. fluorescens (Pf int1 and Pf int2 containing artificial oxalate operon (plac-FpOAR-oah and artificial oxalate gene cluster (plac-FpOAR-oah, vgb, egfp secreted 4.8 mM and 5.4 mM oxalic acid, released 329 μM and 351 μM P, respectively, in alfisol. The integrants showed enhanced root colonization, improved growth and increased P content of Vigna radiata plants. This study demonstrates oxalic acid secretion in P. fluorescens by incorporation of an artificial operon constituted of genes for oxalate synthesis and transport, which imparts mineral phosphate solubilizing ability to the organism leading to enhanced growth and P content of V. radiata in alfisol soil.

  1. Identification of a rare variant haemoglobin (Hb Sinai-Baltimore) causing spuriously low haemoglobin A(1c) values on ion exchange chromatography.

    Science.gov (United States)

    Smith, Geoff; Murray, Heather; Brennan, Stephen O

    2013-01-01

    Commonly used methods for assay of haemoglobin A(1c) (HbA(1c)) are susceptible to interference from the presence of haemoglobin variants. In many systems, the common variants can be identified but scientists and pathologists must remain vigilant for more subtle variants that may result in spuriously high or low HbA(1c) values. It is clearly important to recognize these events whether HbA(1c) is being used as a monitoring tool or, as is increasingly the case, for diagnostic purposes. We report a patient with a rare haemoglobin variant (Hb Sinai-Baltimore) that resulted in spuriously low values of HbA(1c) when assayed using ion exchange chromatography, and the steps taken to elucidate the nature of the variant.

  2. Haemoglobin concentrations appear to be lower in indigenous Greenlanders than in Danes

    DEFF Research Database (Denmark)

    Milman, N; Byg, K E; Mulvad, G

    2001-01-01

    's correlation coefficient (rs). RESULTS: Greenlanders: Haemoglobin levels were not correlated with age or consumption of traditional foods, and were not significantly different in the three residential areas. Mean haemoglobin was higher in men, 146+/-9.6 (SD) g/L, than in women, 132+/-9.6 g/L (p... haemoglobin in iron-replete men with serum ferritin >32 microg/L (n=104) was 146+/-9.3 g/L, and in iron-replete women (n=68) 133+/-10.4 g/L (pwomen 118 g/L (7.3 mmol/L). The prevalence of iron deficiency anaemia...... (i.e. ferritin women) was 0% in men, 2.78% in women women >50 yr of age. Danes: Mean haemoglobin in men was 154+/-10.0 g/L and in women 138+/-10.4 g/L (p

  3. Use of benzidine for histological demonstration of haemoglobin in human bite marks.

    Science.gov (United States)

    Allison, R T; Whittaker, D K

    1990-07-01

    Macroscopic evidence of bruising from human bite marks may be inconclusive and routine histochemical methods of showing extravasated erythrocytes can be unreliable. Leuco patent blue staining, for the presence of peroxidase, Amido black B, a tinctorial staining method for haemoglobin, Perls's reaction for ferric iron (haemosiderin), Masson-Fontana for melanin, Masson's trichrome, a connective tissue strain, and the benzidine reaction for haemoglobin peroxidase were carried out in three forensic cases and one experimental case. A modified benzidine method was the most reliable indicator of haemoglobin activity, especially where dispersion into extra-cellular tissues had occurred. The resilience of the erythrocyte peroxidase enzyme to temperature changes and fixation supports the concept of a "pseudo-peroxidase" in those cells. It is concluded that free haemoglobin from bite marks, or indeed other forms of blunt trauma, may best be shown by the benzidine reaction and that exemption certificates for use of this prohibited substance may be worth pursuing.

  4. Raman and SERS recognition of β-carotene and haemoglobin fingerprints in human whole blood

    Science.gov (United States)

    Casella, Michele; Lucotti, Andrea; Tommasini, Matteo; Bedoni, Marzia; Forvi, Elena; Gramatica, Furio; Zerbi, Giuseppe

    2011-09-01

    The present work reports on Raman and Surface Enhanced Raman Scattering (SERS) vibrational fingerprints of β-carotene and haemoglobin in fresh whole blood (i.e. right after blood test) with different laser excitations, i.e. visible (514 nm) and near-infrared (NIR, 785 nm). The use of colloidal silver nanoparticles significantly increases the Raman signal, thus providing a clear SERS spectrum of blood. The collected spectra have been examined and marker bands of β-carotene and of the haem prosthetic group of haemoglobin have been found. In particular, the fundamental features of β-carotene (514 nm excitation), blood proteins and haem molecules (785 nm excitation) were recognized and assigned. Moreover haemoglobin SERS signals can be identified and related with its oxygenation state (oxy-haemoglobin). The data reported show the prospects of Raman and SERS techniques to detect important bio-molecules in a whole blood sample with no pre-treatment.

  5. Haemoglobin S and haemoglobin C: 'quick but costly' versus 'slow but gratis' genetic adaptations to Plasmodium falciparum malaria.

    Science.gov (United States)

    Modiano, David; Bancone, Germana; Ciminelli, Bianca Maria; Pompei, Fiorenza; Blot, Isa; Simporé, Jacques; Modiano, Guido

    2008-03-15

    Haemoglobin S (HbS; beta6Glu-->Val) and HbC (beta6Glu-->Lys) strongly protect against clinical Plasmodium falciparum malaria. HbS, which is lethal in homozygosity, has a multi-foci origin and a widespread geographic distribution in sub-Saharan Africa and Asia whereas HbC, which has no obvious CC segregational load, occurs only in a small area of central West-Africa. To address this apparent paradox, we adopted two partially independent haplotypic approaches in the Mossi population of Burkina Faso where both the local S (S(Benin)) and the C alleles are common (0.05 and 0.13). Here we show that: both C and S(Benin) are monophyletic; C has accumulated a 4-fold higher recombinational and DNA slippage haplotypic variability than the S(Benin) allele (P = 0.003) implying higher antiquity; for a long initial lag period, the C alleles did apparently remain very few. These results, consistent with epidemiological evidences, imply that the C allele has been accumulated mainly through a recessive rather than a semidominant mechanism of selection. This evidence explains the apparent paradox of the uni-epicentric geographic distribution of HbC, representing a 'slow but gratis' genetic adaptation to malaria through a transient polymorphism, compared to the polycentric 'quick but costly' adaptation through balanced polymorphism of HbS.

  6. Spectrophotometric analysis of haemoglobins of some digenetic trematodes and their hosts.

    Science.gov (United States)

    Haider, S A; Siddiqi, A H

    1976-12-01

    The haemoglobins of six different species of trematodes: Gastrothylax crumenifer, Srivastavaia indica, Gigantocotyle explanatum, Fasciolopsis buski, Gastrodiscoides hominis, Isoparorchis hypselobagri and their three different hosts: Bubalus bubalis, Sus scrofa, and Wallago attu were spectrophotometrically investigated, and were found to contain porphyrin IX as the common prosthetic group. Oxyhaemoglobin, carbonmonoxy-haemoglobin and reduced haemoglobin of all 6 species of trematodes and their 3 hosts under study gave similar absorption maxima. Distinct differences were, however, observed in the nature of the spectral curves of cyanmethaemoglobin which exhibit 2 absorption maxima in the beta and the alpha region in the case of all trematodes whereas in the case of similar host haemoglobin derivatives only one single broad peak in the 536-540 nm region was obtained. With respect to pyridine derivatives all the trematode haemoglobins show a sharp peak in the alpha region and a minor hump in the beta region except Gastrothylax crumenifer. All three host pyridine haemoglobin derivatives show only a single broad peak at 570 nm.

  7. Evaluation of haemoglobin in blister fluid as an indicator of paediatric burn wound depth.

    Science.gov (United States)

    Tanzer, Catherine; Sampson, Dayle L; Broadbent, James A; Cuttle, Leila; Kempf, Margit; Kimble, Roy M; Upton, Zee; Parker, Tony J

    2015-08-01

    The early and accurate assessment of burns is essential to inform patient treatment regimens; however, this first critical step in clinical practice remains a challenge for specialist burns clinicians worldwide. In this regard, protein biomarkers are a potential adjunct diagnostic tool to assist experienced clinical judgement. Free circulating haemoglobin has previously shown some promise as an indicator of burn depth in a murine animal model. Using blister fluid collected from paediatric burn patients, haemoglobin abundance was measured using semi-quantitative Western blot and immunoassays. Although a trend was observed in which haemoglobin abundance increased with burn wound severity, several patient samples deviated significantly from this trend. Further, it was found that haemoglobin concentration decreased significantly when whole cells, cell debris and fibrinous matrix was removed from the blister fluid by centrifugation; although the relationship to depth was still present. Statistical analyses showed that haemoglobin abundance in the fluid was more strongly related to the time between injury and sample collection and the time taken for spontaneous re-epithelialisation. We hypothesise that prolonged exposure to the blister fluid microenvironment may result in an increased haemoglobin abundance due to erythrocyte lysis, and delayed wound healing. Copyright © 2015 Elsevier Ltd and ISBI. All rights reserved.

  8. [Dual antiplatelet therapy and haemoglobin level: An observational study].

    Science.gov (United States)

    Quinteiro-Alonso, M P; González-Cao, M; Barreales-Cardín, C; Díaz-Grávalos, G J

    2016-01-01

    To determine the degree of association between dual antiplatelet therapy (DAPT) (clopidogrel plus acetylsalicylic acid) and haemoglobin (Hb) in clinical practice. A retrospective longitudinal analysis was conducted on all patients on DAPT for at least 6 months. The required sample size was 63 patients. Hb value was determined before DAPT and at least 6 months after, as well as length of treatment, drugs, and diseases that might reduce the Hb. Changes in Hb after DAPT and the emergence or worsening of pre-existing anaemia was determined. Before and after Hb was compared using the t-test for paired samples. The occurrence of anaemia was considered dependent variable in a logistic regression analysis. A total of 122 cases were included. There were 92 (75.4%) males, and the mean age was 74.5 (SD 9.9) years. DAPT duration was 19.3 (11.8) months. The pre-treatment Hb was 14.3 (1.4) g/dl and 12.8 (1.9) g/dl post-treatment. The prevalence of pre-DAPT anaemia was 9.1% (11 cases), and 45.9% post-treatment (56 cases). Comparison of means showed a decrease of 1.5g/dl (1.6) (95% CI; 1.2-1.8, P<.001). Anaemia post-treatment was associated with concomitant causes of anaemia, bleeding in the follow-up, and inversely with pre-treatment Hb level. DAPT is associated with a decrease in Hb. Anaemia or worsening of previous anaemia appeared in about half of the subjects, and this effect was most likely in patients with bleeding in the follow-up and if other causes of anaemia were present. Copyright © 2014 Sociedad Española de Médicos de Atención Primaria (SEMERGEN). Publicado por Elsevier España, S.L.U. All rights reserved.

  9. HAEMOGLOBIN PHENOVARIANTS VS RESILIENCE STATUS, HAEMATOLOGICAL, BIOCHEMICAL AND MINERAL PROFILE IN GAROLE SHEEP NATURALLY INFECTED WITH HAEMONCHUS CONTORTUS.

    Directory of Open Access Journals (Sweden)

    Manoranjan Roy

    2014-12-01

    Full Text Available A total of 232 nos. of Garole sheep were evaluated for studying the variability of resilience to natural infection of Haemonchus contortus in relation to haemoglobin phenovariants as well as to know the association of haemoglobin phenovariants with several haematological parameters, biochemical parameters and serum macro and micro elements. This study revealed a significant variation (p<0.01 of haematological parameters, biochemical parameters and mineral status against resistance status and haemoglobin phenovariants. Significantly (P<0.01 less EPG count was recorded in Haemoglobin–AB type animals than the Haemoglobin-BB type animals. Haemoglobin-AB type animals also possessed significantly higher level of haemoglobin, packed cell volume, total leukocyte count, lymphocyte count, serum total protein, albumin, globulin, calcium, phosphorus, iron, copper and zinc than Haemoglobin-BB type animals. On the other hand Haemoglobin-BB type animals possessed significantly higher level of neutrophil and serum alkaline phosphatase enzyme than Haemoglobin-AB type animals. During selection of H. contortus resistant Garole sheep inclusion of haemoglobin type as an indicator trait may be helpful to achieve the goal. Measurement of haematological parameters, biochemical parameters and serum macro and micro elements in these cases may also be essential for diagnostic and therapeutic purposes

  10. Glycosylated haemoglobin for screening and diagnosis of gestational diabetes mellitus.

    Science.gov (United States)

    Khalafallah, Alhossain; Phuah, Eileen; Al-Barazan, Abdul Majeed; Nikakis, Irena; Radford, Andrea; Clarkson, Wade; Trevett, Clinton; Brain, Terry; Gebski, Val; Corbould, Anne

    2016-04-04

    The oral glucose tolerance test (OGTT) is a cumbersome test that is time consuming, labour intensive and often poorly tolerated by pregnant women. To date, glycosylated haemoglobin (HbA1c) is the most accepted measure of chronic glycaemia outside of pregnancy. HbA1c is an uncomplicated test, less time consuming, does not require any specific patient preparation and is considered straightforward compared with the OGTT. Therefore, we prospectively tested the utility of the HbA1c when used as a screening tool in pregnancy for gestational diabetes mellitus (GDM). Primary health care. Single tertiary referral centre, Tasmania, Australia. A direct comparison between HbA1c levels and the OGTT results in pregnant women, tested concurrently at the 24-28 gestational week, was undertaken. A full profile of 480 pregnant women during the period from September 2012 to July 2014 was completed. Median and mean age of participants was 29 years (range 18-47 years). A simultaneous prospective assessment of HbA1c versus standard OGTT in a cohort of consecutive pregnant women presenting to our institute was performed. The number of women who had GDM according to OGTT criteria was 57, representing 11.9% of the evaluated 480 pregnant women. Using a cut-off value for HbA1c at 5.1% (32 mmol/mol) for detecting GDM showed sensitivity of 61% and specificity of 68% with negative predictive value (NPV) of 93%, versus sensitivity of 27% and specificity of 95% with NPV of 91% when using HbA1c cut-off value of 5.4% (36 mmol/mol). Our results suggest that pregnant women with an HbA1c of≥5.4% (36 mmol/mol) should proceed with an OGTT. This may result in a significant reduction in the burden of testing on both patients and testing facility staff and resources. Further investigations are required to integrate and optimise the HbA1c as a single, non-fasting, screening tool for GDM. ACTRN12611000739910. Published by the BMJ Publishing Group Limited. For permission to use (where not already

  11. Maternal haemoglobin and short-term neonatal outcome in preterm neonates.

    Directory of Open Access Journals (Sweden)

    Elodie Savajols

    Full Text Available To determine whether there is a significant association between maternal haemoglobin measured before delivery and short-term neonatal outcome in very preterm neonates.We included prospectively all live births occurring from 25 to 32+6 weeks of gestation in a tertiary care centre between January 1(st 2009 and December 31(st 2011. Outborn infants and infants presenting with lethal malformations were excluded. Three hundred and thirty-nine mothers and 409 infants met the inclusion criteria. For each mother-infant pair a prospective record of epidemiologic data was performed and maternal haemoglobin concentration recorded within 24 hours before delivery was retrospectively researched. Maternal haemoglobin was divided into quartiles with the second and the third one regarded as reference as they were composed of normal haemoglobin values. Short-term outcome was defined as poor in case of death during hospital stay and/or grades III/IV intraventricular haemorrhage and/or periventricular leukomalacia and/or necessity of ventriculoperitoneal shunt.The global rate of poor short-term neonatal outcome was 11.4% and was significantly associated with low maternal haemoglobin values. This association remained significant after adjustment for antenatal corticosteroids therapy, gestational age, parity, mechanism of preterm birth, mode of delivery and birth weight (aOR = 2.97 CI 95% [1.36-6.47]. There was no relation between short-term neonatal outcome and high maternal haemoglobin concentration values.We show that low maternal haemoglobin concentration at delivery is an independent risk factor for poor short-term neonatal outcome in very preterm neonates. This study is one of the first to show such an association within the preterm population.

  12. A new Vitreoscilla filiformis extract grown on spa water-enriched medium activates endogenous cutaneous antioxidant and antimicrobial defenses through a potential Toll-like receptor 2/protein kinase C, zeta transduction pathway.

    Science.gov (United States)

    Mahe, Yann F; Perez, Marie-Jesus; Tacheau, Charlotte; Fanchon, Chantal; Martin, Richard; Rousset, Françoise; Seite, Sophie

    2013-01-01

    Vitreoscilla filiformis (VF) biomass (VFB) has been widely used in cosmetic preparations and shown to modulate the major inducible free-radical scavenger mitochondrial superoxide dismutase in skin cells. By adding La Roche-Posay (LRP) thermal spring water to the VF culture medium, we obtained a biomass (LRP-VFB) with a similar mitochondrial superoxide dismutase activation capacity to VF. Also, the new biomass more powerfully stimulated mRNA expression and antimicrobial peptides in reconstructed epidermis. Interestingly, a predictive computer model that analyzed transducing events within skin epidermal cells suggested that this protective activity may involve the Toll-like receptor 2/protein kinase C, zeta transduction pathway. Protein kinase C, zeta inhibition was effectively shown to abolish VFB-induced gene stimulation and confirmed this hypothesis. This thus opens new avenues for investigation into the improvement of skin homeostatic defense in relation to the control of its physiological microbiota and innate immunity.

  13. Direct In Vivo Electrochemical Detection of Haemoglobin in Red Blood Cells

    Science.gov (United States)

    Toh, Rou Jun; Peng, Weng Kung; Han, Jongyoon; Pumera, Martin

    2014-08-01

    The electrochemical behavior of iron ion in haemoglobin provides insight to the chemical activity in the red blood cell which is important in the field of hematology. Herein, the detection of haemoglobin in human red blood cells on glassy carbon electrode (GC) was demonstrated. Red blood cells or raw blood cells was immobilized on a glassy carbon electrode surface with Nafion films employed to sandwich the layer of biological sample firmly on the electrode surface. Cyclic voltammetry (CV) analyses revealed a well-defined reduction peak for haemoglobin at about -0.30 V (vs. Ag/AgCl) at the red blood cell (GC-Nf-RBC-3Nf) and blood (GC-Nf-B-3Nf) film modified GCE in a pH 3.5 phosphate buffer solution. We further demonstrated that the complex biological conditions of a human red blood cell displayed no interference with the detection of haemoglobin. Such findings shall have an implication on the possibilities of studying the electrochemical behaviour of haemoglobin directly from human blood, for various scientific and clinical purposes.

  14. Assessing diagnostic accuracy of Haemoglobin Colour Scale in real-life setting.

    Science.gov (United States)

    Shah, Pankaj P; Desai, Shrey A; Modi, Dhiren K; Shah, Shobha P

    2014-03-01

    The study was undertaken to determine diagnostic accuracy of Haemoglobin Colour Scale (HCS) in hands of village-based community health workers (CHWs) in real-life community setting in India. Participants (501 women) were randomly selected from 8 villages belonging to a project area of SEWA-Rural, a voluntary organization located in India. After receiving a brief training, CHWs and a research assistant obtained haemoglobin readings using HCS and HemoCue (reference) respectively. Sensitivity, specificity, positive and negative predictive-values, and likelihood ratios were calculated. Bland-Altman plot was constructed. Mean haemoglobin value, using HCS and HemoCue were 11.02 g/dL (CI 10.9-11.2) and 11.07 g/dL (CI 10.9-11.2) respectively. Mean difference between haemoglobin readings was 0.95 g/dL. Sensitivity of HCS was 0.74 (CI 0.65-0.81) and 0.84 (CI 0.8-0.87) whereas specificity was 0.84 (CI:0.51-0.98) and 0.99 (CI:0.97-0.99) using haemoglobin cutoff limits of 10 g/dL and 7 g/dL respectively. CHWs can accurately diagnose severe and moderately-severe anaemia by using HCS in real-life field condition after a brief training.

  15. Risk factors and consequences of maternal anaemia and elevated haemoglobin levels during pregnancy: a population-based prospective cohort study.

    Science.gov (United States)

    Gaillard, Romy; Eilers, Paul H C; Yassine, Siham; Hofman, Albert; Steegers, Eric A P; Jaddoe, Vincent W V

    2014-05-01

    To determine sociodemographic and life style-related risk factors and trimester specific maternal, placental, and fetal consequences of maternal anaemia and elevated haemoglobin levels in pregnancy. In a population-based prospective cohort study of 7317 mothers, we measured haemoglobin levels in early pregnancy [gestational age median 14.4 weeks (inter-quartile-range 12.5-17.5)]. Anaemia (haemoglobin ≤11 g/dl) and elevated haemoglobin levels (haemoglobin ≥13.2 g/dl) were defined according to the WHO criteria. Maternal blood pressure, placental function and fetal growth were measured in each trimester. Data on gestational hypertensive disorders and birth outcomes was collected from hospitals. Older maternal age, higher body mass index, primiparity and European descent were associated with higher haemoglobin levels (P pregnancy (mean differences 5.1 mmHg, 95% confidence interval [CI] 3.8, 6.5 and 4.1 mmHg, 95% CI 3.0, 5.2, respectively) and with a higher risk of third trimester uterine artery notching (RR 1.3, 95% CI 1.0, 1.7). As compared with maternal normal haemoglobin levels, not anaemia, but elevated haemoglobin levels were associated with fetal head circumference, length, and weight growth restriction from third trimester onwards (P pregnancy. Elevated haemoglobin levels are associated with increased risks of maternal, placental, and fetal complications. © 2014 John Wiley & Sons Ltd.

  16. Promoting access to treatment for patients with haemoglobin disorders

    Directory of Open Access Journals (Sweden)

    L. Perickleous

    2011-12-01

    Full Text Available For the thalassaemia syndromes the Thalassaemia International Federation, the international patients’ organization has been struggling since its inception in 1987 to facilitate access to treatment for all thalassaemia patients across the globe. Ever since we accepted the doctrine that where strong patient organisation exists, we have observed that there has been a marked improvement in the health care services provided for the haemoglobin disorders worldwide. Unfortunately personality or ego issues and lack or inexperience of strategic planning have always proved to be major drawbacks in achieving collective goals for patients. But the biggest obstacle to access to treatment in the years of my early adulthood has been no other than my self. Having finally secured safe and adequate blood, sample chelating agents and excellent medical professionals, I had decided that I had enough and I stopped chelating. I know now that the access to treatment has as much to do with our determination to live and prosper as with the influence of our countrymen to provide to the less privileged. My disorder provided me with much more than I could ever pray for… Thank God. 自1987年成立以来,地中海贫血国际联合会和国际病人组织一直致力于帮助全球此病患者接受治疗。 自从我们接受了“存在着最强大的病人组织”这个观点以后,我们注意到在全球范围内血红蛋白病人的医疗服务得到显著提高。 不幸的是,性格或自尊心问题、缺少或缺乏策略规划经验总是成为达到整体目标的主要障碍。 但是在我成年期的头几年,接受治疗的最大障碍莫过于自己。 在拥有安全和充足的血液、样本螯合剂和优秀的医疗人员后,我觉得这已经足够,便停止了螯合治疗。 我现在知道接受治疗与生存决心息息相关,同时也与我们能对其他人造成的影响相关。 在这次患病中,我得到的远远超过

  17. Haemoglobin variants may cause significant differences in haemoglobin A1c as measured by high-performance liquid chromatography and enzymatic methods in diabetic patients: a cross-sectional study.

    Science.gov (United States)

    Otabe, Shuichi; Nakayama, Hitomi; Ohki, Tsuyoshi; Soejima, Eri; Tajiri, Yuji; Yamada, Kentaro

    2017-07-01

    Background We aimed to determine whether the discrepancy between haemoglobin A1c values determined by high-performance liquid chromatography and enzymatic haemoglobin A1c measurements in diabetic patients was clinically relevant. Methods We randomly recruited 1421 outpatients undergoing diabetic treatment and follow-up who underwent at least three haemoglobin A1c measurements between April 2014 and March 2015 at our clinic. In 6369 samples, haemoglobin A1c was simultaneously measured by HA-8160 and MetaboLead (enzymatic assay), and the values were compared. Results haemoglobin A1c measurements by high-performance liquid chromatography and enzymatic assay were strongly correlated (correlation coefficient: 0.9828, linear approximation curve y = 0.9986x - 0.2507). Mean haemoglobin A1c (6.8 ± 1.0%) measured by high-performance liquid chromatography was significantly higher than that measured by enzymatic assay (6.5 ± 1.0%, P high-performance liquid chromatography than those from enzymatic assay. Of these, three had Hb Toranomon [β112 (G14) Cys→Trp]. The fourth had Hb Ube-2 [α68 (E17) Asn→Asp]. One other subject presented consistently higher haemoglobin A1c values (>1%) by high-performance liquid chromatography than those from enzymatic assay and was diagnosed with a -77 (T > C) mutation in the δ-globin gene. These unrelated asymptomatic subjects had normal erythrocyte profiles, without anaemia. Conclusions We showed that haemoglobin A1c values measured by high-performance liquid chromatography were significantly higher than those measured by enzymatic assay in diabetic subjects. However, when an oversized deviation (>0.7%) between glycaemic control status and haemoglobin A1c is apparent, clinicians should check the methods used to measure haemoglobin A1c and consider the possible presence of a haemoglobin variant.

  18. Physiological properties of eel haemoglobin: hypoxic acclimation, phosphate effects and multiplicity.

    Science.gov (United States)

    Weber, R E; Lykkeboe, G; Johansen, K

    1976-02-01

    Unlike the whole body oxygen affinity, which adapts readily to environmental oxygen tensions, haemoglobins, prepared from normoxic- and hypoxic-accimated eels (Anguilla anguilla) show no adaptive changes in oxygenation properties or in multiplicity. Hypoxic acclimation is, howeveer, accompanied by a strong decrease in red cell nucleoside triphosphates, particularly guanosine triphospphate (GTP), which depresses oxygen affinity of the composite and component haemoglobins more strongly than does the concurring ATP. The effects of pH, temperature and salts on the oxygenation properties of the (isolated) haemoglobins are reported, discussed in relation to the varying environmetal conditions encountered by eels, and compared with data on American and Japanese eels (A. rostrata and A. juponica, respectively.

  19. Role of the duplicated CCAAT box region in γ-globin gene regulation and hereditary persistence of fetal haemoglobin.

    NARCIS (Netherlands)

    A. Ronchi (Antonella); M. Berry (Meera); S. Raguz (Selina); A.M.A. Imam (Ali); N. Yannoutsos (Nikos); S. Ottolenghi (Sergio); F.G. Grosveld (Frank); N.O. Dillon (Niall)

    1996-01-01

    textabstractHereditary persistence of fetal haemoglobin (HPFH) is a clinically important condition in which a change in the developmental specificity of the gamma-globin genes results in varying levels of expression of fetal haemoglobin in the adult. The condition is benign and can significantly

  20. Diagnostic accuracy of the haemoglobin colour scale in neonates and young infants in resource-poor countries

    NARCIS (Netherlands)

    van Rheenen, P. F.; de Moor, L. T. T.

    Due to the insidious nature of infant anaemia, this disorder frequently remains undetected and untreated by health-care workers in resource-poor settings. We assessed the accuracy of a low-cost and simple diagnostic tool, the haemoglobin colour scale (HCS), in estimating haemoglobin (Hb) values in

  1. The contribution of hookworm and other parasitic infections to haemoglobin and iron status among children and adults in western Kenya

    DEFF Research Database (Denmark)

    Olsen, Anette; Magnussen, P.; Ouma, J.H.

    1998-01-01

    hookworm, Necator americanus, Ascaris lumbricoides, Trichuris trichiura, Schistosoma mansoni, malaria, Plasmodium falciparum, Plasmodium malariae, haemoglobin, serum ferritin, anaemia, iron deficiency......hookworm, Necator americanus, Ascaris lumbricoides, Trichuris trichiura, Schistosoma mansoni, malaria, Plasmodium falciparum, Plasmodium malariae, haemoglobin, serum ferritin, anaemia, iron deficiency...

  2. Kinetic resolution of 3-fluoroalanine using a fusion protein of D-amino acid oxidase with Vitroscilla hemoglobin.

    Science.gov (United States)

    Seo, Young-Man; Khang, Yong-Ho; Yun, Hyungdon

    2011-01-01

    In this study, a fusion protein (VHb-DAAO) of D-amino acid oxidase (DAAO) with Vitreoscilla hemoglobin (VHb) was functionally expressed in Escherichia coli and purified. The k(cat) value VHb-DAAO (47.1 s⁻¹) towards rac-3-flouroalanine was about 2-fold higher than that of DAAO (21.9 s⁻¹). rac-3-Flouroalanine (500 mM) was kinetically resolved into (R)-3-fluoroalanine with high enatiomeric excess (>99%) by VHb-DAAO with about 52% conversion.

  3. Seroprevalencia de VHB, VHC y VIH en donadores de sangre en Irapuato, México Seroprevalence of HBV, HCV and HIV in blood donors in Irapuato, Mexico

    Directory of Open Access Journals (Sweden)

    Miguel Angel Carreto-Vélez

    2003-01-01

    Full Text Available OBJETIVO: Investigar la seroprevalencia de marcadores virales de los virus de la inmunodeficiencia humana (VIH, y de las hepatitis B (VHB y C (VHC, en donadores de sangre atendidos en el Hospital General de Zona con Medicina Familiar No. 2, del Instituto Mexicano del Seguro Social de Irapuato, México. MATERIAL Y MÉTODOS: Estudio transversal descriptivo. Se registraron datos en formatos del banco de sangre, y se investigaron factores de riesgo y enfermedades en 7 056 donadores de sangre al Hospital General de Zona con Medicina Familiar No. 2, del Instituto Mexicano del Seguro Social de Irapuato, Guanajuato, México, en un lapso de dos años (de julio de 1998 a junio de 2000, obteniéndose una muestra de 4 010 donadores de recuperación, sometidos estos últimos a pruebas serológicas de VHB, VHC y VIH, serotipos 1 y 2, mediante un inmunoensayo enzimático de micropartículas de tercera generación, en suero o plasma humano; se calculó la seroprevalencia porcentual de los donadores seropositivos y se estratificó por edades y sexo. RESULTADOS: La seroprevalencia absoluta de los casos positivos (VHB, VHC y VIH fue de 2.5% (101; para el VHC fue de 1.14% (46; para el VHB, 1.12% (45, y para el VIH 0.24% (10. Para el sexo masculino el VHB fue de 1.04% (33; VHC, 1.07% (34, y el VIH, 0.28% (9. Para el sexo femenino el VHB fue de 1.42% (12; el VHC, de 1.42% (12, y el VIH de 0.11% (1. Los hombres seropositivos tuvieron una razón 2.4 veces más alta que las mujeres. CONCLUSIONES: La seroprevalencia de marcadores virales fue mayor que la reportada en los estudios previos hechos en México y sugiere que la transmisión sexual fue el mecanismo principal de la infección; esto refleja la pobre educación sanitaria y la necesidad de seleccionar cuidadosamente a los donadores potenciales.OBJECTIVE: To investigate the seroprevalence of viral markers for the human immunodeficiency virus (HIV, and the hepatitis B (HBV and C (HCV viruses, in blood donors at the

  4. Racial variations in booking haemoglobin of primigravidae in Malaysia: a prospective study

    Science.gov (United States)

    2013-01-01

    Background Variations in racial haemoglobin had been previously described in multiple studies locally and abroad. This study was conducted to quantify the differences in haemoglobin of booking primigravidae amongst the three major races in Malaysia at the antenatal clinic of University Malaya Medical Centre, Kuala Lumpur. Findings One year prospective study of booking full blood count sample of primigravidae taken in one centre was conducted. Multiple comparative analyses of the booking haemoglobin were performed using the One-way ANOVA comparative mean test in each trimester. 622 primigravidae without any known history of haematological disorders were recruited into the study. The mean haemoglobin for the Indian race was the lowest compared to the two other races in the second and the third trimesters, and it was found to be statistically significant lower (p- value 0.001) than the Malay race in the second trimester. It was also found that the Indian race had a significantly higher incidence of moderate to severe anaemia (p- value: 0.029). The prevalence of anaemia in our study population is also significantly higher in the Indian population (p- value: 0.01). Conclusions The findings from this study have established that there is racial preponderance to anaemia in pregnancy. The Indian race is at a higher risk of having anaemia in pregnancy particularly in the second trimester. PMID:23634656

  5. Haemoglobin modulates salicylate and jasmonate/ethylene-mediated resistance mechanisms against pathogens

    DEFF Research Database (Denmark)

    Mur, Luis A J; Sivakumaran, Anushen; Mandon, Julien

    2012-01-01

    Nitric oxide (NO) plays a role in defence against hemibiotrophic pathogens mediated by salicylate (SA) and also necrotrophic pathogens influenced by jasmonate/ethylene (JA/Et). This study examined how NO-oxidizing haemoglobins (Hb) encoded by GLB1, GLB2, and GLB3 in Arabidopsis could influence both...

  6. Changes in haemoglobin levels in infants in Malawi: effect of low birth weight and fetal anaemia

    NARCIS (Netherlands)

    le Cessie, S.; Verhoeff, F. H.; Mengistie, G.; Kazembe, P.; Broadhead, R.; Brabin, B. J.

    2002-01-01

    Objectives: To examine the effect of low birth weight (LBW) and fetal anaemia (FA) on haemoglobin (Hb) patterns in infancy. To study the additional contribution of other risk factors known at birth. To examine the effect of iron supplementation during infancy on Hb levels. Methods: A stratified

  7. Should haemoglobin A1C be used for diagnosis of diabetes mellitus ...

    African Journals Online (AJOL)

    2016-03-28

    Mar 28, 2016 ... of red blood cells resulting from haemoglobinopathies, splenomegaly (also common in malaria) rheumatoid arthritis, or drugs (for example, antimicrobials such as ribavirin and dapsone) can also decrease HbA1c. Table 1: Some factors that influence glycated haemoglobin (HbA1c) and its measurement.

  8. Raman and SERS recognition of β-carotene and haemoglobin fingerprints in human whole blood.

    Science.gov (United States)

    Casella, Michele; Lucotti, Andrea; Tommasini, Matteo; Bedoni, Marzia; Forvi, Elena; Gramatica, Furio; Zerbi, Giuseppe

    2011-09-01

    The present work reports on Raman and Surface Enhanced Raman Scattering (SERS) vibrational fingerprints of β-carotene and haemoglobin in fresh whole blood (i.e. right after blood test) with different laser excitations, i.e. visible (514 nm) and near-infrared (NIR, 785 nm). The use of colloidal silver nanoparticles significantly increases the Raman signal, thus providing a clear SERS spectrum of blood. The collected spectra have been examined and marker bands of β-carotene and of the haem prosthetic group of haemoglobin have been found. In particular, the fundamental features of β-carotene (514 nm excitation), blood proteins and haem molecules (785 nm excitation) were recognized and assigned. Moreover haemoglobin SERS signals can be identified and related with its oxygenation state (oxy-haemoglobin). The data reported show the prospects of Raman and SERS techniques to detect important bio-molecules in a whole blood sample with no pre-treatment. Copyright © 2011 Elsevier B.V. All rights reserved.

  9. Risk of stillbirth in relation to maternal haemoglobin concentration during pregnancy.

    Science.gov (United States)

    Tomashek, Kay M; Ananth, Cande V; Cogswell, Mary E

    2006-01-01

    The authors determined the association between maternal haemoglobin concentration measured at or=28 weeks' gestation (stillbirth). Data were derived from the National Maternal and Infant Health Survey--a nationally representative survey of US deliveries in 1988. Analysis was restricted to women with a singleton live birth (n = 4,199) or a stillbirth (n = 1,375) for whom maternal prenatal care, haemoglobin, smoking status and gestational age data were available. Haemoglobin concentrations during first and second trimesters, respectively, were classified as mild (10.0 to or=14.6 g dL(-1) in either trimester). Hazard ratios (HR) and 95% confidence intervals (CI) for stillbirth were derived from discrete proportional hazards regression models after adjusting for confounders. Stillbirth was not associated with mild anaemia or high haemoglobin in either the first or second trimester of pregnancy. Moderate anaemia measured before 28 weeks' gestation was significantly associated with an increased risk of stillbirth among non-black women (adjusted HR: 4.4; 95% CI: 1.02, 19.01). Moderate anaemia was not associated with stillbirths among black women. Further investigation regarding causal mechanisms for this association is warranted.

  10. Inositol-P 6 induced structural changes in duck major haemoglobin ...

    African Journals Online (AJOL)

    The reactivities of 5,5'-Dithiobis (2-nitrobenzoate) with the sulphydryl groups of major haemoglobin of duck (Anas platyrhinchos) have been carried out in the presence of inositol hexakisphosphate, inositol-P6. The time course of the reaction is biphasic. The addition of inositol-P6 changed the pH dependence profile of the ...

  11. Nutrient Patterns Associated with Fasting Glucose and Glycated Haemoglobin Levels in a Black South African Population

    NARCIS (Netherlands)

    Chikowore, T.; Pisa, P.T.; Zyl, van Tertia; Feskens, E.J.M.; Wentzel-Viljoen, E.; Conradie, K.R.

    2017-01-01

    Type 2 diabetes (T2D) burden is increasing globally. However, evidence regarding nutrient patterns associated with the biomarkers of T2D is limited. This study set out to determine the nutrient patterns associated with fasting glucose and glycated haemoglobin the biomarkers of T2D. Factor analysis

  12. Elevated third-trimester haemoglobin A 1c predicts preterm delivery in type 1 diabetes

    DEFF Research Database (Denmark)

    Ekbom, Pia; Damm, Peter; Feldt-Rasmussen, Bo

    2008-01-01

    The prevalence of preterm delivery is considerably elevated in women with type 1 diabetes. The aim of the study was to evaluate haemoglobin A(1c) (HbA(1c)) as a predictor of preterm delivery. Two hundred thirteen consecutive pregnant women with type 1 diabetes and normal urinary albumin excretion...

  13. Should haemoglobin A 1c be used for the diagnosis of diabetes ...

    African Journals Online (AJOL)

    Each of these has limitations and, in 2009, an expert committee of the American Diabetes Association recommended using the haemoglobin A1c (HbA1c) to diagnose diabetes mellitus.1 The aim of this paper is to analyse the advantages and disadvantages of using HbA1c as a diagnostic method for diabetes, and its ...

  14. Inositol-P6 induced structural changes in duck major haemoglobin

    African Journals Online (AJOL)

    Bamiji Babalola

    2011-11-02

    Nov 2, 2011 ... The reactivities of 5,5'-Dithiobis (2-nitrobenzoate) with the sulphydryl groups of major haemoglobin of duck (Anas platyrhinchos) have been carried out in the presence of inositol hexakisphosphate, inositol-P6. The time course of the reaction is biphasic. The addition of inositol-P6 changed the pH.

  15. The moderating effect of haemoglobin A 2 on morbidity in sickle cell ...

    African Journals Online (AJOL)

    High HbA2 levels are associated with lower morbidity in sickle cell anaemia patients. Treatment strategies, which increase HbA2 , may be beneficial in managing SCA. Keywords: Haemoglobin A2 ; sickle cell anaemia; morbidity. International Journal of Biological and Chemical Sciences Vol. 1 (3) 2007: pp. 287-292 ...

  16. The utility of pre-operative haemoglobin testing in adult day-case ...

    African Journals Online (AJOL)

    A retrospective review of the results of preoperative haemoglobin tests of adult day-case surgical patients over a 2-year period was used as tool. Results shows that during the study period, 500 patients underwent day-case surgical procedures under general anaesthesia. Thirty (6%) out of the 500 patients had abnormal ...

  17. Predictors of serum ferritin and haemoglobin during pregnancy, in a malaria-endemic area of western Kenya.

    Science.gov (United States)

    Alusala, D N; Estambale, B B A; Magnussen, P; Friis, H; Luoba, A I; Mwaniki, D

    2008-06-01

    Between 2000 and 2004, a cross-sectional survey was conducted, as part of a prospective cohort study, among the women attending antenatal-care clinics in Bondo district, a malaria-endemic area of western Kenya. The aim was to assess the prevalence of iron deficiency and determine the predictors of haemoglobin and serum ferritin concentrations in the women who had a gestational age between 14 and 24 weeks. A standardized questionnaire was used to collect and store the relevant bio-data for the study. Haemoglobin and ferritin concentrations were evaluated, sickle-cell status was determined, and malarial parasitaemias were detected and evaluated, using blood samples collected at enrollment. Multiple regression analysis was then used to test for significant predictors of the haemoglobin and serum ferritin concentrations. Although 842 women were enrolled in the prospective cohort study, haemoglobin concentrations were evaluated for only 828 of them, serum ferritin levels for 621, and levels of parasitaemia for 812. The mean haemoglobin concentration recorded was 10.9 g/dl. Although 37.9% of the subjects had mild-moderate anaemia (7.0-10.5 g haemoglobin/dl), only 0.5% were severely anaemic (<7.0 g haemoglobin/dl). The geometric mean serum ferritin concentration recorded was 18.9 microg/litre, and 32.3% of the subjects evaluated had low serum concentrations of ferritin (<12 microg/litre). Among the parasitaemic primigravidae (but not the parasitaemic multigravidae), those found positive for sickle-cell trait had significantly lower haemoglobin concentrations than those found negative in a sickling test (P=0.01). Among the pregnant women of Bondo district, gravidity, malarial infection and sickle cell appear to be key predictors of haemoglobin concentration.

  18. Impact of preoperative haemoglobin concentrations on the efficiency of KTP-laser vaporization of the prostate.

    Science.gov (United States)

    Buse, Stephan; Gilfrich, Christian; Hatiboglu, Gencay; Huber, Johannes; Bedke, Jens; Pfitzenmaier, Jesco; Haferkamp, Axel; Hohenfellner, Markus

    2009-06-01

    The potassium-titanyl-phoshate laser (KTP laser) device produces light (wavelength of 532 nm) that is absorbed by haemoglobin, thus releasing thermal energy. This reaction causes vaporization of the tissue. We tested whether preoperative haemoglobin concentrations (Hb) affect the efficiency of the 80 W KTP laser, thus affecting the energy applied. We assessed 164 patients undergoing KTP-laser vaporization for benign prostate hyperplasia from January 2005 to July 2006 at Heidelberg University Hospital. We prospectively collected data on patients' demographics, urodynamics, Hb, prostate volume, and energy applied. We calculated the correlation between preoperative Hb and surgery energy applied and we adjusted it for prostate volume. We further compared the postoperative urinary flow and residual volume results in non-low-Hb and in low-Hb patients. The mean age was 68.8 (+/-8.8 years), the median prostate volume 50.0 mL (interquartile range 40-80), the median preoperative urinary flow 10.1 mL/s (interquartile range 7.1-14.0), the median surgery duration 70.0 min (interquartile range 50-92.75), the median preoperative Hb 144.5 g/L (interquartile range 132-151), and the median applied energy 209.5 kJ (interquartile range 156.5-272.75). The unadjusted correlation between preoperative Hb and applied energy was -0.089 (P 0.05). Functional results did not differ between low-Hb and non-low-Hb patients (P > 0.05 for urinary flow and postvoid volume). Haemoglobin concentrations, in the range of clinically encountered values, do not affect the efficiency of 80 W KTP-laser vaporization of the prostate. This laser technique is thus applicable in patients with low haemoglobin concentrations without concerns about efficiency.

  19. Nutrient Patterns Associated with Fasting Glucose and Glycated Haemoglobin Levels in a Black South African Population

    Science.gov (United States)

    Chikowore, Tinashe; Pisa, Pedro T.; van Zyl, Tertia; Feskens, Edith J. M.; Wentzel-Viljoen, Edelweiss; Conradie, Karin R.

    2017-01-01

    Type 2 diabetes (T2D) burden is increasing globally. However, evidence regarding nutrient patterns associated with the biomarkers of T2D is limited. This study set out to determine the nutrient patterns associated with fasting glucose and glycated haemoglobin the biomarkers of T2D. Factor analysis was used to derive nutrient patterns of 2010 participants stratified by urban/rural status and gender. Principal Component Analysis (PCA) was applied to 25 nutrients, computed from the quantified food frequency questionnaires (QFFQ). Three nutrient patterns per stratum, which accounted for 73% of the variation of the selected nutrients, were identified. Multivariate linear regression models adjusted for age, BMI, smoking, physical activity, education attained, alcohol intake, seasonality and total energy intake were computed. Starch, dietary fibre and B vitamins driven nutrient pattern was significantly associated with fasting glucose (β = −0.236 (−0.458; −0.014); p = 0.037) and glycated haemoglobin levels (β = −0.175 (−0.303; −0.047); p = 0.007) in rural women. Thiamine, zinc and plant protein driven nutrient pattern was associated with significant reductions in glycated haemoglobin and fasting glucose ((β = −0.288 (−0.543; −0.033); p = 0.027) and (β = −0.382 (−0.752; −0.012); p = 0.043), respectively) in rural men. Our results indicate that plant driven nutrient patterns are associated with low fasting glucose and glycated haemoglobin levels. PMID:28106816

  20. Nutrient Patterns Associated with Fasting Glucose and Glycated Haemoglobin Levels in a Black South African Population

    Directory of Open Access Journals (Sweden)

    Tinashe Chikowore

    2017-01-01

    Full Text Available Type 2 diabetes (T2D burden is increasing globally. However, evidence regarding nutrient patterns associated with the biomarkers of T2D is limited. This study set out to determine the nutrient patterns associated with fasting glucose and glycated haemoglobin the biomarkers of T2D. Factor analysis was used to derive nutrient patterns of 2010 participants stratified by urban/rural status and gender. Principal Component Analysis (PCA was applied to 25 nutrients, computed from the quantified food frequency questionnaires (QFFQ. Three nutrient patterns per stratum, which accounted for 73% of the variation of the selected nutrients, were identified. Multivariate linear regression models adjusted for age, BMI, smoking, physical activity, education attained, alcohol intake, seasonality and total energy intake were computed. Starch, dietary fibre and B vitamins driven nutrient pattern was significantly associated with fasting glucose (β = −0.236 (−0.458; −0.014; p = 0.037 and glycated haemoglobin levels (β = −0.175 (−0.303; −0.047; p = 0.007 in rural women. Thiamine, zinc and plant protein driven nutrient pattern was associated with significant reductions in glycated haemoglobin and fasting glucose ((β = −0.288 (−0.543; −0.033; p = 0.027 and (β = −0.382 (−0.752; −0.012; p = 0.043, respectively in rural men. Our results indicate that plant driven nutrient patterns are associated with low fasting glucose and glycated haemoglobin levels.

  1. Anisakis haemoglobin is a main antigen inducing strong and prolonged immunoreactions in rats.

    Science.gov (United States)

    Abe, Niichiro; Teramoto, Isao

    2017-07-01

    Anisakis simplex larvae are well known to cause gastrointestinal and allergic manifestations after ingestion of parasitized raw or undercooked seafood. The antibody recognition dynamics against the components of Anisakis larval antigen after primary and re-infection with Anisakis live larvae remain unclear. For this study, immunoblot analyses of serum IgG, IgE, and IgM against Anisakis larval somatic extract were performed in rats that had been orally inoculated with A. simplex live larvae. Multiple antigen fractions were recognized after primary infection. Their reaction was enhanced after re-infection. Antibody recognition was observed for 12 weeks after re-infection. The fraction of approximately 35 kDa contained a main antigen that induced strong and prolonged immunoreactions in IgG and IgE. The antibody reaction to this fraction appeared to be enhanced after inoculation of larval homogenates. This fraction was heat tolerant with boiling for 30 min. The fraction was spotted by immunoblotting after two-dimensional electrophoresis and was identified as Anisakis haemoglobin (Ani s 13) using mass spectrometry analysis. The amino acid sequences of haemoglobin mRNAs from two A. simplex sensu stricto and one Anisakis pegreffii were identified by RACE-PCR. They differed from those of two isolates of Pseudoterranova decipiens and A. pegreffii. Results of this study show that Anisakis haemoglobin, which is known to be a major allergen of A. simplex, induces strong and prolonged immunoreaction in rats. This report is the first to show the amino acid sequence variation of Anisakis haemoglobin mRNA between A. simplex sensu stricto and A. pegreffii.

  2. Effect of Vitamin C and Tablets Fe on Haemoglobin Levels Against Pregnant Women

    Directory of Open Access Journals (Sweden)

    Susilo Wirawan

    2016-01-01

    Full Text Available Background: Iron deficiency anaemia is the most common nutritional problem of pregnant women in Indonesia. The existing program/intervention has been implemented namely supplementation of iron pills for mothers at the third semester of pregnancy. This study aims to compare the effect of single and multiple micronutrients supplementation of iron and iron plus vitamin C. Methods: Type of the study is study experimental with the design of community intervention, implementing pre and post trials. Subjects were pregnant women at the second semester of pregnancy. Haemoglobin level was examinedby Cyanmet hemoglobin. Data analysis was done through independent and paired t-test. Results: showed that there were statistically signifi cant difference between the intervention and control group (p = 0.001. The haemoglobin level of the intervention group increased by 0.91 grm%, while the control group was 0.43 grm%. The proportion of anaemia amongpregnant mothers declined after intervention from 80.95 to 42.86 at the intervention group. Similarly, the proportion of anaemia of the control group reduced from 80.95% to 71.43% after the intervention. Conclusion: intervention with multiple micronutrients of Fe combined with vitamin C has more effect in changing the haemoglobin levels of pregnant mothers.Recommendation: Fe tablet administration should still be accompanied by vitamin C to help boost hemoglobin levels. Required for controlled administration of iron tablet, along with vitamin C so that the effect can be seen.

  3. A new Vitreoscilla filiformis extract grown on spa water-enriched medium activates endogenous cutaneous antioxidant and antimicrobial defenses through a potential Toll-like receptor 2/protein kinase C, zeta transduction pathway

    Directory of Open Access Journals (Sweden)

    Mahe YF

    2013-08-01

    Full Text Available Yann F Mahe,1 Marie-Jesus Perez,1 Charlotte Tacheau,1 Chantal Fanchon,2 Richard Martin,3 Françoise Rousset,1 Sophie Seite4 1L’Oreal Research and Innovation, Clichy, 2L’Oréal Research and Innovation, Chevilly Larue, 3L’Oréal Research and Innovation Tours, 4La Roche-Posay Pharmaceutical Laboratories, Asnières, France Abstract: Vitreoscilla filiformis (VF biomass (VFB has been widely used in cosmetic preparations and shown to modulate the major inducible free-radical scavenger mitochondrial superoxide dismutase in skin cells. By adding La Roche-Posay (LRP thermal spring water to the VF culture medium, we obtained a biomass (LRP-VFB with a similar mitochondrial superoxide dismutase activation capacity to VF. Also, the new biomass more powerfully stimulated mRNA expression and antimicrobial peptides in reconstructed epidermis. Interestingly, a predictive computer model that analyzed transducing events within skin epidermal cells suggested that this protective activity may involve the Toll-like receptor 2/protein kinase C, zeta transduction pathway. Protein kinase C, zeta inhibition was effectively shown to abolish VFB-induced gene stimulation and confirmed this hypothesis. This thus opens new avenues for investigation into the improvement of skin homeostatic defense in relation to the control of its physiological microbiota and innate immunity. Keywords: innate skin defenses, TLR2, PKCz, La Roche-Posay, mitochondrial superoxide dismutase, SOD2

  4. Association among low whole blood viscosity, haematocrit, haemoglobin and diabetic retinopathy in subjects with type 2 diabetes.

    Science.gov (United States)

    Irace, C; Scarinci, F; Scorcia, V; Bruzzichessi, D; Fiorentino, R; Randazzo, G; Scorcia, G; Gnasso, A

    2011-01-01

    Haemorheological variables influence endothelial function through the release of several factors. Clinical studies have described an association among blood viscosity, haematocrit, haemoglobin and macro-angiopathy. Few data are reported about the association between haemorheological variables and micro-angiopathy. The aim of the present study was to evaluate the association between these variables and retinopathy in subjects with type 2 diabetes. 111 men, 79 postmenopausal women, and 95 healthy age- and sex-matched controls were recruited. Haematocrit and haemoglobin were measured by standard methods. Blood viscosity was calculated according to the formula (0.12× haematocrit)+(0.17× (plasma proteins-2.07)). Subjects were grouped according to the presence or absence of diabetic retinopathy, while the severity of retinopathy was classified according to the Early Treatment Diabetic Retinopathy Study scale. Haemoglobin, haematocrit and whole blood viscosity were significantly lower in subjects with retinopathy compared to subjects without retinopathy in both sexes. These variables significantly decreased with increasing severity of retinopathy. A multiple logistic regression analysis confirmed the independent inverse association among viscosity, haematocrit, haemoglobin and retinopathy (p<0.01). Results demonstrate the association among low viscosity, haemoglobin, haematocrit and diabetic retinopathy. The mechanisms responsible for this association can be hypothesised. Reduced haemoglobin might cause direct organ damage. Low blood viscosity, through the reduction of shear stress, might inhibit the anti-atherogenic functions of endothelial cells.

  5. Syncytiotrophoblast vesicles show altered micro-RNA and haemoglobin content after ex-vivo perfusion of placentas with haemoglobin to mimic preeclampsia.

    Science.gov (United States)

    Cronqvist, Tina; Saljé, Karen; Familari, Mary; Guller, Seth; Schneider, Henning; Gardiner, Chris; Sargent, Ian L; Redman, Christopher W; Mörgelin, Matthias; Åkerström, Bo; Gram, Magnus; Hansson, Stefan R

    2014-01-01

    Cell-free foetal haemoglobin (HbF) has been shown to play a role in the pathology of preeclampsia (PE). In the present study, we aimed to further characterize the harmful effects of extracellular free haemoglobin (Hb) on the placenta. In particular, we investigated whether cell-free Hb affects the release of placental syncytiotrophoblast vesicles (STBMs) and their micro-RNA content. The dual ex-vivo perfusion system was used to perfuse isolated cotyledons from human placenta, with medium alone (control) or supplemented with cell-free Hb. Perfusion medium from the maternal side of the placenta was collected at the end of all perfusion phases. The STBMs were isolated using ultra-centrifugation, at 10,000×g and 150,000×g (referred to as 10K and 150K STBMs). The STBMs were characterized using the nanoparticle tracking analysis, identification of surface markers and transmission electron microscopy. RNA was extracted and nine different micro-RNAs, related to hypoxia, PE and Hb synthesis, were selected for analysis by quantitative PCR. All micro-RNAs investigated were present in the STBMs. Mir-517a, mir-141 and mir-517b were down regulated after Hb perfusion in the 10K STBMs. Furthermore, Hb was shown to be carried by the STBMs. This study showed that Hb perfusion can alter the micro-RNA content of released STBMs. Of particular interest is the alteration of two placenta specific micro-RNAs; mir-517a and mir-517b. We have also seen that STBMs may function as carriers of Hb into the maternal circulation.

  6. Connecting airborne Ku-band radar measurements to surface-based measurements: Integrating data from ASIRAS, VHB, and physical property measurements from Greenland and Svalbard. (Invited)

    Science.gov (United States)

    Hawley, R. L.; Morris, E. M.; Brant, O.

    2009-12-01

    Airborne observations can extend the reach of ground-based campaigns measuring spatial variability of snow properties. We introduce the European Space Agency's Airborne Synthetic aperture Interferometric Radar Altimetry System (ASIRAS), and discuss the penetration of its 13.5 GHz energy into polar firn and snow. We compare results from ASIRAS to physical property measurements in Greenland, Very High Bandwidth (VHB) radar measurements in Svalbard, and physical propetry measurements in both locations. Operating at 1 GHz bandwidth, ASIRAS can penetrate as much as 11 m into polar firn, and has detected annually-occurring density horizons in the dry-snow zone of Greenland. On Austfonna and Kongsvagen in Svalbard, ASIRAS detects the Last Summer Surface (LSS), allowing measurements of winter accumulation. These measurements allow us to examine the nature of the subsurface reflections detected by ASIRAS.

  7. Maternal anaemia at delivery and haemoglobin evolution in children during their first 18 months of life using latent class analysis.

    Directory of Open Access Journals (Sweden)

    Kobto G Koura

    Full Text Available BACKGROUND: Anaemia during pregnancy and at delivery is an important public health problem in low- and middle-income countries. Its association with the children's haemoglobin level over time remains unclear. Our goals were to identify distinct haemoglobin level trajectories using latent class analysis and to assess the association between these trajectories and maternal anaemia and other risk factors. METHOD: A prospective study of children from birth to 18 months of life was conducted in a rural setting in Tori-Bossito, Benin. The main outcome measure was the haemoglobin levels repeatedly measured at 3, 6, 9, 12, 15 and 18 months. Variables were collected from the mothers at delivery and from their children at birth and during the follow-up. The analyses were performed by means of Latent Class Analysis which has never been used for this kind of data. All the analyses were performed with Stata software, version 11.0, using the generalized linear latent and mixed model (GLLAMM framework. RESULTS: We showed that 33.7% of children followed a low haemoglobin trajectory and 66.3% a high trajectory during the first 18 months of life. Newborn anaemia, placental malaria, malaria attack, sickle cell trait and male gender were significantly associated with a lower children's haemoglobin level over time, whereas maternal age, children living in a polygamous family and with good feeding practices had a higher Hb level in the first18 months. We also showed that maternal anaemia was a predictor for 'low haemoglobin level trajectory' group membership but have no significant effect on children haemoglobin level over time. CONCLUSION: Latent Class Analyses framework seems well suited to analyse longitudinal data under the hypothesis that different subpopulations of subjects are present in the data, each with its own set of parameters, with distinctive evolutions that themselves may reflect distinctive aetiologies.

  8. Reliability and validity of non-invasive determined haemoglobin mass and blood volumes

    DEFF Research Database (Denmark)

    Fagoni, Nazzareno; Andersen, Andreas Breenfeldt; Oberholzer, Laura

    2017-01-01

    INTRODUCTION: The carbon monoxide (CO) rebreathing method used for the determination of haemoglobin mass (Hbmass ) is associated with blood sample analysis (in this study: Radiometer ABL800). As an alternative hereto the aim of the present study was to evaluate the use of a portable and non......-invasive CO pulse oximeter (Rad-57). METHOD: With simultaneous determination of CO in the circulation by ABL800 (%HbCO) and Rad-57 (SpCO), Hbmass and blood volume (BV) were determined in duplicates in 24 volunteers. Percentage of typical errors (%TE) within methods and linear correlations between the two...

  9. Blood haemoglobin concentrations are higher in smokers and heavy alcohol consumers than in non-smokers and abstainers-should we adjust the reference range?

    DEFF Research Database (Denmark)

    Milman, N.; Pedersen, Agnes N.

    2009-01-01

    The blood haemoglobin concentration is one of the most frequently used laboratory parameters in clinical practice. There is evidence that haemoglobin levels are influenced by tobacco smoking. The objective of this study was to evaluate the impact of smoking and alcohol consumption on haemoglobin...... concentrations in apparently healthy subjects living at sea level. A retrospective, epidemiological cohort study was performed in 1984. Participants were 1,503 men and 1,437 non-pregnant women evenly distributed in age cohorts of 30, 40, 50, and 60 years. Information of smoking habits and alcohol consumption...... were obtained by a questionnaire. Haemoglobin was measured in the fasting state on Coulter-S. Men displayed no difference in mean haemoglobin levels in the four age groups. In women, mean haemoglobin increased gradually with age (p = 0.001). Fifty-nine percent of men and 50% of women were daily smokers...

  10. DETECTION OF HAEMOGLOBINOPATHIES USING HAEMOGLOBIN ELECTROPHORESIS IN MICROCYTIC HYPOCHROMIC ANAEMIA IN PAEDIATRIC POPULATION OF SOUTHERN ODISHA

    Directory of Open Access Journals (Sweden)

    Meenakshi Mohapatro

    2017-02-01

    Full Text Available BACKGROUND Anaemia is the most common symptom in the developing countries including India where under nutrition is prevalent besides haemoglobinopathy is also prevalent in this geographic region. Haemoglobinopathies especially thalassaemia minor present in the paediatric age group with microcytic hypochromic anaemia and hence often misdiagnosed and treated wrongly as iron deficiency anaemia. Simpler cost-effective techniques like study of haematological indices by performing Complete Blood Count (CBC and in suspicious cases haemoglobin electrophoresis the exact diagnosis can be established at the earliest. MATERIALS AND METHODS Under aseptic condition, 5 mL of blood collected in K2EDTA Vacutainer. One part was analysed in cell count analyser. Other part was used to prepare hemolysate and subsequently gel electrophoresis. RESULTS Gel Electrophoresis is done in 210 cases of microcytic hypochromic anaemia which is detected by haemogram assay, 21% of cases were diagnosed to be thalassaemia and 79% were iron deficiency anaemia. CONCLUSION Iron-Deficiency Anaemia (IDA is the commonest cause of microcytic hypochromic anaemia, the second being thalassaemia. Differential diagnosis is based on complete haemogram and peripheral smear. Serum iron profile study and haemoglobin electrophoresis are must for confirmation of diagnosis.

  11. The distribution of haemoglobin C and its prevalence in newborns in Africa.

    Science.gov (United States)

    Piel, Frédéric B; Howes, Rosalind E; Patil, Anand P; Nyangiri, Oscar A; Gething, Peter W; Bhatt, Samir; Williams, Thomas N; Weatherall, David J; Hay, Simon I

    2013-01-01

    Haemoglobin C (HbC) is one of the commonest structural haemoglobin variants in human populations. Although HbC causes mild clinical complications, its diagnosis and genetic counselling are important to prevent inheritance with other haemoglobinopathies. Little is known about its contemporary distribution and the number of newborns affected. We assembled a global database of population surveys. We then used a Bayesian geostatistical model to create maps of HbC frequency across Africa and paired our predictions with high-resolution demographics to calculate heterozygous (AC) and homozygous (CC) newborn estimates and their associated uncertainty. Data were too sparse outside Africa for this methodology to be applied. The highest frequencies were found in West Africa but HbC was commonly found in other parts of the continent. The expected annual numbers of AC and CC newborns in Africa were 672,117 (interquartile range (IQR): 642,116-705,163) and 28,703 (IQR: 26,027-31,958), respectively. These numbers are about two times previous estimates.

  12. Ocorrência da infecção pelo vírus da hepatite B (VHB e delta (VHD em sete grupos indígenas do Estado do Amazonas

    Directory of Open Access Journals (Sweden)

    Braga Wornei Silva Miranda

    2001-01-01

    Full Text Available A infecção pelo VHB e VHD são importantes problemas de saúde na Amazônia. Este estudo avalia a prevalência da infecção por esses agentes em sete grupos indígenas do Estado do Amazonas. A taxa de infecção passada pelo VHB encontrada foi de 54,5% e a de portadores do AgHBs de 9,7%. Observa-se variação importante destes marcadores entre as aldeias, inclusive da mesma etnia. Não evidenciamos marcador de infecção aguda, os quatro AgHBe reativos eram todos Apurinã, da mesma aldeia, e três da mesma família. O VHD foi encontrado em 13,4% dos AgHBs reativos. O padrão de infecção pelo VHB e VHD encontrado possui as seguintes características: endemicidade elevada, baixo potencial de infectividade, transmissão marcada em idade precoce, provável transmissão familiar, e pouca importância da transmissão vertical. Entretanto, também sugere que esses vírus não tenham sido ainda introduzidos efetivamente em algumas das etnias estudadas.

  13. Haplotype analyses of haemoglobin C and haemoglobin S and the dynamics of the evolutionary response to malaria in Kassena-Nankana District of Ghana.

    Directory of Open Access Journals (Sweden)

    Anita Ghansah

    Full Text Available Haemoglobin S (HbS and C (HbC are variants of the HBB gene which both protect against malaria. It is not clear, however, how these two alleles have evolved in the West African countries where they co-exist at high frequencies. Here we use haplotypic signatures of selection to investigate the evolutionary history of the malaria-protective alleles HbS and HbC in the Kassena-Nankana District (KND of Ghana.The haplotypic structure of HbS and HbC alleles was investigated, by genotyping 56 SNPs around the HBB locus. We found that, in the KND population, both alleles reside on extended haplotypes (approximately 1.5 Mb for HbS and 650 Kb for HbC that are significantly less diverse than those of the ancestral HbA allele. The extended haplotypes span a recombination hotspot that is known to exist in this region of the genomeOur findings show strong support for recent positive selection of both the HbS and HbC alleles and provide insights into how these two alleles have both evolved in the population of northern Ghana.

  14. Tissue specific haemoglobin gene expression suggests adaptation to local marine conditions in North Sea flounder (Platichthys flesus L.)

    DEFF Research Database (Denmark)

    Larsen, P.F.; Eg Nielsen, Einar; Hansen, M.M.

    2013-01-01

    of the haemoglobin alpha and beta subunit genes was studied in reciprocally transplanted European flounder Platichthys flesus from the highly saline North Sea and the brackish Baltic Sea. Clear differences in expression patterns of haemoglobin alpha and beta subunit genes were found among different types of tissue....... Finally, for kidney tissue a stress response was observed in one population, with gene up-regulation when North Sea flounders were transplanted to low salinity. This study underlines the importance of tissue specific gene expression and the significance of gene expression for evolution of local adaptation...... in high gene flow marine fishes. © 2013 The Genetics Society of Korea...

  15. Aspirin-mediated acetylation of haemoglobin increases in presence of high glucose concentration and decreases protein glycation

    Directory of Open Access Journals (Sweden)

    Francesco Finamore

    2015-09-01

    Full Text Available Glycation represents the first stage in the development of diabetic complications. Aspirin was shown to prevent sugars reacting with proteins, but the exact mechanism of this interaction was not well defined. We performed a quantitative analysis to calculate the levels of acetylation and glycation of haemoglobin, among others red blood cell (RBC proteins, using a label free approach. After glucose incubation, increases in the acetylation levels were seen for several haemoglobin subunits, while a parallel decrease of their glycation levels was observed after aspirin incubation. These results suggest that, a mutual influence between these two modifications, occur at protein level.

  16. Detection of glucose metabolism disorders in coronary patients enrolled in cardiac rehabilitation: Is glycated haemoglobin useful? Data from the prospective REHABDIAB study.

    Science.gov (United States)

    Tatulashvili, Sopio; Patois-Vergès, Bénédicte; Nguyen, Amandine; Blonde, Marie-Cécile; Vergès, Bruno

    2018-01-01

    Introduction Diabetes and pre-diabetes are highly prevalent in patients with a history of acute coronary syndrome. This is why screening for glucose metabolism disorders is recommended in patients following an acute coronary syndrome. The aim of our study was to determine whether glycated haemoglobin alone compared with the oral glucose tolerance test could allow effective screening for glucose metabolism disorders in acute coronary syndrome patients undergoing cardiac rehabilitation. Patients and methods Among 347 patients with a recent history of acute coronary syndrome enrolled in our cardiac rehabilitation centre, 267 patients without previously known diabetes were recruited for this prospective study with performance of both oral glucose tolerance test and glycated haemoglobin measurement. The patients were divided into three groups: newly diagnosed diabetes mellitus, pre-diabetes and normoglycaemia according to the oral glucose tolerance test and glycated haemoglobin results. The results obtained with glycated haemoglobin were compared with those obtained with the oral glucose tolerance test, considered as the reference. Results For the diagnosis of diabetes, glycated haemoglobin had a sensitivity of 72% and a specificity of 100%. Positive and negative predictive values were high at 100% and 96%, respectively. However, for the diagnosis of pre-diabetes the sensitivity of glycated haemoglobin was low at 64% as were the specificity (53%) and the positive predictive values (37%). Glycated haemoglobin overdiagnosed pre-diabetes (52% vs 30%, p enrolled in cardiac rehabilitation, and glycated haemoglobin over-diagnoses pre-diabetes in comparison with the oral glucose tolerance test.

  17. Glycated haemoglobin may in future be reported as estimated mean blood glucose concentration--secondary publication

    DEFF Research Database (Denmark)

    Borg, R.; Nerup, J.; Nathan, D.M.

    2009-01-01

    Glycated haemoglobin (HbA 1c ) is widely used to determine levels of chronic glycaemia, to judge the adequacy of diabetes treatment and to adjust therapy. HbA 1c results are expressed as the percentage of HbA that is glycated. Day-to-day management is guided by self-monitoring of capillary glucose...... concentrations in mmol/l. The ADAG study determined the relationship between HbA 1c and average glucose concentration (AG) and concluded that for most patients with diabetes, HbA 1c can - with reasonable precision - be expressed as an estimated AG in the same units as self-monitoring Udgivelsesdato: 2009/11/2...

  18. Haemoglobin modulates NO emission and hyponasty under hypoxia-related stress in Arabidopsis thaliana

    DEFF Research Database (Denmark)

    Hebelstrup, Kim; van Zanten, Martijn; Mandon, Julien

    2012-01-01

    Nitric oxide (NO) and ethylene are signalling molecules that are synthesized in response to oxygen depletion. Non-symbiotic plant haemoglobins (Hbs) have been demonstrated to act in roots under oxygen depletion to scavenge NO. Using Arabidopsis thaliana plants, the online emission of NO or ethylene......-nitrosylated compounds, and it is demonstrated that hypoxia substantially increased the content of S-nitrosylated compounds. A parallel up-regulation of Hb gene expression in the normoxic shoots of the flooded plants may reflect signal transmission from root to shoot via ethylene and a role for Hb in the shoots. Hb gene...... was directly quantified under normoxia, hypoxia (0.1–1.0% O2), or full anoxia. The production of both gases was increased with reduced expression of either of the Hb genes GLB1 or GLB2, whereas NO emission decreased in plants overexpressing these genes. NO emission in plants with reduced Hb gene expression...

  19. Cation effects on haemoglobin aggregation: balance of chemisorption against physisorption of ions.

    Science.gov (United States)

    Parsons, Drew F; Duignan, Timothy T; Salis, Andrea

    2017-08-06

    A theoretical model of haemoglobin is presented to explain an anomalous cationic Hofmeister effect observed in protein aggregation. The model quantifies competing proposed mechanisms of non-electrostatic physisorption and chemisorption. Non-electrostatic physisorption is stronger for larger, more polarizable ions with a Hofmeister series Li(+) K(+) > Cs(+). We assess aggregation using second virial coefficients calculated from theoretical protein-protein interaction energies. Taking Cs(+) to not chemisorb, comparison with experiment yields mildly repulsive cation-carboxylate binding energies of 0.48 kBT for Li(+) and 3.0 kBT for K(+). Aggregation behaviour is predominantly controlled by short-range protein interactions. Overall, adsorption of the K(+) ion in the middle of the Hofmeister series is stronger than ions at either extreme since it includes contributions from both physisorption and chemisorption. This results in stronger attractive forces and greater aggregation with K(+), leading to the non-conventional Hofmeister series K(+) > Cs(+) ≈ Li(+).

  20. Haemoglobin C and S role in acquired immunity against Plasmodium falciparum malaria.

    Directory of Open Access Journals (Sweden)

    Federica Verra

    2007-10-01

    Full Text Available A recently proposed mechanism of protection for haemoglobin C (HbC; beta6Glu-->Lys links an abnormal display of PfEMP1, an antigen involved in malaria pathogenesis, on the surface of HbC infected erythrocytes together with the observation of reduced cytoadhesion of parasitized erythrocytes and impaired rosetting in vitro. We investigated the impact of this hypothesis on the development of acquired immunity against Plasmodium falciparum variant surface antigens (VSA encoding PfEMP1 in HbC in comparison with HbA and HbS carriers of Burkina Faso. We measured: i total IgG against a single VSA, A4U, and against a panel of VSA from severe malaria cases in human sera from urban and rural areas of Burkina Faso of different haemoglobin genotypes (CC, AC, AS, SC, SS; ii total IgG against recombinant proteins of P. falciparum asexual sporozoite, blood stage antigens, and parasite schizont extract; iii total IgG against tetanus toxoid. Results showed that the reported abnormal cell-surface display of PfEMP1 on HbC infected erythrocytes observed in vitro is not associated to lower anti- PfEMP1 response in vivo. Higher immune response against the VSA panel and malaria antigens were observed in all adaptive genotypes containing at least one allelic variant HbC or HbS in the low transmission urban area whereas no differences were detected in the high transmission rural area. In both contexts the response against tetanus toxoid was not influenced by the beta-globin genotype. These findings suggest that both HbC and HbS affect the early development of naturally acquired immunity against malaria. The enhanced immune reactivity in both HbC and HbS carriers supports the hypothesis that the protection against malaria of these adaptive genotypes might be at least partially mediated by acquired immunity against malaria.

  1. Altitude Exposure at 1800 m Increases Haemoglobin Mass in Distance Runners

    Directory of Open Access Journals (Sweden)

    Laura A. Garvican-Lewis, Iona Halliday, Chris R. Abbiss, Philo U. Saunders, Christopher J. Gore

    2015-06-01

    Full Text Available The influence of low natural altitudes (< 2000 m on erythropoietic adaptation is currently unclear, with current recommendations indicating that such low altitudes may be insufficient to stimulate significant increases in haemoglobin mass (Hbmass. As such, the purpose of this study was to determine the influence of 3 weeks of live high, train high exposure (LHTH at low natural altitude (i.e. 1800 m on Hbmass, red blood cell count and iron profile. A total of 16 elite or well-trained runners were assigned into either a LHTH (n = 8 or CONTROL (n = 8 group. Venous blood samples were drawn prior to, at 2 weeks and at 3 weeks following exposure. Hbmass was measured in duplicate prior to exposure and at 2 weeks and at 3 weeks following exposure via carbon monoxide rebreathing. The percentage change in Hbmass from baseline was significantly greater in LHTH, when compared with the CONTROL group at 2 (3.1% vs 0.4%; p = 0.01; and 3 weeks (3.0% vs -1.1%; p < 0.02, respectively following exposure. Haematocrit was greater in LHTH than CONTROL at 2 (p = 0.01 and 3 weeks (p = 0.04 following exposure. No significant interaction effect was observed for haemoglobin concentration (p = 0.06, serum ferritin (p = 0.43, transferrin (p = 0.52 or reticulocyte percentage (p = 0.16. The results of this study indicate that three week of natural classic (i.e. LHTH low altitude exposure (1800 m results in a significant increase in Hbmass of elite distance runners, which is likely due to the continuous exposure to hypoxia.

  2. Routine screening for α-thalassaemia using an immunochromatographic strip assay for haemoglobin Bart's.

    Science.gov (United States)

    Prayalaw, Patcharawadee; Fucharoen, Goonnapa; Fucharoen, Supan

    2014-09-01

    To evaluate an immunochromatographic (IC) strip assay for Hb Bart's as a routine screening test for α-thalassaemia in area with a high prevalence of thalassaemia and haemoglobinopathies. A total of 300 adult screen positive blood specimens were collected at an ongoing thalassaemia screening programme in northeast Thailand. Routine screening was done using red blood cell indices, osmotic fragility, and dichlorophenolindophenol tests. The IC strip assay for haemoglobin Bart's was performed on all samples. The result was evaluated against thalassaemia genotypes determined using standard haemoglobin and DNA analyses. Of 300 subjects investigated, Hb and DNA analyses identified 32 with normal genotype. The remaining subjects carried thalassaemia with as many as 16 different genotypes. Hb Bart's was detected in all cases, with several α(0)-thalassaemia (SEA type) related disorders. Of cases with α(+)-thalassaemia, 86.1% showed a positive result; 100 out of 103 Hb E carriers, all homozygous Hb E and β-thalassaemia trait were negative. Nine out of 17 cases with β-thalassaemia/Hb E disease, and one case of double heterozygote for Hb Q-Thailand and Hb E returned positive results. The overall sensitivity and specificity of the IC strip assay for detecting α(0)-thalassaemia were 100% and 73.1%, respectively. The results showed a high sensitivity for screening for α(0)-thalassaemia using IC strip assay for Hb Bart's. This simple method, used in combination with conventional screening protocols, should lead to a significant reduction in the number of referral cases for DNA analysis. Cost effectiveness in each population should be taken into consideration. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  3. Biological monitoring in workers in a nitrobenzene reduction plant: haemoglobin versus serum albumin adducts.

    Science.gov (United States)

    Thier, R; Lewalter, J; Selinski, S; Bolt, H M

    2001-09-01

    The high priority of monitoring workers exposed to nitrobenzene is a consequence of clear findings of experimental carcinogenicity of nitrobenzene and the associated evaluations by the International Agency for Research on Cancer. Eighty male employees of a nitrobenzene reduction plant, with potential skin contact with nitrobenzene and aniline, participated in a current medical surveillance programme. Blood samples were routinely taken and analysed for aniline, 4-aminodiphenyl (4-ADP) and benzidine adducts of haemoglobin (Hb) and human serum albumin (HSA). Also, levels of methaemoglobin (Met-Hb) and of carbon monoxide haemoglobin (CO-Hb) were monitored. Effects of smoking were straightforward. Using the rank sum test of Wilcoxon, we found that very clear-cut and statistically significant smoking effects (about 3-fold increases) were apparent on CO-Hb (P = 0.00085) and on the Hb adduct of 4-ADP (P = 0.0006). The mean aniline-Hb adduct level in smokers was 1.5 times higher than in non-smokers; the significance (P = 0.05375) was close to the 5% level. The strongest correlation was evident between the Hb and HSA adducts of aniline (r(s) = 0.846). Less pronounced correlations (but with P values aniline-Hb and 4-ADP-Hb adducts (r(s) = 0.388), between 4-ADP and 4-ADP-HSA adducts (r(s) = 0.373), and between 4-ADP-Hb and aniline-HSA adducts (r(s) = 0.275). In view of the proposal for additional use of the aniline-HSA adduct for biological monitoring, particularly in cases of acute overexposures or poisonings, the strong correlation of the Hb and HSA conjugates is noteworthy; the ratio aniline-HSA:aniline-Hb was 1:42 for the entire cohort.

  4. Haemoglobin, serum albumin and transferrin variants of Bali (Banteng) cattle, Bos (Bibos) javanicus.

    Science.gov (United States)

    Bell, K; McKenzie, H A; Shaw, D C

    1990-01-01

    1. Individual blood samples from 144 Bali (Banteng) cattle [Bos (Bibos) javanicus] in the Northern Territory of Australia and from 61 Bali cross cattle, were examined by zone electrophoresis to determine the variants of haemoglobin, serum albumin and transferrin that are present. 2. Of the common cattle haemoglobin variants (A and B) only variant B occurs in the Bali cattle samples. A second variant, designated CBali, occurs in Bali cattle either as the heterozygote (B CBali) or as the homozygote, the frequencies of occurrence indicating a two-allele system of inheritance without dominance. The CBali cross samples may exhibit the homozygous or heterozygous A variant. 3. The CBali variant has an electrophoretic mobility intermediate between those of the A and B variants at pH 8.6 and 9.1 but closer to B than to A (B greater than C greater than A). It appears to be similar in mobility to the C variants found in Indian Khillan (CKhillan) by Naik, Sukumaran and Sanghvi (Anim. Prodn, 1965 I, 275-277), and in Asian cattle by Oishi, Abe and Namikama (Immunogenet. Lett., 1968 5, 170-173) and Abe, Mogi, Oishi, Tanaka and Suzuki (Proc. XIIth Europ. Conf. Anim. Blood Groups Biochem. Polymorphisms 1972, pp. 225-228), but appreciably different from those in Kenyan and Rhodesian cattle (CRhodesia) found by Braend (Anim. Blood Grps Biochem. Genet., 1971 2, 15-21) and Carr (Rhod. J. agric. Res., 1964 3, 62-62A), respectively. It is also different in mobility from the C variant found by Winter, Mayr, Schleger, Dworak, Krutzler and Burger (Res. vet. Sci., 1984 36, 276-283) in the mithun.(ABSTRACT TRUNCATED AT 250 WORDS)

  5. Fetal Haemoglobin and β-globin Gene Cluster Haplotypes among Sickle Cell Patients in Chhattisgarh.

    Science.gov (United States)

    Bhagat, Sanjana; Patra, Pradeep Kumar; Thakur, Amar Singh

    2013-02-01

    Foetal Haemoglobin (HbF) is the best-known genetic modulator of sickle cell anaemia, which varies dramatically in concentration in the blood of these patients. The patients with SCA display a remarkable variability in the disease severity. High HbF levels and the β-globin gene cluster haplotypes influence the clinical presentation of sickle cell disease. To identify the genetic modifiers which influence the disease severity, we conducted a β-globin haplotype analysis in the sickle cell disease patients of Chhattisgarh. The foetal haemoglobin and the β-globin gene haplotypes of the sickle cell trait and the sickle cell disease patients from Chhattisgarh were investigated. A total of 100 sickle cell patients (SS), 50 sickle cell trait patients (AS) and 50 healthy control individuals were included in the present study. The distribution of the β-globin gene haplotype was done by the PCR-RFLP method. PCR-RFLP showed that the homozygous Arab-Indian haplotype (65%) was the most frequent one, followed by the heterozygous Arab-Indian haplotype (11%) in the sickle cell patients (SS), while the AS patients had a higher frequency of the heterozygous Arab-Indian haplotype (38%) in comparison to homozygous one (32%). Four atypical haplotypes, 3 Benin and 1 Cameroon were also observed, although they were in lower frequencies. In the present study, the HbF levels were higher in the AS and the SS patients, with one or two Arab-Indian haplotypes as compared to the other haplotypes. The presence of the Arab-Indian haplotype as the predominant haplotype might be suggestive of a gene flow to/from Saudi-Arabia or India and it was associated with higher HbF levels and a milder disease severity.

  6. Haemoglobin C and S role in acquired immunity against Plasmodium falciparum malaria.

    Science.gov (United States)

    Verra, Federica; Simpore, Jacques; Warimwe, George M; Tetteh, Kevin K; Howard, Tevis; Osier, Faith H A; Bancone, Germana; Avellino, Pamela; Blot, Isa; Fegan, Greg; Bull, Peter C; Williams, Thomas N; Conway, David J; Marsh, Kevin; Modiano, David

    2007-10-03

    A recently proposed mechanism of protection for haemoglobin C (HbC; beta6Glu-->Lys) links an abnormal display of PfEMP1, an antigen involved in malaria pathogenesis, on the surface of HbC infected erythrocytes together with the observation of reduced cytoadhesion of parasitized erythrocytes and impaired rosetting in vitro. We investigated the impact of this hypothesis on the development of acquired immunity against Plasmodium falciparum variant surface antigens (VSA) encoding PfEMP1 in HbC in comparison with HbA and HbS carriers of Burkina Faso. We measured: i) total IgG against a single VSA, A4U, and against a panel of VSA from severe malaria cases in human sera from urban and rural areas of Burkina Faso of different haemoglobin genotypes (CC, AC, AS, SC, SS); ii) total IgG against recombinant proteins of P. falciparum asexual sporozoite, blood stage antigens, and parasite schizont extract; iii) total IgG against tetanus toxoid. Results showed that the reported abnormal cell-surface display of PfEMP1 on HbC infected erythrocytes observed in vitro is not associated to lower anti- PfEMP1 response in vivo. Higher immune response against the VSA panel and malaria antigens were observed in all adaptive genotypes containing at least one allelic variant HbC or HbS in the low transmission urban area whereas no differences were detected in the high transmission rural area. In both contexts the response against tetanus toxoid was not influenced by the beta-globin genotype. These findings suggest that both HbC and HbS affect the early development of naturally acquired immunity against malaria. The enhanced immune reactivity in both HbC and HbS carriers supports the hypothesis that the protection against malaria of these adaptive genotypes might be at least partially mediated by acquired immunity against malaria.

  7. Post-surgical wound management of pilonidal cysts with a haemoglobin spray: a case series.

    Science.gov (United States)

    Mustafi, N; Engels, P

    2016-04-01

    Painful acute cysts in the natal cleft or lower back, known as pilonidal sinus disease, are a severe burden to many younger patients. Although surgical intervention is the preferred first line treatment, postsurgical wound healing disturbances are frequently reported due to infection or other complications. Different treatment options of pilonidal cysts have been discussed in the literature, however, no standardised guideline for the postsurgical wound treatment is available. After surgery, a common recommended treatment to patients is rinsing the wound with clean water and dressing with a sterile compress. We present a case series of seven patients with wounds healing by secondary intention after surgical intervention of a pilonidal cyst. The average age of the patients was 40 years old. Of the seven patients, three had developed a wound healing disturbance, one wound had started to develop a fibrin coating and three were in a good condition. The applied wound care regimens comprised appropriate mechanical or autolytic debridement, rinsing with an antimicrobial solution, haemoglobin application, and primary and secondary dressings. In all seven cases a complete wound closure was achieved within an average of 76 days with six out of seven wounds achieving wound closure within 23-98 days. Aesthetic appearance was deemed excellent in five out of seven cases excellent and acceptable in one. Treatment of one case with a sustained healing disturbance did result in wound closure but with a poor aesthetic outcome and an extensive cicatrisation of the new tissue. Based on these results we recommend that to avoid healing disturbances of wounds healing by secondary intention after surgical pilonidal cyst intervention, an adequate wound care regime comprising appropriate wound debridement, rinsing, topically applied haemoglobin and adequate wound dressing is recommendable as early as possible after surgery.

  8. Nitric oxide-fixation by non-symbiotic haemoglobin proteins in Arabidopsis thaliana under N-limited conditions.

    Science.gov (United States)

    Kuruthukulangarakoola, Gitto Thomas; Zhang, Jiangli; Albert, Andreas; Winkler, Barbro; Lang, Hans; Buegger, Franz; Gaupels, Frank; Heller, Werner; Michalke, Bernhard; Sarioglu, Hakan; Schnitzler, Jörg-Peter; Hebelstrup, Kim Henrik; Durner, Jörg; Lindermayr, Christian

    2017-01-01

    Nitric oxide (NO) is an important signalling molecule that is involved in many different physiological processes in plants. Here, we report about a NO-fixing mechanism in Arabidopsis, which allows the fixation of atmospheric NO into nitrogen metabolism. We fumigated Arabidopsis plants cultivated in soil or as hydroponic cultures during the whole growing period with up to 3 ppmv of NO gas. Transcriptomic, proteomic and metabolomic analyses were used to identify non-symbiotic haemoglobin proteins as key components of the NO-fixing process. Overexpressing non-symbiotic haemoglobin 1 or 2 genes resulted in fourfold higher nitrate levels in these plants compared with NO-treated wild-type. Correspondingly, rosettes size and weight, vegetative shoot thickness and seed yield were 25, 40, 30, and 50% higher, respectively, than in wild-type plants. Fumigation with 250 ppbv 15 NO confirmed the importance of non-symbiotic haemoglobin 1 and 2 for the NO-fixation pathway, and we calculated a daily uptake for non-symbiotic haemoglobin 2 overexpressing plants of 250 mg N/kg dry weight. This mechanism is probably important under conditions with limited N supply via the soil. Moreover, the plant-based NO uptake lowers the concentration of insanitary atmospheric NOx, and in this context, NO-fixation can be beneficial to air quality. © 2016 The Authors Plant, Cell & Environment Published by John Wiley & Sons Ltd.

  9. Paradoxical correlation between signal in functional magnetic resonance imaging and deoxygenated haemoglobin content in capillaries: a new theoretical explanation

    Science.gov (United States)

    Yamamoto, Toru; Kato, Toshinori

    2002-04-01

    Signal increases in functional magnetic resonance imaging (fMRI) are believed to be a result of decreased paramagnetic deoxygenated haemoglobin (deoxyHb) content in the neural activation area. However, discrepancies in this canonical blood oxygenation level dependent (BOLD) theory have been pointed out in studies using optical techniques, which directly measure haemoglobin changes. To explain the discrepancies, we developed a new theory bridging magnetic resonance (MR) signal and haemoglobin changes. We focused on capillary influences, which have been neglected in most previous fMRI studies and performed a combined fMRI and near-infrared spectroscopy (NIRS) study using a language task. Paradoxically, both the MR signal and deoxyHb content increased in Broca's area. On the other hand, fMRI activation in the auditory area near large veins correlated with a mirror-image decrease in deoxyHb and increase in oxygenated haemoglobin (oxyHb), in agreement with canonical BOLD theory. All fMRI signal changes correlated consistently with changes in oxyHb, the diamagnetism of which is insensitive to MR. We concluded that the discrepancy with the canonical BOLD theory is caused by the fact that the BOLD theory ignores the effect of the capillaries. Our theory explains the paradoxical phenomena of the oxyHb and deoxyHb contributions to the MR signal and gives a new insight into the precise haemodynamics of activation by analysing fMRI and NIRS data.

  10. Paradoxical correlation between signal in functional magnetic resonance imaging and deoxygenated haemoglobin content in capillaries: a new theoretical explanation

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Toru [College of Medical Technology, Hokkaido University, Sapporo (Japan)]. E-mail: yamamoto@cme.hokudai.ac.jp; Kato, Toshinori [Center for Magnetic Resonance Research, University of Minnesota Medical School, Minneapolis, MN (US) and Ogawa Laboratories for Brain Function Research, Hamano Life Science Research Foundation, Shinjuku-ku, Tokyo (Japan)]. E-mail: kato@hlsrf.or.jp

    2002-04-01

    Signal increases in functional magnetic resonance imaging (fMRI) are believed to be a result of decreased paramagnetic deoxygenated haemoglobin (deoxyHb) content in the neural activation area. However, discrepancies in this canonical blood oxygenation level dependent (BOLD) theory have been pointed out in studies using optical techniques, which directly measure haemoglobin changes. To explain the discrepancies, we developed a new theory bridging magnetic resonance (MR) signal and haemoglobin changes. We focused on capillary influences, which have been neglected in most previous fMRI studies and performed a combined fMRI and near-infrared spectroscopy (NIRS) study using a language task. Paradoxically, both the MR signal and deoxyHb content increased in Broca's area. On the other hand, fMRI activation in the auditory area near large veins correlated with a mirror-image decrease in deoxyHb and increase in oxygenated haemoglobin (oxyHb), in agreement with canonical BOLD theory. All fMRI signal changes correlated consistently with changes in oxyHb, the diamagnetism of which is insensitive to MR. We concluded that the discrepancy with the canonical BOLD theory is caused by the fact that the BOLD theory ignores the effect of the capillaries. Our theory explains the paradoxical phenomena of the oxyHb and deoxyHb contributions to the MR signal and gives a new insight into the precise haemodynamics of activation by analysing fMRI and NIRS data. (author)

  11. Effects of Rambutan Peel Extract to The Number of Erythrocytes and Haemoglobin in Rats Exposed to Cigarette Smoke

    Science.gov (United States)

    Lisdiana; Dewi, F. K.

    2017-04-01

    Cigarette smoke is one of the exogenous free radicals sources. When it is inhaled, its activity may damage the structure of erythrocyte membrane function. The impacts of free radicals can be reduced through the provision of antioxidants. Rambutan fruit peel contains the phenolic compound in the form of polyphenols that are antioxidants. The purpose of this study is to determine the effect of rambutan fruit peel extracts to the number of erythrocytes and haemoglobin in rats exposed to cigarette smoke. This design used Post Test Control Group Design. A sample of 25 rats was divided into five groups, each group consisting of 5 rats. The positive control group (K+) were given a standard food and drinking water. The negative control group (K) by three cigarettes, the treatment group (KP1, KP2, KP3) by three cigarettes and skin extract of rambutan each treatment group with a dose 15 mg/kg, 30 mg/kg and 45 mg/kg for 30 days. Data on the number of erythrocytes and haemoglobin in rat blood was analysed with LSD and to determine the optimum dosage was analysed by using regression test. Research results shown that the content of rambutan fruit peel extract may increase the number of erythrocytes and haemoglobin of blood. Conclusions from this research are the rambutan fruit peel extract at a dose of 45 mg/kg body weight can increase and maintain the number of erythrocytes and haemoglobin in the blood of rat exposed to cigarette smoke.

  12. A multidisciplinary approach for improving services in primary care: randomised controlled trial of screening for haemoglobin disorders

    OpenAIRE

    Modell, Michael; Wonke, Beatrix; Anionwu, Elizabeth; Khan, Maren; Tai, Sharon See; Lloyd, Michael; Modell, Bernadette

    1998-01-01

    Objective: To investigate the feasibility of improving screening for carriers of haemoglobin disorders in general practice by using a nurse facilitator to work with primary care teams and the relevant haematology laboratories; to identify problems in communication between all those involved in delivering the service, and to implement solutions.

  13. Association between glycated haemoglobin and the risk of congestive heart failure in diabetes mellitus : systematic review and meta-analysis

    NARCIS (Netherlands)

    Erqou, Sebhat; Lee, Chee-Tin Christine; Suffoletto, Matthew; Echouffo-Tcheugui, Justin B.; de Boer, Rudolf A.; van Melle, Joost P.; Adler, Amanda I.

    Clinical trials to date have not provided definitive evidence regarding the effects of glucose lowering on the incidence of congestive heart failure (CHF). We synthesized available prospective epidemiological data on the association between glycaemia measured by haemoglobin A(1c) (HbA(1c)) and

  14. The importance of pre-treatment haemoglobin level in inoperable non-small cell lung carcinoma treated with radical radiotherapy.

    NARCIS (Netherlands)

    Langendijk, H.; Jong, de J.; Wanders, R; Lambin, P; Slotman, B.J.

    2003-01-01

    BACKGROUND AND PURPOSE: The purpose of this study was to evaluate the prognostic significance of the pre-treatment haemoglobin level among patients with inoperable non-small cell lung carcinoma (NSCLC) treated with definitive radiotherapy with regard to loco-regional tumour control (LC) and overall

  15. The importance of pre-treatment haemoglobin level in inoperable non-small cell lung carcinoma treated with radical radiotherapy.

    NARCIS (Netherlands)

    Langendijk, H.; de Jong, J.; Wanders, R; Lambin, P; Slotman, B.J.

    2003-01-01

    Background and purpose: The purpose of this study was to evaluate the prognostic significance of the pre-treatment haemoglobin level among patients with inoperable non-small cell lung carcinoma (NSCLC) treated with definitive radiotherapy with regard to loco-regional tumour control (LC) and overall

  16. Recombinant vs native Anisakis haemoglobin (Ani s 13): Its appraisal as a new gold standard for the diagnosis of allergy.

    Science.gov (United States)

    González-Fernández, Juan; Rivas, Luis; Luque-Ortega, Juan Román; Núñez-Ramírez, Rafael; Campioli, Pamela; Gárate, Teresa; Perteguer, María J; Daschner, Alvaro; Cuéllar, Carmen

    2017-10-01

    Recombinant allergens are currently the best option for serodiagnosis of human anisakiasis in terms of sensitivity and specificity. However, previous reports showed high rates of anisakiasis patients who were negative to Ani s 7 and especially to Ani s 1. Recently, Anisakis haemoglobin was described as a major allergen (Ani s 13). Although Ani s 13 belongs to a conserved protein family, it seems not to be a cross-reacting antigen because of the absence of IgE recognition against Ascaris haemoglobin in Anisakis patients. The aim of this study is to develop a more sensitive and specific diagnosis tool for Anisakis based on the recently discovered allergen Ani s 13. We obtained and purified recombinant Anisakis haemoglobin (rAni s 13) and the native form (nAni s 13). The recognition of both recombinant and native haemoglobins by anti-haemoglobin IgE from patients' sera was assessed by indirect ELISA and immunoblotting using 43 Anisakis sensitised patients and 44 non-Anisakis sensitised patients. Native Ani s 13 was also treated with periodate to study if oxidation of glycans destroys antibody binding. Furthermore, it was structurally characterised by negative staining electron microscopy and analytical ultracentrifugation. Recombinant Ani s 13 was only recognised by four patients with gastro-allergic anisakiasis (GAA) and immunoblotting analyses showed no bands. However, nAni s 13 was detected by 72.1% of Anisakis sensitised patients measured by indirect ELISA. Particularly, 18 (90%) out of 20 GAA patients were positive. Tetramers and octamers were the most abundant homomers of nAni s 13 but octamers had higher content of bound heme. None of the non-Anisakis sensitised patients were positive. Combined use of purified native form of Ani s 13 with current gold standards would improve the sensitivity and specificity for diagnosing anisakiasis. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Randomised feasibility study of a more liberal haemoglobin trigger for red blood cell transfusion compared to standard practice in anaemic cancer patients treated with chemotherapy

    DEFF Research Database (Denmark)

    Yakymenko, D.; Frandsen, K. B.; Christensen, I. J.

    2017-01-01

    Objectives: The primary objective of this feasibility study was to identify quality of life (QoL) scores and symptom scales as tools for measuring patient-reported outcomes (PRO) associated with haemoglobin level in chemotherapy-treated cancer patients. Secondary objectives included comparing Qo...... to a haemoglobin trigger for RBCT of either7gdL-1 (arm A) or... Status (PS). The association between haemoglobin and PRO variables was assessed using a linear mixed model with random effects. Results: A total of 133 patients were enrolled, of which 86 patients received RBCT (28 in arm A, 58 in arm B). Baseline questionnaires were filled out in 79·7% of cases...

  18. Variation in haemoglobin measurement across different HemoCue devices and device operators in rural Cambodia.

    Science.gov (United States)

    Rappaport, Aviva I; Barr, Susan I; Green, Timothy J; Karakochuk, Crystal D

    2017-07-01

    : Point-of-use haemoglobinometers, such as the HemoCue, are a common method to measure haemoglobin (Hb) concentration in field settings as the device is portable, requires only a small finger-prick capillary blood sample and computes an immediate Hb reading. The aim of this study was to compare Hb measurements across different HemoCue devices and across device operators using capillary blood samples collected from women during a trial in rural Cambodia. We compared mean±SD capillary Hb concentration (g/L) across n=12 different HemoCue Hb 301 devices and across n=9 device operators among 2846 Cambodian women. Significant variability in mean Hb concentration was observed across HemoCue devices (means ranged from 117 to 124 g/L) and across device operators (means ranged from 118 to 124 g/L). This variability is of particular concern when a single HemoCue device or device operator is used at different time points in surveys or research trials. NCT02481375. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  19. Relations between haemoglobin mass, cardiac dimensions and aerobic capacity in endurance trained cyclists.

    Science.gov (United States)

    Ahlgrim, C; Pottgiesser, T; Kron, J; Duerr, H; Baumstark, M; Schumacher, Y O

    2009-12-01

    Chronic endurance exercise triggers increased cardiac dimensions, blood volumes and haemoglobin mass (Hb mass). Cardiac output and Hb mass are considered as independent contributors to aerobic performance. Therefore, increased Hb mass could counterbalance for a relative deficiency in cardiac adaptation. The purpose of the present study is to investigate relations between Hb mass and cardiac dimensions in a group of endurance athletes with respect to aerobic capacity. Two groups of highly trained cyclists featuring high (HHB group, N.=13) and low (LHB group, N.=13) Hb mass (measured by a CO-rebreathing method) were compared for measures of aerobic performance, cardiac wall thickness, cavity size and left ventricular mass (determined by 2-D-echocardiography). Lean body mass (LBM) was chosen as anthropometrical reference for Hb mass. HHB featured higher cardiac wall thickness than LHB, but no difference appeared in cardiac cavity size, left ventricular mass and the performance parameters. Normalising Hb mass for body weight instead of LBM improved correlations between Hb mass and performance parameters. Our data provides new evidence for a connection between cardiac wall thickness and Hb mass in endurance athletes but no further evidence for a counterbalance between Hb mass and cardiac adaptation was found. Moreover, we postulate that Hb mass loses predictive value for aerobic performance when normalised for LBM.

  20. Non-invasive prenatal detection of haemoglobin Bart's disease by cardiothoracic ratio during the first trimester.

    Science.gov (United States)

    Zhen, Li; Pan, Min; Han, Jin; Yang, Xin; Ou, Yan-Mei; Liao, Can; Li, Dong-Zhi

    2015-10-01

    To evaluate the efficacy of the sonographic cardiothoracic ratio (CTR) in early pregnancy for the prediction of fetal haemoglobin (Hb) Bart's disease. Over a 1.5-year period at a Chinese tertiary obstetric centre, women at risk of Hb Bart's disease were given the option of a non-invasive approach to exclude an affected pregnancy between 11 weeks and 13 weeks and 6 days of gestation, with a routine rescan after a 2-week interval. The fetal CTR, a sonographic marker, was assessed, and invasive testing followed in cases of fetal cardiomegaly. The diagnosis of fetal Hb Bart's disease was based on DNA analysis from chorionic villus sampling. Of 154 at-risk cases studied, five cases (four at 11 weeks of gestation) were subjected to direct invasive testing because of an unsatisfactory scan. Of the remaining 149 cases, non-invasive ultrasound examinations were performed successfully. Thirty-four (22.8%) affected pregnancies were revealed, including one picked up on rescan. The sensitivity and specificity of the non-invasive approach were 97.1% and 100%, respectively. The need for an invasive test was reduced by 74.7%, and all affected pregnancies except one were diagnosed before 14 weeks of gestation. CTR can differentiate reliably between pregnancies with and without Hb Bart's disease. This non-invasive approach for the exclusion of Hb Bart's disease can be used in early pregnancy. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  1. Iron from haemoglobin and haemin modulates nucleotide hydrolysis in Trichomonas vaginalis.

    Science.gov (United States)

    Vieira, Patrícia de Brum; Silva, Nícolas Luiz Feijó; Kist, Luiza Wilges; Oliveira, Giovanna Medeiros Tavares de; Bogo, Maurício Reis; Carli, Geraldo Atillio de; Macedo, Alexandre José; Tasca, Tiana

    2015-04-01

    Extracellular ATP may act as a danger signalling molecule, inducing inflammation and immune responses in infection sites. The ectonucleotidases NTPDase and ecto-5'-nucleotidase are enzymes that modulate extracellular nucleotide levels; these enzymes have been previously characterised in Trichomonas vaginalis. Iron plays an important role in the complex trichomonal pathogenesis. Herein, the effects of iron on growth, nucleotide hydrolysis and NTPDase gene expression in T. vaginalis isolates from female and male patients were evaluated. Iron from different sources sustained T. vaginalis growth. Importantly, iron from haemoglobin (HB) and haemin (HM) enhanced NTPDase activity in isolates from female patients and conversely reduced the enzyme activity in isolates from male patients. Iron treatments could not alter the NTPDase transcript levels in T. vaginalis. Furthermore, our results reveal a distinct ATP, ADP and AMP hydrolysis profile between isolates from female and male patients influenced by iron from HB and HM. Our data indicate the participation of NTPDase and ecto-5'-nucleotidase in the establishment of trichomonas infection through ATP degradation and adenosine production influenced by iron.

  2. Iron from haemoglobin and haemin modulates nucleotide hydrolysis in Trichomonas vaginalis

    Directory of Open Access Journals (Sweden)

    Patrícia de Brum Vieira

    2015-04-01

    Full Text Available Extracellular ATP may act as a danger signalling molecule, inducing inflammation and immune responses in infection sites. The ectonucleotidases NTPDase and ecto-5’-nucleotidase are enzymes that modulate extracellular nucleotide levels; these enzymes have been previously characterised in Trichomonas vaginalis. Iron plays an important role in the complex trichomonal pathogenesis. Herein, the effects of iron on growth, nucleotide hydrolysis and NTPDase gene expression in T. vaginalis isolates from female and male patients were evaluated. Iron from different sources sustained T. vaginalis growth. Importantly, iron from haemoglobin (HB and haemin (HM enhanced NTPDase activity in isolates from female patients and conversely reduced the enzyme activity in isolates from male patients. Iron treatments could not alter the NTPDase transcript levels in T. vaginalis. Furthermore, our results reveal a distinct ATP, ADP and AMP hydrolysis profile between isolates from female and male patients influenced by iron from HB and HM. Our data indicate the participation of NTPDase and ecto-5’-nucleotidase in the establishment of trichomonas infection through ATP degradation and adenosine production influenced by iron.

  3. Molecular and clinical analysis of haemoglobin Lepore in Campania, a region of Southern Italy.

    Science.gov (United States)

    Ricchi, Paolo; Ammirabile, Massimiliano; Spasiano, Anna; Costantini, Silvia; Di Matola, Tiziana; Cinque, Patrizia; Saporito, Caterina; Filosa, Aldo; Pagano, Leonilde

    2017-08-01

    To date in Italy, there is paucity on data about the prevalence, clinical and haematological features of patients carrying the haemoglobin (Hb) Lepore variant in homozygous or in association with other haemoglobinopathies. Here we report the results of a retrospective analysis on 33 patients from Campania, a region of Southern Italy, historically followed at 'UOSD Malattie Rare del Globulo Rosso' of Cardarelli hospital, Naples, Italy. We described 33 patients carrying the Hb Lepore variant: 21 compound heterozygotes with a common thalassaemia allele, six patients with homozygous state for Hb Lepore, five patients with Hb Lepore/Hb S and one patient with Hb Lepore/Hb Neapolis were identified. All individuals carried haplotype I or V. These thalassaemic patients showed different phenotypes ranging from severe disease with early blood transfusion dependency to moderate form of thalassaemia intermedia. In most cases, thalassaemia mutation type determined the severity of the disease. A great variability of clinical phenotype among the same genotypes was also observed suggesting the presence of unknown genetic modifiers acting in combination with Hb Lepore.

  4. Bovine colostrum supplementation does not affect plasma buffer capacity or haemoglobin content in elite female rowers.

    Science.gov (United States)

    Brinkworth, Grant D; Buckley, Jonathan D

    2004-03-01

    It has been reported that bovine colostrum (BC) supplementation improves buffer capacity (beta) during exercise, but whether the improvement results from changes in tissue and/or blood buffer systems has not been determined. The purpose of the present study was to examine the effect of supplementation with BC on blood buffer systems. Thirteen elite females rowers were supplemented with 60 g.day(-1) of either BC ( n=6) or whey protein (WP, n=7) during 9 weeks of pre-competition training in a randomised, double-blind, placebo-controlled, parallel design. All subjects undertook the study as a group and completed the same training program. Resting haemoglobin (Hb) concentration and plasma buffer capacity (pbeta) (determined by titration with HCl) were measured pre- and post-supplementation. There were no differences in macronutrient intakes ( P>0.56) or training volumes ( P>0.99) between BC and WP during the study period. There were no differences in Hb [BC 13.28 (0.28) mg.dl(-1), WP 13.70 (0.26) mg.dl(-1); P=0.45] or pbeta [BC 14.8 (1.1) nmol HCl.ml(-1).pH(-1), WP 14.8 (0.5) nmol HCl.ml(-1).pH(-1); P=0.68] between groups at week 0. pbeta increased in both groups during the study period ( Pbuffer capacity that result from BC supplementation.

  5. Characterization of Spbhp-37, a haemoglobin-binding protein of Streptococcus pneumoniae

    Directory of Open Access Journals (Sweden)

    María Elena eRomero-Espejel

    2016-05-01

    Full Text Available Streptococcus pneumoniae is a Gram-positive microorganism that is the cause of bacterial pneumonia, sinusitis and otitis media. This human pathogen also can cause invasive diseases such as meningitis, bacteremia and septicemia. Haemoglobin (Hb and haem can support the growth and viability of S. pneumoniae as sole iron sources. Unfortunately, the acquisition mechanism of Hb and haem in this bacterium has been poorly studied. Previously we identified two proteins of 37 and 22 kDa as putative Hb- and haem-binding proteins (Spbhp-37 and Spbhp-22, respectively. The sequence of Spbhp-37 protein was database annotated as lipoprotein without any function or localization. Here it was immunolocalized in the surface cell by transmission electron microscopy using specific antibodies produced against the recombinant protein. The expression of Spbhp-37 was increased when bacteria were grown in media culture supplied with Hb. In addition, the affinity of Sphbp-37 for Hb was determined. Thus, in this work we are presenting new findings that attempt to explain the mechanism involved in iron acquisition of this pathogen. In the future these results could help to develop new therapy targets in order to avoid the secondary effects caused by the traditional therapies.

  6. Thermal fluctuations of haemoglobin from different species: adaptation to temperature via conformational dynamics

    Science.gov (United States)

    Stadler, A. M.; Garvey, C. J.; Bocahut, A.; Sacquin-Mora, S.; Digel, I.; Schneider, G. J.; Natali, F.; Artmann, G. M.; Zaccai, G.

    2012-01-01

    Thermodynamic stability, configurational motions and internal forces of haemoglobin (Hb) of three endotherms (platypus, Ornithorhynchus anatinus; domestic chicken, Gallus gallus domesticus and human, Homo sapiens) and an ectotherm (salt water crocodile, Crocodylus porosus) were investigated using circular dichroism, incoherent elastic neutron scattering and coarse-grained Brownian dynamics simulations. The experimental results from Hb solutions revealed a direct correlation between protein resilience, melting temperature and average body temperature of the different species on the 0.1 ns time scale. Molecular forces appeared to be adapted to permit conformational fluctuations with a root mean square displacement close to 1.2 Å at the corresponding average body temperature of the endotherms. Strong forces within crocodile Hb maintain the amplitudes of motion within a narrow limit over the entire temperature range in which the animal lives. In fully hydrated powder samples of human and chicken, Hb mean square displacements and effective force constants on the 1 ns time scale showed no differences over the whole temperature range from 10 to 300 K, in contrast to the solution case. A complementary result of the study, therefore, is that one hydration layer is not sufficient to activate all conformational fluctuations of Hb in the pico- to nanosecond time scale which might be relevant for biological function. Coarse-grained Brownian dynamics simulations permitted to explore residue-specific effects. They indicated that temperature sensing of human and chicken Hb occurs mainly at residues lining internal cavities in the β-subunits. PMID:22696485

  7. Haemoglobin s interaction with Beta thalassaemia- a case report from assam, India.

    Science.gov (United States)

    Pathak, Mauchumi Saikia; Borah, Monalisha Saikia; Kalita, Dulal

    2014-09-01

    Interaction of Hb S with beta thalassaemia is being reported here as this type of case is rare. Hb S (β6 glu→val) is a genetic disorder which occurs due to beta globin gene mutation of haemoglobin. In India, the Hb S is prevalent in the central part, in the eastern, western and southern tribal belt regions and among the tea tribe communities of Assam. The Hb S carriers (Sickle cell trait) leads a normal life but the Sickle cell disease patients show certain clinical manifestation like joint pain, anaemia and jaundice. The HPLC report of the patient showed Compound heterozygous for Hb S- β thalassaemia. The complete blood count was measured in automated haematology analyser. Mutational pattern of the beta thalassaemia as well as the presence of Hb S gene was detected by PCR. The case showed severe clinical manifestations and transfusion was required due to inheritance of the IVS 1-5 G →C β- thalassaemia mutation with the Hb S gene.

  8. The adaptation of polar fishes to climatic changes: Structure, function and phylogeny of haemoglobin.

    Science.gov (United States)

    Verde, Cinzia; Giordano, Daniela; di Prisco, Guido

    2008-01-01

    In the Antarctic, fishes of dominant suborder Notothenioidei have evolved in a unique thermal scenario. Phylogenetically related taxa of the suborder live in a wide range of latitudes, in Antarctic, sub-Antarctic and temperate oceans. Consequently, they offer a remarkable opportunity to study the physiological and biochemical characters gained and, conversely, lost during their evolutionary history. The evolutionary perspective has also been pursued by comparative studies of some features of the heme protein devoted to O(2) transport in fish living in the other polar region, the Arctic. The two polar regions differ by age and isolation. Fish living in each habitat have undergone regional constraints and fit into different evolutionary histories. The aim of this contribution is to survey the current knowledge of molecular structure, functional features, phylogeny and adaptations of the haemoglobins of fish thriving in the Antarctic, sub-Antarctic and Arctic regions (with some excursions in the temperate latitudes), in search of insights into the convergent processes evolved in response to cooling. Current climate change may disturb adaptation, calling for strategies aimed at neutralising threats to biodiversity.

  9. Haemoglobin level in relation to vitamin D status in infants and toddlers

    Directory of Open Access Journals (Sweden)

    Mitić Jadranka

    2016-01-01

    Full Text Available Introduction: Vitamin D Deficiency (VDD is defined as the level of 25(OHD in the serum < 30 ng/ml. According to the contemporary research, even the slight vitamin D deficiency can adversely affect our body in many ways. Numerous studies indicate that vitamin D deficiency is very common in children. The study aimed to research the frequency of vitamin D deficiency in infants and toddlers, the connection between VDD and iron deficiency anemia (IDA, as well as the correlation between 25-hydroxycholecalciferol (25(OHD and haemoglobin (Hb in the examinees. Method: The study includes 150 children, 73 (49% newborns and 77 (51% infants. Vitamin D status was determined through the amount of 25(OHD in blood, using the electrochemiluminescence. Results: Vitamin D Deficiency was found in 58% of infants and toddlers (severe vitamin D deficiency was found in 16% of examinees, vitamin D deficiency was found in 23% of examinees, while vitamin D insufficiency was found in 19% of examinees. Vitamin D deficiency (VDD and anaemia were found in 80% of examined infants and toddlers. VDD was found in 49% of newborns that were not anaemic. We have observed the substantial difference between the examinees suffering from both anaemia and VDD and the examinees suffering from VDD only. Conclusion: The highest level on anaemia was found in the children with severe vitamin D deficiency, while in the examined infants and toddlers, there was a connection between the level of 25(OHD and Hb in the serum.

  10. [Trauma bay haemoglobin level. Predictor of coagulation disorder in major trauma].

    Science.gov (United States)

    Hilbert, P; Hofmann, G O; Lefering, R; Struck, M F

    2015-07-01

    Trauma-induced coagulopathy is common in patients with major trauma and requires early and appropriate treatment for bleeding control. Even in emergency laboratory, the availability of standard coagulation tests is associated with certain latencies and devices for viscoelastic haemostasis diagnosis (thromboelastometry) are not routinely established in major trauma centres. We searched for a laboratory parameter with fast availability by point of care blood gas analysis and reliable correlation with coagulation parameters. We analyzed the trauma patients of a single level one trauma centre from 2005-2011 and particularly evaluated the correlation between haemoglobin (Hb) and coagulation parameters and the correlation of Hb and parameters indicating tissue perfusion. All patients who were directly admitted from the scene of an accident to the trauma centre had an injury severity score (ISS) > 9, had a complete revised injury severity classification (RISC) and blood samples that were taken in the emergency department (ED) immediately after admission were included. Correlations were tested using the Pearson test (r) with a two-tailed significance level of p trauma population. These data suggest that especially severely injured trauma patients with persistent bleeding might benefit from an Hb-based algorithm for early correction of coagulation disorders. Further studies with larger trauma populations are required to confirm our findings.

  11. Características fenotípicas de células T linfocitarias de tipo regulador (Treg presentes en el hígado de pacientes con infección crónica por VHB

    Directory of Open Access Journals (Sweden)

    Danely Velázquez

    2012-07-01

    Full Text Available El virus de la hepatitis B (VHB puede generar daños irreversibles en el hígado. En este trabajo se caracterizaron las poblaciones de células T reguladoras infiltrantes del hígado, en biopsias hepáticas de sujetos con infección crónica por el VHB. Se evidenció un incremento significativo (p< 0,05 del número de células T CD4+ que co-expresan FoxP3, IL-10 o TGFβ en los individuos infectados crónicos con el VHB, al compararse con los otros dos grupos estudiados. Este incremento se correlacionó positivamente con los niveles plasmáticos de ALT (R=0,9, p<0,05. No hubo diferencias significativas entre los tres grupos cuando se evaluó a las poblaciones CD8+. Estos resultados pudieran contribuir a entender los eventos que conducen al fracaso de la respuesta inmune, asociado a reclutamiento de poblaciones de tipo supresor, que pudieran inhibir la respuesta efectora específica contra el VHB contribuyendo con la persistencia viral. Palabras clave: Células T reguladoras, Higado, Hepatitis, Virus de la Hepatitis B, Inmunohistoquímica. Phenotypic characterization of regulatory T lymphocytes (Treg in livers from chronically HBV infected patients Abstract Hepatitis B virus (HBV is responsible for irreversible liver damage. In this study we evaluated regulatory T cell that infiltrate the liver in hepatic biopsies from subjects with chronic HBV infection. Data showed a significant increase (p <0.05 in the number of CD4 + T cells co-expressing FoxP3, IL-10 or TGFβ, in HBV chronically infected patients, as compared with the other group of patients. This increase was positively correlated with plasma ALT levels (R= 0.9, p <0.05. There were not significant differences between the clinical groups, when liver infiltrating CD8 + populations were evaluated. These findings may contribute to understand events leading to failure of the immune response associated with recruitment of suppressor-type populations, which could inhibit specific immune response

  12. Long-term outcomes in patients with septic shock transfused at a lower versus a higher haemoglobin threshold

    DEFF Research Database (Denmark)

    Brandstrup, Sofie Louise Rygaard; Holst, Lars B; Wetterslev, Jørn

    2016-01-01

    PURPOSE: We assessed the predefined long-term outcomes in patients randomised in the Transfusion Requirements in Septic Shock (TRISS) trial. METHODS: In 32 Scandinavian ICUs, we randomised 1005 patients with septic shock and haemoglobin of 9 g/dl or less to receive single units of leuko-reduced red...... % CI -2.4 to 3.1; P = 0.79) and in mental HRQoL 0.5 (95 % CI -3.1 to 4.0; P = 0.79). CONCLUSIONS: Long-term mortality rates and HRQoL did not differ in patients with septic shock and anaemia who were transfused at a haemoglobin threshold of 7 g/dl versus a threshold of 9 g/dl. We may reject a more than...

  13. Association between hepcidin, haemoglobin level and iron status in stage 4 chronic kidney disease patients with anaemia.

    Science.gov (United States)

    Mogadam, Reza Alipanah; Nemati, Ali; Amani, Firouz; Ghorbanihaghjo, Amir; Argani, Hassan; Bashardoust, Bahman

    2015-04-01

    To explore the probable association of serum hepcidin and haemoglobin levels with iron and inflammation statuses in patients of chronic kidney disease stage 4 with anaemia. The cross-sectional study was conducted at Tabriz University of Medical Sciences, Iran, from March 2011 to October 2012, and comprised patients of chronic kidney disease stage 4 with anaemia. Serum biochemical factors as well as hepcidin, ferritin, interleukin 6, high sensitivity C-reactive protein and iron levels were measured using standard methods. Statistical correlations were established using regression analysis and Pearson's correlation coefficient. There were 40 patients among whom 15(37.5%) were males and 25(62.5%) were females with an overall mean age of 55.68±14.4 years. There was a significant inverse relationship between hepcidin and haemoglobin levels (pnutritional and inflammatory markers such as ferritin, Total iron binding capacity, albumin and interleukin 6 (panaemia in such patients.

  14. Structural studies of haemoglobin from pisces species shortfin mako shark (Isurus oxyrinchus) at?1.9?? resolution

    OpenAIRE

    Ramesh, Pandian; Sundaresan, S. S.; Sathya Moorthy, Pon.; Balasubramanian, M.; Ponnuswamy, M. N.

    2013-01-01

    Haemoglobin (Hb) is a tetrameric iron-containing protein that carries oxygen from the lungs to tissues and carbon dioxide from tissues back to the lungs. Pisces are the advanced aquatic vertebrates capable of surviving at wide depth ranges. The shortfin mako shark (SMS) is the pelagic, largest, fastest and most sophisticated species of the shark kingdom with well developed eyes. Mostly the pisces species are cold blooded in nature. Distinctly, the SMSs are warm-blooded animals with an advance...

  15. Structural studies of haemoglobin from pisces species shortfin mako shark (Isurus oxyrinchus) at 1.9 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Ramesh, Pandian, E-mail: prms23@gmail.com [Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, Suwon 440-746 (Korea, Republic of); University of Madras, Maraimalai Campus (Guindy), Chennai 600 025 (India); Sundaresan, S. S.; Sathya Moorthy, Pon.; Balasubramanian, M.; Ponnuswamy, M. N. [University of Madras, Maraimalai Campus (Guindy), Chennai 600 025 (India)

    2013-11-01

    Shortfin mako shark haemoglobin adopts an unliganded deoxy T state conformation, which is shown from the quaternary structural features, interface interactions and heme binding sites of different subunits of haemoglobin with high-resolution X-ray data. Haemoglobin (Hb) is a tetrameric iron-containing protein that carries oxygen from the lungs to tissues and carbon dioxide from tissues back to the lungs. Pisces are the advanced aquatic vertebrates capable of surviving at wide depth ranges. The shortfin mako shark (SMS) is the pelagic, largest, fastest and most sophisticated species of the shark kingdom with well developed eyes. Mostly the pisces species are cold blooded in nature. Distinctly, the SMSs are warm-blooded animals with an advanced circulatory system. SMSs are capable of maintaining elevated muscle temperatures up to 33 K above the ambient water temperatures at a depth of 150–500 m. SMSs have a diverged air-breathing mechanism compared with other vertebrates. The haemoglobin molecule consists of four polypeptide chains, namely two α chains, each with 140 amino acids and two β chains each having 136 amino acids. The SMS Hb was found to crystallize in monoclinic space group P2{sub 1} using the hanging-drop vapour-diffusion method at room temperature. The crystal packing parameters for the SMS Hb structure contain one whole biological molecule in the asymmetric unit with a solvent content of 47%. The SMS Hb quaternary structural features interface–interface interactions and heme binding sites are discussed with different state Hbs and the results reveal that SMS Hb adopts an unliganded deoxy T state conformation.

  16. Purification, crystallization, preliminary X-ray diffraction and molecular-replacement studies of great cormorant (Phalacrocorax carbo) haemoglobin

    Energy Technology Data Exchange (ETDEWEB)

    Jagadeesan, G. [Presidency College, Chennai 600 005 (India); Malathy, P.; Gunasekaran, K. [University of Madras, Chennai 600 025 (India); Harikrishna Etti, S. [GKM College of Engineering and Technology, Kamaraj Salai, Chennai 600 063 (India); Aravindhan, S., E-mail: aravindhanpresidency@gmail.com [Presidency College, Chennai 600 005 (India)

    2014-10-25

    The great cormorant hemoglobin has been isolated, purified and crystallized and the three dimensional structure is solved using molecular replacement technique. Haemoglobin is the iron-containing oxygen-transport metalloprotein that is present in the red blood cells of all vertebrates. In recent decades, there has been substantial interest in attempting to understand the structural basis and functional diversity of avian haemoglobins. Towards this end, purification, crystallization, preliminary X-ray diffraction and molecular-replacement studies have been carried out on cormorant (Phalacrocorax carbo) haemoglobin. Crystals were grown by the hanging-drop vapour-diffusion method using PEG 3350, NaCl and glycerol as precipitants. The crystals belonged to the trigonal system P3{sub 1}21, with unit-cell parameters a = b = 55.64, c = 153.38 Å, β = 120.00°; a complete data set was collected to a resolution of 3.5 Å. Matthews coefficient analysis indicated that the crystals contained a half-tetramer in the asymmetric unit.

  17. Pathophysiological effects and changes in potassium, ionised calcium, glucose and haemoglobin early after severe blunt chest trauma.

    Science.gov (United States)

    Rocksén, David; Gryth, Dan; Druid, Henrik; Gustavsson, Jenny; Arborelius, Ulf P

    2012-05-01

    Severe lung contusion is often observed after blunt chest trauma due to traffic accidents or fall from heights, but may also occur after a non-penetrating ballistic impact against body armour. Such trauma has been designated behind armour blunt trauma (BABT). Our aim in the present study has been to evaluate pathophysiological changes and compensatory mechanisms that occur early after such severe lung contusion. Twelve pigs wearing body armour were shot with a 7.62mm assault rifle to produce a standardised pulmonary contusion. Exposed animals were compared with five control animals shot with blank ammunition. Physiological parameters and levels of potassium, glucose, haemoglobin, calcium, lactate and pH were monitored for two hours after the shot. The impact induced severe pulmonary contusion with apnoea, desaturation and hypotension in all exposed animals. Increased haemoglobin, glucose and severe hyperkalaemia were seen shortly after impact. Seven of twelve animals died due to the trauma. Dense cardiac tissue was observed during post mortem examination in six of the animals that died during the experimental course. In conclusion, this study has shown that life-threatening hyperkalaemia occurs early after severe lung contusion. Moreover, dense cardiac tissue and early increase of haemoglobin and glucose are intriguing findings that should be investigated in future studies. Copyright © 2010 Elsevier Ltd. All rights reserved.

  18. Decreased expression of haemoglobin beta (HBB) gene in anaplastic thyroid cancer and recovery of its expression inhibits cell growth.

    Science.gov (United States)

    Onda, M; Akaishi, J; Asaka, S; Okamoto, J; Miyamoto, S; Mizutani, K; Yoshida, A; Ito, K; Emi, M

    2005-06-20

    Anaplastic thyroid cancer (ATC) is one of the most fulminant and foetal diseases in human malignancies. However, the genetic alterations and carcinogenic mechanisms of ATC are still unclear. Recently, we investigated the gene expression profile of 11 anaplastic thyroid cancer cell lines (ACL) and significant decreased expression of haemoglobin beta (HBB) gene in ACL. Haemoglobin beta is located at 11p15.5, where loss of heterozygosity (LOH) was reported in various kinds of cancers, including ATC, and it has been suggested that novel tumour suppressor genes might exist in this region. In order to clarify the meaning of decreased expression of HBB in ATC, the expression status of HBB was investigated with ACL, ATC, papillary thyroid cancer (PTC) and normal human tissues. Haemoglobin beta showed significant decreased expression in ACLs and ATCs; however, in PTC, HBB expressed equal to the normal thyroid gland. In addition, HBB expressed in normal human tissues ubiquitously. To validate the tumour-suppressor function of HBB, cell growth assay was performed. Forced expression of HBB in KTA2 cell, which is a kind of ACL, significantly suppressed KTA2 growth. The mechanism of downregulation of HBB in ATC is still unclear; however, our results suggested the possibility of HBB as a novel tumour-suppressor gene.

  19. Decreased expression of haemoglobin beta (HBB) gene in anaplastic thyroid cancer and recovory of its expression inhibits cell growth

    Science.gov (United States)

    Onda, M; Akaishi, J; Asaka, S; Okamoto, J; Miyamoto, S; Mizutani, K; Yoshida, A; Ito, K; Emi, M

    2005-01-01

    Anaplastic thyroid cancer (ATC) is one of the most fulminant and foetal diseases in human malignancies. However, the genetic alterations and carcinogenic mechanisms of ATC are still unclear. Recently, we investigated the gene expression profile of 11 anaplastic thyroid cancer cell lines (ACL) and significant decreased expression of haemoglobin beta (HBB) gene in ACL. Haemoglobin beta is located at 11p15.5, where loss of heterozygosity (LOH) was reported in various kinds of cancers, including ATC, and it has been suggested that novel tumour suppressor genes might exist in this region. In order to clarify the meaning of decreased expression of HBB in ATC, the expression status of HBB was investigated with ACL, ATC, papillary thyroid cancer (PTC) and normal human tissues. Haemoglobin beta showed significant decreased expression in ACLs and ATCs; however, in PTC, HBB expressed equal to the normal thyroid gland. In addition, HBB expressed in normal human tissues ubiquitously. To validate the tumour-suppressor function of HBB, cell growth assay was performed. Forced expression of HBB in KTA2 cell, which is a kind of ACL, significantly suppressed KTA2 growth. The mechanism of downregulation of HBB in ATC is still unclear; however, our results suggested the possibility of HBB as a novel tumour-suppressor gene. PMID:15956966

  20. Impact of nutrition education on knowledge and haemoglobin status of hill women in Uttarakhand State of India.

    Science.gov (United States)

    Upadhyay, S; Kumar, A R; Raghuvanshi, R S; Singh, B B

    2011-12-01

    This study aimed to examine the impact of the use of single vs. combination of media on nutritional knowledge and haemoglobin status of women in a rural hill area in Uttarakhand State, India. Women from three villages were selected randomly and divided into three groups namely, print media group (n = 59), multimedia group (n = 53) and control group (n = 111). The print media group was exposed to nutrition education through the use of calendars on anaemia for 60 days; the multimedia group was given nutrition education through a combination of media including calendars, video films, and group discussions for 60 days. At pre-exposure stage, 62.7% of the women in the print media group, 67.9% of the multimedia group, and 66.7% of the control group had a low nutrition knowledge level. After exposure, the print media group and the multimedia group showed a significant rise in nutrition knowledge, with the multimedia group scoring significantly higher than the print media group. Overall, 69.1% of the women were anaemic with mean haemoglobin concentration of 10.74 +/- 0.86 g/dl. A non-significant rise in mean haemoglobin concentrations in the experimental groups was found at post-exposure stage. Calendars and video films are effective in increasing nutrition knowledge of illiterate hill women. Use of mass media programmes of longer duration should be encouraged to combat the nutritional problems of rural communities.

  1. Haemoglobin F, A2, and S levels in subjects with or without sickle cell trait in south-eastern Gabon.

    Science.gov (United States)

    Mombo, Landry-Erik; Mabioko-Mbembo, Gaël; Kassa-Kassa, Roland-Fabrice; Ontsitsagui, Emmanuel; Mboui-Ondo, Statiana; Nzé-Kamsi, Leatitia; Nkoghé, Dieudonné; Elion, Jacques

    2017-09-01

    Infant mortality due to sickle cell disease in sub-Saharan Africa is high, necessitating a better understanding of the modulating factors of the disease in this region. We assessed the hereditary persistence of foetal haemoglobin and α-thalassemia. We diagnosed 787 subjects, with or without sickle cell trait, by capillary electrophoresis in the Medical Diagnostic Laboratory of the CIRMF (Franceville, Gabon). Heterocellular and pancellular forms of hereditary persistence of foetal haemoglobin occurred at low rates of 10.9 and 2.3%, respectively. The distribution of HbS levels in individuals with sickle cell trait was trimodal, showing a high percentage (52.4%) of heterozygous subjects with α-thalassemia. The distribution of HbA2 levels was bimodal in individuals without sickle cell trait, estimated to be comprised of 12 and 15% of α and β-thalassemic heterozygous subjects, respectively. In sub-Saharan Africa, α-thalassemia is a far more prevalent modulating factor than hereditary persistence of foetal haemoglobin. Our study highlights the need for further investigation of thalassemia, haemoglobinopathies that are neglected in sub-Saharan Africa.

  2. Threshold haemoglobin levels and the prognosis of stable coronary disease: two new cohorts and a systematic review and meta-analysis.

    Science.gov (United States)

    Shah, Anoop D; Nicholas, Owen; Timmis, Adam D; Feder, Gene; Abrams, Keith R; Chen, Ruoling; Hingorani, Aroon D; Hemingway, Harry

    2011-05-01

    Low haemoglobin concentration has been associated with adverse prognosis in patients with angina and myocardial infarction (MI), but the strength and shape of the association and the presence of any threshold has not been precisely evaluated. A retrospective cohort study was carried out using the UK General Practice Research Database. 20,131 people with a new diagnosis of stable angina and no previous acute coronary syndrome, and 14,171 people with first MI who survived for at least 7 days were followed up for a mean of 3.2 years. Using semi-parametric Cox regression and multiple adjustment, there was evidence of threshold haemoglobin values below which mortality increased in a graded continuous fashion. For men with MI, the threshold value was 13.5 g/dl (95% confidence interval [CI] 13.2-13.9); the 29.5% of patients with haemoglobin below this threshold had an associated hazard ratio for mortality of 2.00 (95% CI 1.76-2.29) compared to those with haemoglobin values in the lowest risk range. Women tended to have lower threshold haemoglobin values (e.g, for MI 12.8 g/dl; 95% CI 12.1-13.5) but the shape and strength of association did not differ between the genders, nor between patients with angina and MI. We did a systematic review and meta-analysis that identified ten previously published studies, reporting a total of only 1,127 endpoints, but none evaluated thresholds of risk. There is an association between low haemoglobin concentration and increased mortality. A large proportion of patients with coronary disease have haemoglobin concentrations below the thresholds of risk defined here. Intervention trials would clarify whether increasing the haemoglobin concentration reduces mortality.

  3. Free serum haemoglobin is associated with brain atrophy in secondary progressive multiple sclerosis [version 2; referees: 1 approved, 2 approved with reservations

    Directory of Open Access Journals (Sweden)

    Alex Lewin

    2016-12-01

    Full Text Available Background A major cause of disability in secondary progressive multiple sclerosis (SPMS is progressive brain atrophy, whose pathogenesis is not fully understood. The objective of this study was to identify protein biomarkers of brain atrophy in SPMS.   Methods We used surface-enhanced laser desorption-ionization time-of-flight mass spectrometry to carry out an unbiased search for serum proteins whose concentration correlated with the rate of brain atrophy, measured by serial MRI scans over a 2-year period in a well-characterized cohort of 140 patients with SPMS.  Protein species were identified by liquid chromatography-electrospray ionization tandem mass spectrometry.   Results There was a significant (p<0.004 correlation between the rate of brain atrophy and a rise in the concentration of proteins at 15.1 kDa and 15.9 kDa in the serum.  Tandem mass spectrometry identified these proteins as alpha-haemoglobin and beta-haemoglobin, respectively.  The abnormal concentration of free serum haemoglobin was confirmed by ELISA (p<0.001.  The serum lactate dehydrogenase activity was also highly significantly raised (p<10-12 in patients with secondary progressive multiple sclerosis.    Conclusions The results are consistent with the following hypothesis. In progressive multiple sclerosis, low-grade chronic intravascular haemolysis releases haemoglobin into the serum; the haemoglobin is subsequently translocated into the central nervous system (CNS across the damaged blood-brain barrier.  In the CNS, the haemoglobin and its breakdown products, including haem and iron, contribute to the neurodegeneration and consequent brain atrophy seen in progressive disease. We postulate that haemoglobin is a source of the iron whose deposition along blood vessels in multiple sclerosis plaques is associated with neurodegeneration.  If so, then chelators of haemoglobin, rather than chelators of free serum iron, may be effective in preventing this

  4. HAEMOGLOBIN LEVEL AS A RISK FACTOR FOR LOWER RESPIRATORY TRACT INFECTIONS

    Directory of Open Access Journals (Sweden)

    Harishchandra Venkata Yanamandala

    2017-06-01

    Full Text Available BACKGROUND Lower Respiratory Tract Infection (LRTI is an inflammation of the airways, pulmonary tissue below the larynx level. Children who are below 5 years of age suffer about 5-6 episodes of LRTI per year on an average. 1,2 The largest cause of death in children worldwide is pneumonia. If the haemoglobin level is below 11 g/dL 3 , then the child is considered as anaemic. In children, LRTIs associated with anaemia occur more commonly than in adults. Pneumonia kills about an estimated 1.1 million children under the age of 5 years old worldwide. It is more prevalent in South East Asia and Africa. 3,4,5 Anaemia is a condition in which the number of RBCs is very low to meet the body’s physiologic needs. The most common cause of anaemia is deficiency of iron. In both developing and developed countries, anaemia is a common health problem. This study is a prospective study, which was conducted to assess the low haemoglobin level as a risk factor for developing LRTI in children. MATERIALS AND METHODS This is a prospective study, which was conducted in 75 children who attended the outpatient unit of Department of Paediatrics, Gitam Institute of Medical Sciences and Research. It was conducted during the period between December 2015 to December 2016. By the symptoms and signs, pneumonia was diagnosed. Exclusion Criteria- Children who had congenital malformations of chest wall, severe systemic illness and protein malfunction. All children’s height and weight were recorded to assess the nutritional status. RESULTS C-Reactive Protein Estimation (CRP was more than 6 mg/L in 34 (45.3% patients in the study group, 11 (14.7% in the control group. Mantoux test was positive for 17 (22.6% among study group and none in the control group. Pneumonia as per radiological evidence was present in 49 (65.3% and hyperinflation of lungs in 26 (34.7% among the study group. X-ray reports were normal in 8 cases (10.7%. Age was not found to be a significant factor, which

  5. Maternal haemoglobin concentration and risk of preterm birth in a Chinese population.

    Science.gov (United States)

    Zhang, Yiting; Li, Zhiwen; Li, Hongtian; Jin, Lei; Zhang, Yali; Zhang, Le; Liu, Jufen; Ye, Rongwei; Liu, Jianmeng; Ren, Aiguo

    2018-01-01

    The aim was to examine the relationship between maternal haemoglobin (Hb) concentrations and risk of preterm birth by secondary analysis of data from a randomised controlled trial. This analysis included 10,430 women who were at least 20 years old and no more than 20 weeks of gestation. Results revealed neither first- nor second-trimester Hb concentrations were associated with the risk of preterm births. However, the risk of preterm birth increased when the Hb level was low (preterm birth. A low-Hb level in the first trimester but coupled with a high Hb level in the second was associated with an elevated risk of preterm birth. Impact statement What is already known on this subject: The relationship between maternal Hb concentration and preterm birth remains inconclusive. Some studies have shown an association between a low- or a high-Hb level and an increased risk of preterm birth. Others have not found such an association. Yet others have shown a U-shaped relationship. What do the results of this study add: Overall, maternal Hb concentrations in first or second trimester were not statistically associated with the risk of preterm birth. However, women with a low Hb concentration in the first trimester together with a high Hb concentration in the second trimester had an increased risk of preterm birth, compared to women who had a higher Hb concentration in the first trimester that remained similar during the second trimester. What are the implications are of these findings for clinical practice and/or further research: Our finding helps identify mothers who are at risk of having a preterm delivery. Investigating the underlying clinical causes of the unfavourable change in Hb levels and close follow-up to these women may help improve birth outcomes.

  6. Haemoglobin discordances in twins: due to differences in timing of cord clamping?

    Science.gov (United States)

    Verbeek, Lianne; Zhao, Depeng P; Middeldorp, Johanna M; Oepkes, Dick; Hooper, Stuart B; Te Pas, Arjan B; Lopriore, Enrico

    2017-07-01

    Our objective was to study the differences in haemoglobin (Hb) at birth in dichorionic (DC) versus monochorionic (MC) twins in relation to birth order and mode of delivery. All consecutive DC twin pregnancies and uncomplicated MC twin pregnancies with two live-born twins delivered at our centre were included in this retrospective cohort study. Hb levels at birth and on day 2 were evaluated in association with birth order and mode of delivery. The occurrence of polycythaemia (venous haematocrit >65%) was also recorded. A total of 300 DC and 290 MC twin pairs were included. In DC and MC twins delivered vaginally, second-born twins had a higher Hb level at birth compared with their co-twin (mean Hb level 16.7 vs 15.9 g/dL (ptwins and 17.8 vs 16.1 g/dL (ptwins). In twins delivered through caesarean section, no intertwin differences in Hb levels were detected. Polycythaemia occurred significantly more often in second-born twins compared with first-born twins delivered vaginally: 10 (5%) vs 2 (1%) (p=0.02) in DC twins and 20 (12%) vs 2 (1%) (ptwins. Second-born DC and MC twins delivered vaginally have higher Hb levels at birth compared with first-born twins. Intertwin Hb differences in MC twins may partly be related to blood transfusion through the vascular anastomoses. Since DC twins do not have anastomoses, other factors may lead to Hb differences, including differences in timing of umbilical cord clamping. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  7. Associations among milk production traits and glycosylated haemoglobin in dairy cattle; importance of lactose synthesis potential.

    Science.gov (United States)

    Shahbazkia, Homayon Reza; Aminlari, Mahmoud; Tavasoli, Atoosa; Mohamadnia, Ahmad Reza; Cravador, Alfredo

    2010-01-01

    Glucose is the major precursor of lactose synthesis in the mammary gland. Lactose the major carbohydrate and osmolyte of milk, controls milk volume and its concentration. Glycosylated haemoglobin (HbG) is a retrospective measure of mean blood glucose level and it is largely unaffected by recent physiological conditions and environmental events. The purposes of this study were to determine the correlations between lactose traits and other milk production traits in dairy cattle and to investigate whether HbG level can be correlated with milk and lactose production traits. Here, HbG percentage, milk and lactose production traits including milk yield, lactose, protein, SNF, total solid and fat percentages and yields were measured in 485 second calved Iranian Holstein cattle. Statistically significant negative correlations were established between HbG and milk yield (r = -0.88), lactose yield (r = -0.83), SNF yield (r = -0.81), protein yield (r = -0.79) and total solid yield (r = -0.74). Positive correlations were established between lactose yield and milk (r = 0.96), protein (r = 0.81), SNF (r = 0.92) and total solid (r = 0.79) yields. The negative correlation between HbG and milk and total lactose production is probably related to the higher glucose demands in the lactating mammary gland of more productive cows. The positive correlation between lactose yield and milk, protein, SNF and total solid yield indicates that the level of lactose synthesis influences milk production traits in ways other than merely via its osmolytic action.

  8. Evaluation of two devices for point-of-care testing of haemoglobin in neonatal pigs.

    Science.gov (United States)

    Kutter, Annette P N; Mauch, Jacqueline Y; Riond, Barbara; Martin-Jurado, Olga; Spielmann, Nelly; Weiss, Markus; Bettschart-Wolfensberger, Regula

    2012-01-01

    In veterinary medicine, point-of-care testing (POCT) techniques have become popular, since they provide immediate results and only small amounts of blood are needed. However, their accuracy is controversial. Pigs are often used for research purposes and accurate measurement of haemoglobin (Hb) is important during invasive procedures. The aim of this study was to evaluate two different Hb POCT devices in neonatal pigs. A prospective study with 57 pigs of 3-6 weeks of age, weighing 4.1-6.2 kg (median 5.1 kg) was performed. Fifty-seven blood samples were analysed for Hb using a conductivity-based and a photometrical POCT device and compared with a photometrical reference method. Statistical analysis was performed with Bland-Altman analysis, Spearman correlation and Passing-Bablok regression analysis. Hb values ranged from 32 to 108 g/L (median 80 g/L) using the reference method. The bias of the photometrical method (HemoCue(®)) to the reference method was -1 g/L, with limits of agreement (LOA) of -7 to 6 g/L. The conductivity-based method (i-STAT(®)) had a bias of -15 g/L with LOA from -24 to -6 g/L. There was a significant association between protein values and the bias of i-STAT versus CellDyn (r(2) = 0.27, P CellDyn (r(2) = 0.001, P = 0.79). The lower the protein values were, the lower the Hb values were measured by the i-STAT. The conductivity-based measurement of Hb constantly underestimated Hb values, whereas the photometrical method demonstrated a better accuracy and is therefore more reliable for on-site measurement of Hb in pigs.

  9. Changing reference intervals for haemoglobin in Denmark: Clinical and financial aspects.

    Science.gov (United States)

    Ryberg-Nørholt, Judith; Frederiksen, Henrik; Nybo, Mads

    2017-10-15

    Based on international experiences and altering demography the reference intervals (RI) for haemoglobin (Hb) concentrations in blood were changed in Denmark in 2013 from 113 - 161 g/L to 117 - 153 g/L for women and from 129 - 177 g/L to 134 - 170 g/L for men. The aim of this study was to determine the derived change in prevalence of anaemia and the change in yearly health care costs of diagnostic investigations associated with the expected, as we hypothesized, increased prevalence and health care costs. Data from 96,314 non-hospitalised patients (55,341 females and 40,973 males, aged 18 - 105 years) from general practitioners and community specialists of Funen, Denmark, were extracted from the laboratory information system. The prevalence of anaemia according to the new and the old RI were investigated, and additional costs were calculated based on estimated additional blood analyses and nationally recommended endoscopic procedures. Changing the Hb RI increased the number of anaemic patients by 52% (3450 patients) over a two-year period. With new RI the proportion of anaemic elderly above 80 years was 20.5% for females and 43.9% for males. Annual costs of derived additional assessments due to the altered RI were estimated to be 5.7 million €, which equals the cost of 1214 knee replacement surgeries in Denmark. Changing the Hb RI has been expensive, despite the fact that no outcome studies have justified the alteration. The methodological approach for establishing new RI, here particularly for Hb, should be thoroughly considered. In general, physicians should use RI with caution.

  10. Effect of whey guava beverage supplementation on haemoglobin level of school going children

    Directory of Open Access Journals (Sweden)

    Divya .

    2014-12-01

    Full Text Available Introduction: Iron deficiency is estimated to affect one-half of the school going children in developing countries and school years are opportune time to intervene. Rationale: No coherent, co-ordinate and effective health services are available in the country for below 16 years. So attempt was made to know real scenario of iron deficiency. Objectives: To assess the effect of whey guava beverage supplementation on the haemoglobin level of school going children. Methodology:  An experimental research design was taken to conduct the study in which 200 children of 6≥and7≥ years in low socio economic status of both the genders were taken. For hemoglobin testing Sahil’s hemoglobinometer was used. Each child in experimental group was given 200ml of whey guava beverage for 90 days except holidays. Results and Discussion: The initial mean Hb levels of 6≥and7≥ year’s old boys and girls of control groups and experimental groups were ranging from 9.50 to 10.24 which were 79.17% to 85.33%. The results revealed that almost all the respondents were anaemic. After 90 days of feeding supplement the final mean Hb levels of 6≥7 years old boys and girls of control group  ranged from 10.10 to 10.65 which was 84.17% to 88.75%. Whereas in experimental group it ranged from 11.06 to 11.42 which were 91.92% to 95.17%. The study clearly evidences that the respondents in experimental group had improved with more Hb levels when compared to control group. Also children who were suffering from anaemia in experimental group became normal. Conclusion: Distribution of whey guava beverage through school feeding program may prove as an outstanding strategy to combat iron deficiency in school children.

  11. Immunoassay of haemoglobin-acrylonitrile adduct in rat as a biomarker of exposure.

    Science.gov (United States)

    L Wong Yu Ting Zheng Junyu Li Carlo H Tamburro Frederick W Benz, J

    1998-01-01

    Acrylonitrile (AN) is a rat carcinogen. Human exposure may come from chemical industries and smoking. A haemoglobin adduct of acrylonitrile (Hb-AN) has been used as a biomarker of exposure by means of gas chromatography-mass spectrometry (GC-MS) analysis. We have developed specific monoclonal antibodies (Mab) to human Hb-AN and wish to report evaluation of an immunoassay in rats using an Mab that cross-reacts with rat Hb-AN. A dose response study of LD 0, 10, 50, and 90 in Sprague-Dawley rats was undertaken, with each rat receiving \\[2,3-14C]AN at 50 Ci kg-1 sc, and Hb from an aliquot of blood was taken for covalent binding analysis by liquid scintillation spectrometry and fluorescence ELISA. The dose responses of rats at 0.25, 0.5, 1.0, and 2.0 h after AN doses of 20, 50, 80, 115 mg kg-1 were compared by both methods with Hb and globin samples. Regression analysis showed a linear relationship between immunoassay and 14C-AN binding. This indicates that an antigenic form of Hb-AN may be used as a surrogate of Hb-AN adduct. The sensitivity of ELISA was tested in rats exposed for 1 h to sub-toxic doses of AN (10-1.1 mg kg-1). Quantification of Hb-AN by immunoassay was achieved by calibration with a synthetic adduct HbAN4h, a reference adduct prepared by treating rat Hb with excess AN for 4 h. ELISA and GC-MS analysis of N-terminal valine-AN in the Hb-AN adduct were compared and similar detection levels were found. This rat study appears to have validated the new immunoassay method for biomonitoring of AN exposure.

  12. Financial strain, inflammatory factors, and haemoglobin A1c levels in African American women.

    Science.gov (United States)

    Cutrona, Carolyn E; Abraham, William T; Russell, Daniel W; Beach, Steven R H; Gibbons, Frederick X; Gerrard, Meg; Monick, Martha; Philibert, Robert

    2015-09-01

    Type 2 diabetes disproportionately affects African American women, a population exposed to high levels of stress, including financial strain (Centers for Disease Control & Prevention, 2011, http://www.cdc.gov/diabetes/pubs/pdf/ndfs_2011.pdf). We tested a mediational model in which chronic financial strain among African American women contributes to elevated serum inflammation markers, which, in turn, lead to increased haemoglobin A1C (HbA1c) levels and risk for type 2 diabetes. We assessed level of financial strain four times over a 10-year period and tested its effect on two serum inflammation markers, C-reactive protein (CRP) and soluble interleukin-6 receptor (sIL-6R) in year 11 of the study. We tested the inflammation markers as mediators in the association between chronic financial strain and HbA1c, an index of average blood glucose level over several months. Data were from 312 non-diabetic African American women from the Family and Community Health Study (FACHS; Cutrona et al., 2000, J. Pers. Soc. Psychol., 79, 1088). Chronic financial strain predicted circulating sIL-6R after controlling for age, BMI, health behaviours, and physical health measures. In turn, sIL-6R significantly predicted HbA1c levels. The path between chronic financial strain and HbA1c was significantly mediated by sIL-6R. Contrary to prediction, CRP was not predicted by chronic financial strain. Results support the role of inflammatory factors in mediating the effects of psychosocial stressors on risk for type 2 diabetes. Findings have implications for interventions that boost economic security and foster effective coping as well as medical interventions that reduce serum inflammation to prevent the onset of type 2 diabetes. © 2014 The British Psychological Society.

  13. The specific influence of carbon dioxide and carbamate compounds on the buffer power and Bohr effects in human haemoglobin solutions

    Science.gov (United States)

    Rossi-Bernardi, L.; Roughton, F. J. W.

    1967-01-01

    1. The difference of pH (ΔpH) between human deoxygenated haemoglobin (Hb) and oxygenated haemoglobin (O2Hb) solutions when equilibrated with physiological pressures of carbon dioxide is (experimentally) much less than previously supposed. 2. This smaller ΔpH is in contradiction to Wyman's (1948) theoretical calculations, wherein no allowance was made for the specific effect of carbamino-compounds on the amount of base neutralized by haemoglobin. Other previous authorities have also neglected this factor, which when properly allowed for restores the role of carbamino-compounds in CO2 transport practically to that previously estimated by Ferguson & Roughton (1934a, b). 3. At a given pH and PCO2, more CO2 is bound by Hb solutions than by O2Hb, the difference increasing with pH. This result provides further, and seemingly decisive, evidence that the bound-CO2 in the blood other than HCO3— (i.e. x-bound CO2) is oxygen-linked. 4. According to a modified form of the Henderson—Hasselbalch equation for haemoglobin solutions [Formula: see text]. The value of pK1′ is the same in Hb as in O2Hb solution and from the data in 3 is found to have the value 6·15 at 37° C. 5. The difference between the titration curves of O2Hb and Hb (ΔX̄), at a given pH had been hitherto supposed to be the same in presence of CO2 as in its absence. Our experiments show, however, that ΔX̄ is less in presence of CO2 and at pH > 7·5 may even change sign. This paradoxical effect is also explicable, at any rate semi-quantitatively, by the effect of carbamino compounds on the buffer power, according to the theory put forward in the paper. 6. The results show that the buffer power (dB/dpH) of haemoglobin solution under physiological conditions is 20-30% greater than previously estimated, and this also is in line with the new theory. 7. In graphs of total CO2 versus PCO2 in haemoglobin solutions (or blood) it has been customary to suppose that points on straight lines radiating from the

  14. Root Effect Haemoglobins in Fish May Greatly Enhance General Oxygen Delivery Relative to Other Vertebrates.

    Directory of Open Access Journals (Sweden)

    Jodie L Rummer

    Full Text Available The teleost fishes represent over half of all extant vertebrates; they occupy nearly every body of water and in doing so, occupy a diverse array of environmental conditions. We propose that their success is related to a unique oxygen (O2 transport system involving their extremely pH-sensitive haemoglobin (Hb. A reduction in pH reduces both Hb-O2 affinity (Bohr effect and carrying capacity (Root effect. This, combined with a large arterial-venous pH change (ΔpHa-v relative to other vertebrates, may greatly enhance tissue oxygen delivery in teleosts (e.g., rainbow trout during stress, beyond that in mammals (e.g., human. We generated oxygen equilibrium curves (OECs at five different CO2 tensions for rainbow trout and determined that, when Hb-O2 saturation is 50% or greater, the change in oxygen partial pressure (ΔPO2 associated with ΔpHa-v can exceed that of the mammalian Bohr effect by at least 3-fold, but as much as 21-fold. Using known ΔpHa-v and assuming a constant arterial-venous PO2 difference (Pa-vO2, Root effect Hbs can enhance O2 release to the tissues by 73.5% in trout; whereas, the Bohr effect alone is responsible for enhancing O2 release by only 1.3% in humans. Disequilibrium states are likely operational in teleosts in vivo, and therefore the ΔpHa-v, and thus enhancement of O2 delivery, could be even larger. Modeling with known Pa-vO2 in fish during exercise and hypoxia indicates that O2 release from the Hb and therefore potentially tissue O2 delivery may double during exercise and triple during some levels of hypoxia. These characteristics may be central to performance of athletic fish species such as salmonids, but may indicate that general tissue oxygen delivery may have been the incipient function of Root effect Hbs in fish, a trait strongly associated with the adaptive radiation of teleosts.

  15. Negative Epistasis between Sickle and Foetal Haemoglobin Suggests a Reduction in Protection against Malaria.

    Directory of Open Access Journals (Sweden)

    Bruno P Mmbando

    Full Text Available Haemoglobin variants, Sickle (HbS and foetal (HbF have been associated with malaria protection. This study explores epistatic interactions between HbS and HbF on malaria infection.The study was conducted between March 2004 and December 2013 within the sickle cell disease (SCD programme at Muhimbili National Hospital, Tanzania. SCD status was categorized into HbAA, HbAS and HbSS using hemoglobin electrophoresis and High Performance Liquid Chromatography (HPLC. HbF levels were determined by HPLC. Malaria was diagnosed using rapid diagnostic test and/or blood film. Logistic regression and generalized estimating equations models were used to evaluate associations between SCD status, HbF and malaria.2,049 individuals with age range 0-70 years, HbAA 311(15.2%, HbAS 241(11.8% and HbSS 1,497(73.1% were analysed. At enrolment, malaria prevalence was significantly higher in HbAA 13.2% compared to HbAS 1.24% and HbSS 1.34% (p<0.001. Mean HbF was lower in those with malaria compared to those without malaria in HbAA (0.43% vs 0.82% but was the reverse in HbSS (8.10% vs 5.59%. An increase in HbF was associated with a decrease in risk of malaria OR=0.50 (95%CI: 0.28, 0.90; p=0.021 in HbAA, whereas for HbSS the risk of malaria increased OR=2.94 (1.44, 5.98; p=0.003. A similar pattern was seen during multiple visits; HbAA OR=0.52 (0.34, 0.80; p=0.003 vs HbSS OR=2.01 (1.27, 3.23; p=0.003.Higher prevalence of malaria in HbAA compared to HbAS and HbSS confirmed the protective effect of HbS. Lower prevalence of malaria in HbAA with high HbF supports a protective effect of HbF. However, in HbSS, the higher prevalence of malaria with high levels of HbF suggests loss of malaria protection. This is the first epidemiological study to suggest a negative epistasis between HbF and HbS on malaria.

  16. Glycated haemoglobin A1c is associated with low-grade albuminuria in Chinese adults

    Science.gov (United States)

    Huang, Xiaolin; Zhou, Yulin; Xu, Baihui; Sun, Wanwan; Lin, Lin; Sun, Jichao; Xu, Min; Lu, Jieli; Bi, Yufang; Wang, Weiqing; Xu, Yu; Ning, Guang

    2015-01-01

    Background and objective Diabetes is a strong risk factor for cardiovascular diseases, whereas few studies have investigated simultaneously the associations of glycated haemoglobin A1c (HbA1c), fasting blood glucose (fasting plasma glucose (FPG)) and 2 h postload blood glucose (2 h PG) with low-grade albuminuria, which is an earlier marker of cardiovascular diseases in the general population. Our study aimed to investigate and compare associations of HbA1c, FPG, and 2 h PG levels with risks of low-grade albuminuria in the middle-aged and elderly Chinese. Design and methods This was a cross-sectional study involving 9188 participants aged 40 years or older. All participants underwent a standard 75 g oral glucose tolerance test. Low-grade albuminuria was defined as the highest quartile of urinary albumin-to-creatinine ratio (ACR) (>6.10 mg/g in males and >8.76 mg/g in females) in respondents without microalbuminuria or macroalbuminuria. Results HbA1c, FPG and 2 h PG were all significantly correlated with urinary ACR after adjustment for confounders (all p values albuminuria were positively associated with HbA1c levels in a dose–response manner. Compared with participants with HbA1c ≤37 mmol/mol (5.5%), ORs (95% CIs) for low-grade albuminuria were 1.05 (0.94 to 1.18), 1.25 (1.04 to 1.50), 1.40 (1.04 to 1.90) and 2.21 (1.61 to 3.03) for HbA1c categories of 38–42 mmol/mol (5.6–6.0%), 43–48 mmol/mol (6.1–6.5%), 49–53 mmol/mol (6.6–7.0%), and >53 mmol/mol (7.0%), respectively (pfor trend albuminuria in the middle-aged and elderly Chinese. PMID:26243552

  17. ROLE OF GLYCOSYLATED HAEMOGLOBIN IN PREDICTION OF FOETOMATERNAL OUTCOME IN GESTATIONAL DIABETES MELLITUS

    Directory of Open Access Journals (Sweden)

    Vinita Sarbhai

    2016-08-01

    Full Text Available OBJECTIVE To explore the role of Glycosylated Haemoglobin (HbA1c in predicting foetomaternal outcome in pregnant women with gestational diabetes mellitus (GDM. METHOD This was a prospective study of 100 women with singleton pregnancy with 140 mg/dL on glucose challenge test enrolled in Kasturba Hospital, Delhi, from 2012 to 2013. A detailed history, examination, routine obstetrical investigations including 75 g Oral Glucose Tolerance Test (OGTT and HbA1c level were done. Patients were managed accordingly and followed till delivery. Their obstetrical and perinatal outcomes were noted and the data was compared using chi-squared test and Fischer’s exact test with a two-tailed p-value 6% HbA1c level and those with abnormal OGTT. Adverse maternal outcomes in patients with >6% HbA1c included excessive weight gain (68% vs. 58.2%, preeclampsia (44% vs. 38.2%, polyhydramnios (44% vs. 35.2%, caesarean section (68% vs. 52.9%, wound sepsis (24% vs. 17.6% as compared to patients with abnormal GTT. Adverse foetal outcomes and neonatal complications in patients with >6% HbA1c included preterm delivery (36% vs. 32.3%, intrauterine death (12% vs. 8.8%, LGA babies (52% vs. 29.4%, congenital anomalies (13.6% vs. 9.6%, respiratory distress (27.3% vs. 16.1%, hypoglycaemia (36.8% vs. 25.8%, hyperbilirubinaemia (31.8% vs. 29%, and NICU admission >2 days (95.4% vs. 64.5%. A high HbA1c was found to be comparable to OGTT in predicting adverse maternal outcome in GDM patients while a poor foetal outcome was more commonly associated with HbA1c >6%. CONCLUSIONS HbA1c is a sensitive tool for prediction of foetomaternal outcomes in patients with abnormal blood glucose value; hence, it should be advised in all pregnant women.

  18. Evolution of glycated haemoglobin in adults on growth hormone replacement therapy.

    Science.gov (United States)

    Andrea Parra R, Paola; Barquiel A, Beatriz; Fernández M, Alberto; Pérez F, Laura; Lecumberri S, Beatriz; Gaby Llaro C, Mary; Álvarez-Escolá, Cristina

    2015-05-01

    To evaluate the effects of GH replacement therapy (GHR) for 3 years on glycated haemoglobin (HbA1c) and on the presence of dysglycaemia at any time during follow-up in Spanish adult patients with growth hormone deficiency (GHD). A retrospective study of 41 patients with GHD was conducted using baseline and long-term data. Changes in HbA1c values during the first 3 years of GHR were studied in both the overall population and patients with or without dysglycaemia during follow-up. Dysglycaemia was defined as FPG ≥ 100 mg/dl and/or HbA1c ≥ 5.7%. Mean HbA1c value (5.4 ± 0.4% at baseline) increased during the first and second years of GHR (HbA1c 5.5 ± 0.4%, p=0.05, and 5.5 ± 0.4%, p=0.006 respectively). This increase was not maintained during the third year (HbA1c 5.4 ± 0.3%, p=0.107) of GHR. Twenty-eight patients (68.2%) had dysglycaemia during follow-up, 9 of them since baseline. In the 19 patients without baseline dysglycaemia, HbA1c increased during the first year and remained stable in the next 2 years (mean HbA1c 5.2 ± 0.4% at baseline; 5.5 ± 0.4% at 1 year, p<0.050; 5.4 ± 0.4% at 2 years, p=0.004, and 5.4 ± 0.4% at 3 years, p=0.016). In the 9 patients with baseline dysglycaemia, HbA1c did not significantly change during the 3 years of GHR therapy. HbA1c values increased during the first 2 years of GHR therapy. In patients with no dysglycaemia before treatment, HbA1c steadily increased over the 3 years. However, it did not change in patients with baseline dysglycaemia. Copyright © 2014 SEEN. Published by Elsevier España, S.L.U. All rights reserved.

  19. The effect of a school-based iron intervention on the haemoglobin concentration of school children in north-west Pakistan.

    Science.gov (United States)

    Rousham, E K; Uzaman, B; Abbott, D; Lee, S F; Mithani, S; Roschnik, N; Hall, A

    2013-11-01

    To assess the effectiveness of iron supplements administered to school children through a longitudinal school health intervention in terms of child haemoglobin concentration and anaemia prevalence. Children and adolescents aged 5-17 years were selected from 30 schools in north-west Pakistan for a longitudinal iron supplement intervention. Children received once-weekly iron supplements (200 mg ferrous sulphate containing 63 mg of elemental iron) for 24 weeks (n=352); or the same supplements twice-weekly for 12 weeks (n=298) or received no tablets (n=298). Haemoglobin concentration was estimated in finger-prick blood samples at baseline, 12 and 24 weeks. Follow-up samples were taken at 36 weeks. A non-significant increase in haemoglobin concentration was observed in children receiving iron supplements after 12 weeks (mean 1.4 g/l s.d. 15.0 g/l in once-weekly versus 2.5 g/l s.d. 14.5 g/l in twice-weekly) compared with the group receiving no iron supplements. There was no significant reduction in the prevalence of anaemia in the once-weekly or twice-weekly group compared with the unsupplemented group. The prevalence of anaemia increased in all three groups during the follow-up period (24-36 weeks). Once-weekly and twice-weekly iron supplements were not associated with significant increases in haemoglobin concentration compared with unsupplemented children. In all groups, baseline haemoglobin concentration was the strongest predictor of haemoglobin increase. The lack of improvement may stem from the moderate baseline prevalence of anaemia (33%); other micronutrient deficiencies; variable compliance; or the worsening of haemoglobin status owing to seasonal changes in dietary iron and other nutrients.

  20. Global epidemiology of sickle haemoglobin in neonates: a contemporary geostatistical model-based map and population estimates.

    Science.gov (United States)

    Piel, Frédéric B; Patil, Anand P; Howes, Rosalind E; Nyangiri, Oscar A; Gething, Peter W; Dewi, Mewahyu; Temperley, William H; Williams, Thomas N; Weatherall, David J; Hay, Simon I

    2013-01-12

    Reliable estimates of populations affected by diseases are necessary to guide efficient allocation of public health resources. Sickle haemoglobin (HbS) is the most common and clinically significant haemoglobin structural variant, but no contemporary estimates exist of the global populations affected. Moreover, the precision of available national estimates of heterozygous (AS) and homozygous (SS) neonates is unknown. We aimed to provide evidence-based estimates at various scales, with uncertainty measures. Using a database of sickle haemoglobin surveys, we created a contemporary global map of HbS allele frequency distribution within a Bayesian geostatistical model. The pairing of this map with demographic data enabled calculation of global, regional, and national estimates of the annual number of AS and SS neonates. Subnational estimates were also calculated in data-rich areas. Our map shows subnational spatial heterogeneities and high allele frequencies across most of sub-Saharan Africa, the Middle East, and India, as well as gene flow following migrations to western Europe and the eastern coast of the Americas. Accounting for local heterogeneities and demographic factors, we estimated that the global number of neonates affected by HbS in 2010 included 5,476,000 (IQR 5,291,000-5,679,000) AS neonates and 312,000 (294,000-330,000) SS neonates. These global estimates are higher than previous conservative estimates. Important differences predicted at the national level are discussed. HbS will have an increasing effect on public health systems. Our estimates can help countries and the international community gauge the need for appropriate diagnoses and genetic counselling to reduce the number of neonates affected. Similar mapping and modelling methods could be used for other inherited disorders. The Wellcome Trust. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. The Effect of Date (Phoenix dactylifera Juice on Haemoglobin Level An Experimental Study in Iron Supplemented Rats

    Directory of Open Access Journals (Sweden)

    Ady Try Himawan Zen

    2013-06-01

    Full Text Available There has been more research on the iron supplementation. Date juice has been shown to be rich in iron. It has been reported to increase the hemoglobin level in rats. Few studies has been conducted on the effect of date juice on the hemoglobin level in male white Wistar rats fed low iron diet.This research was conducted to evaluate the effect of (Phoenix dactylifera juice on haemoglobin level in iron supplemented rats. In this experimental study using post test control group design, 24 male white Wistar rats were divided into 4 groups. G-I served as the control group (standard diet and aquadest. G II was given the low Fe diet and aquadest for 21 d. G-III,IV were given the low fe diet and aquadest plus date juice at the concentration of 50%, 100% respectively. The treatment was given for 14 days. Spectrophotometer was used to assess the haemoglobin level of rats. One way anova followed by Post Hoc LSD was applied for the data analysis. Mean of hemoglobin (g/dl level for the four groups were 12,03, 7.72, 9.25, 10.35 respectively. Test resulted in p<0.05. Post Hoc LSD test resulted in a significant different between K-I and G-II, G-III, G-IV ;G-II and G-III, G-IV ;G-III and G-IV. In conclusion, date juice increases the haemoglobin level in male white rats fed on the low fe diet.

  2. Are there better alternatives than haemoglobin A1c to estimate glycaemic control in the chronic kidney disease population?

    DEFF Research Database (Denmark)

    Speeckaert, Marijn; Van Biesen, Wim; Delanghe, Joris

    2014-01-01

    BACKGROUND: Although measurement of haemoglobin A1c has become the cornerstone for diagnosing diabetes mellitus in routine clinical practice, the role of this biomarker in reflecting long-term glycaemic control in patients with chronic kidney disease has been questioned. METHODS: Consensus review...... paper based on narrative literature review. RESULTS: As a different association between glycaemic control and morbidity/mortality might be observed in patients with and without renal insufficiency, the European Renal Best Practice, the official guideline body of the European Renal Association...... kidney disease, it still remains the cornerstone as follow-up of longer term glycaemic control, as most clinical trials have used it as reference....

  3. Deworming drugs for soil-transmitted intestinal worms in children: effects on nutritional indicators, haemoglobin and school performance.

    Science.gov (United States)

    Taylor-Robinson, David C; Maayan, Nicola; Soares-Weiser, Karla; Donegan, Sarah; Garner, Paul

    2012-07-11

    The World Health Organization (WHO) recommends treating all school children at regular intervals with deworming drugs in areas where helminth infection is common. The WHO state this will improve nutritional status, haemoglobin, and cognition and thus will improve health, intellect, and school attendance. Consequently, it is claimed that school performance will improve, child mortality will decline, and economic productivity will increase. Given the important health and societal benefits attributed to this intervention, we sought to determine whether they are based on reliable evidence. To summarize the effects of giving deworming drugs to children to treat soil-transmitted intestinal worms (nematode geohelminths) on weight, haemoglobin, and cognition; and the evidence of impact on physical well being, school attendance, school performance, and mortality. In February 2012, we searched the Cochrane Infectious Diseases Group Specialized Register, MEDLINE, EMBASE, LILACS, mRCT, and reference lists, and registers of ongoing and completed trials. We selected randomized controlled trials (RCTs) and quasi-RCTs comparing deworming drugs for geohelminth worms with placebo or no treatment in children aged 16 years or less, reporting on weight, haemoglobin, and formal test of intellectual development. In cluster-RCTs treating communities or schools, we also sought data on school attendance, school performance, and mortality. We included trials that included health education with deworming. At least two authors independently assessed the trials, evaluated risk of bias, and extracted data. Continuous data were analysed using the mean difference (MD) with 95% confidence intervals (CI). Where data were missing, we contacted trial authors. We used GRADE to assess evidence quality, and this is reflected in the wording we used: high quality ("deworming improves...."); moderate quality ("deworming probably improves..."); low quality ("deworming may improve...."); and very low quality

  4. New porcine test-model reveals remarkable differences between algorithms for spectrophotometrical haemoglobin saturation measurements with VLS

    DEFF Research Database (Denmark)

    Gade, John; Greisen, Gorm

    2016-01-01

    UNLABELLED: The study created an 'ex vivo' model to test different algorithms for measurements of mucosal haemoglobin saturation with visible light spectrophotometry (VLS). The model allowed comparison between algorithms, but it also allowed comparison with co-oximetry using a 'gold standard......-oxygenated state ranged from  -32.8 to  +29.9 percentage points and from  -5.0 to  +9.2 percentage points, respectively. CONCLUSION: the algorithms showed remarkable in-between differences when tested on raw-spectra from an 'ex vivo' model. All algorithms had bias, more marked at high oxygenation than low...

  5. Changes in levels of haemoglobin A1c during the first 6 years after diagnosis of clinical type 2 diabetes

    DEFF Research Database (Denmark)

    Olivarius, Niels de Fine; Siersma, V.; Hansen, Lars Jørgen

    2009-01-01

    OBJECTIVE: To assess the variability in levels of glycosylated haemoglobin (HbA(1c)) during the first six years after diagnosis of clinical type 2 diabetes in relation to possible predictors. MATERIAL AND METHODS: Data were from a population-based sample from general practice of 581 newly diagnosed...... the first 6 years after the diagnosis of clinical type 2 diabetes, changes in levels of HbA(1c) show considerable inter-individual variability with age as the only long-term predictor. The results indicate that it is important to monitor changes in HbA(1c) more closely and intensify treatment of those often...

  6. Structural studies of haemoglobin from pisces species shortfin mako shark (Isurus oxyrinchus) at 1.9 Å resolution.

    Science.gov (United States)

    Ramesh, Pandian; Sundaresan, S S; Sathya Moorthy, Pon; Balasubramanian, M; Ponnuswamy, M N

    2013-11-01

    Haemoglobin (Hb) is a tetrameric iron-containing protein that carries oxygen from the lungs to tissues and carbon dioxide from tissues back to the lungs. Pisces are the advanced aquatic vertebrates capable of surviving at wide depth ranges. The shortfin mako shark (SMS) is the pelagic, largest, fastest and most sophisticated species of the shark kingdom with well developed eyes. Mostly the pisces species are cold blooded in nature. Distinctly, the SMSs are warm-blooded animals with an advanced circulatory system. SMSs are capable of maintaining elevated muscle temperatures up to 33 K above the ambient water temperatures at a depth of 150-500 m. SMSs have a diverged air-breathing mechanism compared with other vertebrates. The haemoglobin molecule consists of four polypeptide chains, namely two α chains, each with 140 amino acids and two β chains each having 136 amino acids. The SMS Hb was found to crystallize in monoclinic space group P21 using the hanging-drop vapour-diffusion method at room temperature. The crystal packing parameters for the SMS Hb structure contain one whole biological molecule in the asymmetric unit with a solvent content of 47%. The SMS Hb quaternary structural features interface-interface interactions and heme binding sites are discussed with different state Hbs and the results reveal that SMS Hb adopts an unliganded deoxy T state conformation.

  7. Preliminary investigation of haemoglobin polymorphism and association with morphometric traits in West African Dwarf goats in north central Nigeria

    Directory of Open Access Journals (Sweden)

    Abdulmojeed Yakubu

    2014-03-01

    Full Text Available The aim of this study was to characterize the genetic pool of the West African Dwarf (WAD goats using haemoglobin (Hb polymorphism, as well as the association of some morphological traits with the Hb variants. Blood samples were collected from a total of 104 mature goats of both sexes belonging to the WAD breed in north central Nigeria. The red cell lysates were subjected to cellulose acetate electrophoresis and specific staining procedure to reveal the band patterns of haemoglobin. Three co-dominant alleles, causing the presence of three genotypes (AA, AB and AC were detected among individual goats. The frequencies of the A, B and C alleles were 0.69, 0.30 and 0.01, respectively. The corresponding genotype frequencies for AA, AB and AC in the goat population were 0.37, 0.61 and 0.02, respectively. The discrepancy between the observed and the expected genotype number was significant (P0.05 by Hb variants. There is a need for further study encompassing more number of goats covering larger areas, use of DNA markers and their relationship with economic traits as well as performance study for detailed understanding of breed characteristics, conservation and genetic improvement of WAD goats in north central Nigeria.

  8. Preferred temperature of juvenile Atlantic cod Gadus morhua with different haemoglobin genotypes at normoxia and moderate hypoxia

    DEFF Research Database (Denmark)

    Petersen, Maria Faldborg; Steffensen, John Fleng

    2003-01-01

    .2+/-1.5 degrees C while HbI-1 cod preferred 15.4+/-1.1 degrees C, and this preference was significant. The effect of hypoxia (35% oxygen saturation) on the preferred temperature was also measured. Previous studies showed that the preferred temperature of fish decreases during hypoxia, and this was the case for Hb......I-1 cod, which preferred 9.8+/-1.8 degrees C during hypoxia, whereas HbI-2 cod did not show this effect. The results indicate that environmental temperature changes will lead to a distributional change in the different haemoglobin types of Atlantic cod, global warming providing an advantage for HbI-1...... in northern regions, and the HbI(1) allele dominant in warmer areas. To determine if temperature is a selective parameter in the distribution of the haemoglobin types, the preferred temperature of the homozygous genotypes HbI-1 and HbI-2 was measured. We found that HbI-2 cod preferred a temperature of 8...

  9. Prevalence of glucose-6-phosphate dehydrogenase deficiency and haemoglobin S in high and moderate malaria transmission areas of Muheza, north-eastern Tanzania

    DEFF Research Database (Denmark)

    Segeja, M D; Mmbando, Bruno Paul; Kamugisha, M L

    2008-01-01

    Glucose-6-phosphate dehydrogenase (G6PD) deficiency and haemoglobin S (HbS) are very common genetic disorders in sub Saharan Africa, where malaria is endemic. These genetic disorders have been associated with protection against malaria and are therefore under strong selection pressure by the dise......Glucose-6-phosphate dehydrogenase (G6PD) deficiency and haemoglobin S (HbS) are very common genetic disorders in sub Saharan Africa, where malaria is endemic. These genetic disorders have been associated with protection against malaria and are therefore under strong selection pressure...... by the disease. In November-December 2003, we conducted a cross-sectional survey to determine the prevalence of G6PD deficiency and HbS in the population and relate these to malaria infection and haemoglobin levels in lowland and highland areas of differing malaria transmission patterns of Muheza, Tanzania...

  10. Effect of daily versus weekly home fortification with multiple micronutrient powder on haemoglobin concentration of young children in a rural area, Lao People's Democratic Republic: a randomised trial

    Directory of Open Access Journals (Sweden)

    Kounnavong Sengchanh

    2011-11-01

    Full Text Available Abstract Background Multiple micronutrient deficiencies, in particular iron deficiency anaemia (IDA is a severe public health problem in Lao People's Democratic Republic (Lao PDR. Because of the practical difficulties encountered in improving the nutritional adequacy of traditional complementary foods and the limitations associated with the use of liquid iron supplementation for the treatment and prevention of IDA in infants and young children, recently, home-fortification with multivitamins and minerals sprinkles was recommended. This study aims to compare the effect of twice weekly versus daily supplementation with multivitamins and minerals powder (MMP on anaemia prevalence, haemoglobin concentration, and growth in infants and young children in a rural community in Lao PDR. Methods A randomized trial was conducted in six rural communities. Children aged 6 to 52 months (n = 336 were randomly assigned to a control group (n = 110 or to one of two intervention groups receiving either two sachets per week (n = 115 or a daily sachet (n = 111 of MMP for 24 weeks; 331 children completed the study. A finger prick of blood was taken at baseline, at week 12, and again at week 24 to determine haemoglobin concentration. Anthropometric measurements were taken every 4 weeks. The McNemar test was used to assess within group differences at three time points in the study subjects with anaemia and one-way ANOVA was used to assess changes in mean haemoglobin concentration in the treatment groups. Results MMP supplementation resulted in significant improvements in haemoglobin concentration and in the reduction of anaemia prevalence in the two treatment groups compared with the control group (p Conclusions MMP supplementation had positive effects in reduction of anaemia prevalence and in improving haemoglobin concentration. For severely to moderately anaemic children, daily MMP supplementation was more effective in improving haemoglobin concentration and reducing

  11. Deworming drugs for soil-transmitted intestinal worms in children: effects on nutritional indicators, haemoglobin, and school performance

    Science.gov (United States)

    Taylor-Robinson, David C; Maayan, Nicola; Soares-Weiser, Karla; Donegan, Sarah; Garner, Paul

    2015-01-01

    Background The World Health Organization (WHO) recommends treating all school children at regular intervals with deworming drugs in areas where helminth infection is common. As the intervention is often claimed to have important health, nutrition, and societal effects beyond the removal of worms, we critically evaluated the evidence on benefits. Objectives To summarize the effects of giving deworming drugs to children to treat soil-transmitted helminths on weight, haemoglobin, and cognition; and the evidence of impact on physical well-being, school attendance, school performance, and mortality. Search methods We searched the Cochrane Infectious Diseases Group Specialized Register (14 April 2015); Cochrane Central Register of Controlled Trials (CENTRAL), published in the Cochrane Library (2015, Issue 4); MEDLINE (2000 to 14 April 2015); EMBASE (2000 to 14 April 2015); LILACS (2000 to 14 April 2015); the metaRegister of Controlled Trials (mRCT); and reference lists, and registers of ongoing and completed trials up to 14 April 2015. Selection criteria We included randomized controlled trials (RCTs) and quasi-RCTs comparing deworming drugs for soil-transmitted helminths with placebo or no treatment in children aged 16 years or less, reporting on weight, haemoglobin, and formal tests of intellectual development. We also sought data on school attendance, school performance, and mortality. We included trials that combined health education with deworming programmes. Data collection and analysis At least two review authors independently assessed the trials, evaluated risk of bias, and extracted data. We analysed continuous data using the mean difference (MD) with 95% confidence intervals (CIs). Where data were missing, we contacted trial authors. We used outcomes at time of longest follow-up. The evidence quality was assessed using GRADE. This edition of the Cochrane Review adds the DEVTA trial from India, and draws on an independent analytical replication of a trial from

  12. Relationship between exposure to malaria and haemoglobin level of children 2-9 years old in low malaria transmission settings.

    Science.gov (United States)

    Birhanu, Zewdie; Yihdego, Yemane Ye-Ebiyo; Emana, Daniel; Feyissa, Damtew; Kenate, Silashi; Kebede, Estifanos; Getahun, Kefelegn; Yewhalaw, Delenasaw

    2017-09-01

    In the context of reduced transmission of malaria, it is essential to examine the association between exposure to malaria and haemoglobin level. This study measured the Haemoglobin level of children 2-9 years of age and examined its association with malariometric indices. A cross sectional study was conducted, during June 2016, on 763 children 2-9 years old, recruited from ten sites representing different malaria transmission settings in Ethiopia. Haemoglobin concentration was determined using HemoCue analyzer. Malariometric indices (splenomegaly rate, parasite rate and serological marker) were measured. The overall prevalence of anaemia was 17.3% (95% CI: 14.6-19.9) in the study population. Mild, moderate and severe anaemia accounted for 7.3%, 7.2% and 2.8% respectively. Of the children with anaemia (132), only 7 (5.3%) had malaria parasitaemia. The prevalence of malaria parasitaemia was 3.6% (2/56), 9.1% (5/55) and 0.0% (0/21) among children with mild, moderate and severe anaemia, respectively. Malaria reactive antibody and anaemia co-occurred in 3.13% (21/672) of the samples. Seroprevalence and parasitaemia did not have significant association with anaemia (p>0.05). However, splenomegaly was significantly associated with increased risk of anaemia (AOR=14.93; p=0.001). Anaemia was significantly higher among children 2-4 years old (22.2%), and children living in households without any insecticide treated bed net (34.0%). The prevalence of anaemia was lower by 55.0% among children living in households with at least one net (AOR=0.45, 95% CI: 0.21-0.96). Repeated exposure to malaria infections (seropositive) and parasitaemia was less likely to contribute to development of anaemia among children 2-9 years in this study setting. Thus, in low malaria endemic settings, anaemia prevention and control program required to reconsider the historical evidence that suggests malaria is one of the major risk factor for anaemia. Copyright © 2017. Published by Elsevier B.V.

  13. Haemoglobin changes and risk of anaemia following treatment for uncomplicated falciparum malaria in sub-Saharan Africa.

    Science.gov (United States)

    Zwang, Julien; D'Alessandro, Umberto; Ndiaye, Jean-Louis; Djimdé, Abdoulaye A; Dorsey, Grant; Mårtensson, Andreas A; Karema, Corine; Olliaro, Piero L

    2017-06-23

    Anaemia is common in malaria. It is important to quantitate the risk of anaemia and to distinguish factors related to the natural history of disease from potential drug toxicity. Individual-patient data analysis based on nine randomized controlled trials of treatments of uncomplicated falciparum malaria from 13 sub-Saharan African countries. Risk factors for reduced haemoglobin (Hb) concentrations and anaemia on presentation and after treatment were analysed using mixed effect models. Eight thousand eight hundred ninety-seven patients (77.0% malaria young children with high parasitaemia have the highest risk of anaemia. The majority of patients experience a drop in Hb while on treatment as early as day 1-2, followed by a linear increase through follow-up. The degree of the early Hb dip is determined by pre-treatment parasitaemia and parasite clearance rates. Hb trends and rick of anaemia are independent of treatment.

  14. Cryo-EM structure of haemoglobin at 3.2 Å determined with the Volta phase plate

    Science.gov (United States)

    Khoshouei, Maryam; Radjainia, Mazdak; Baumeister, Wolfgang; Danev, Radostin

    2017-06-01

    With the advent of direct electron detectors, the perspectives of cryo-electron microscopy (cryo-EM) have changed in a profound way. These cameras are superior to previous detectors in coping with the intrinsically low contrast and beam-induced motion of radiation-sensitive organic materials embedded in amorphous ice, and hence they have enabled the structure determination of many macromolecular assemblies to atomic or near-atomic resolution. Nevertheless, there are still limitations and one of them is the size of the target structure. Here, we report the use of a Volta phase plate in determining the structure of human haemoglobin (64 kDa) at 3.2 Å. Our results demonstrate that this method can be applied to complexes that are significantly smaller than those previously studied by conventional defocus-based approaches. Cryo-EM is now close to becoming a fast and cost-effective alternative to crystallography for high-resolution protein structure determination.

  15. Analysis of native human plasma proteins and haemoglobin for the presence of bityrosine by high-performance liquid chromatography

    DEFF Research Database (Denmark)

    Daneshvar, B; Frandsen, H; Dragsted, L O

    1997-01-01

    fluorescent substance, bityrosine. High-performance liquid chromatography (HPLC) analysis of acid hydrolyzed serum albumin after oxidation with peroxidase/H2O2 or with Cu++/H2O2 showed that bityrosine had been formed whereas oxidation of this protein with Fe(III)/ascorbate did not result in the formation......Generation of reactive oxygen species in vivo results in oxidative-damage to cellular components, including proteins. Due to the relatively long half-lives of several blood proteins the cumulative formation of oxidatively damaged proteins might serve as a biomarker for reactive oxygen species...... of bityrosine. Bityrosine could not be detected in human plasma proteins or haemoglobin with the detection limit of one pmol per mg protein....

  16. Trimester-specific reference intervals for haemoglobin A(1c) (HbA(1c)) in pregnancy.

    LENUS (Irish Health Repository)

    O'Connor, Catherine

    2011-11-26

    Abstract Background: Diabetes in pregnancy imposes additional risks to both mother and infant. These increased risks are considered to be primarily related to glycaemic control which is monitored by means of glycated haemoglobin (HbA(1c)). The correlation of HbA(1c) with clinical outcomes emphasises the need to measure HbA(1c) accurately, precisely and for correct interpretation, comparison to appropriately defined reference intervals. Since July 2010, the HbA(1c) assay in Irish laboratories is fully metrologically traceable to the IFCC standard. The objective was to establish trimester-specific reference intervals in pregnancy for IFCC standardised HbA(1c) in non-diabetic Caucasian women. Methods: The authors recruited 311 non-diabetic Caucasian pregnant (n=246) and non-pregnant women (n=65). A selective screening based on risk factors for gestational diabetes was employed. All subjects had a random plasma glucose <7.7 mmol\\/L and normal haemoglobin level. Pregnancy trimester was defined as trimester 1 (T1, n=40) up to 12 weeks +6 days, trimester 2 (T2, n=106) 13-27 weeks +6 days, trimester 3 (T3, n=100) >28 weeks to term. Results: The normal HbA(1c) reference interval for Caucasian non-pregnant women was 29-37 mmol\\/mol (Diabetes Control and Complications Trial; DCCT: 4.8%-5.5%), T1: 24-36 mmol\\/mol (DCCT: 4.3%-5.4%), T2: 25-35 mmol\\/mol (DCCT: 4.4%-5.4%) and T3: 28-39 mmol\\/mol (DCCT: 4.7%-5.7%). HbA(1c) was significantly decreased in trimesters 1 and 2 compared to non-pregnant women. Conclusions: HbA(1c) trimester-specific reference intervals are required to better inform the management of pregnancies complicated by diabetes.

  17. Activating mitochondrial function and haemoglobin expression with EH-201, an inducer of erythropoietin in neuronal cells, reverses memory impairment.

    Science.gov (United States)

    Horng, Lin-Yea; Hsu, Pei-Lun; Chen, Li-Wen; Tseng, Wang-Zou; Hsu, Kai-Tin; Wu, Chia-Ling; Wu, Rong-Tsun

    2015-10-01

    Memory impairment can be progressive in neurodegenerative diseases, and physiological ageing or brain injury, mitochondrial dysfunction and oxidative stress are critical components of these issues. An early clinical study has demonstrated cognitive improvement during erythropoietin treatment in patients with chronic renal failure. As erythropoietin cannot freely cross the blood-brain barrier, we tested EH-201 (2,3,5,4'-tetrahydroxystilbene-2-O-β-d-glucoside, also known as TSG), a low MW inducer of erythropoietin, for its therapeutic effects on memory impairment in models of neurodegenerative diseases, physiological ageing or brain injury. The effects of EH-201 were investigated in astrocytes and PC12 neuronal-like cells. In vivo, we used sleep-deprived (SD) mice as a stress model, amyloid-β (Aβ)-injected mice as a physiological ageing model and kainic acid (KA)-injected mice as a brain damage model to assess the therapeutic effects of EH-201. EH-201 induced expression of erythropoietin, PPAR-γ coactivator 1α (PGC-1α) and haemoglobin in astrocytes and PC12 neuronal-like cells. In vivo, EH-201 treatment restored memory impairment, as assessed by the passive avoidance test, in SD, Aβ and KA mouse models. In the hippocampus of mice given EH-201 in their diet, levels of erythropoietin, PGC-1α and haemoglobin were increased The induction of endogenous erythropoietin in neuronal cells by inducers such as EH-201 might be a therapeutic strategy for memory impairment in neurodegenerative disease, physiological ageing or traumatic brain injury. © 2015 The Authors. British Journal of Pharmacology published by John Wiley & Sons Ltd on behalf of The British Pharmacological Society.

  18. The inherited diseases of haemoglobin are an emerging global health burden

    Directory of Open Access Journals (Sweden)

    S. Fucharoen

    2011-12-01

    Full Text Available Thalasseamia is one of the common genetic disorders. A genetic defect causes reduction of the globin chains leading to chronic haemolytic anaemia from birth. The mainstay of treatment is blood transfusion to maintain adequate levels of the haemoglobin. Secondary iron overload in β-thalassaemia patients is secondary to multiple blood transfusions and increased iron absorption. Excesses iron potentially catalyses free-radicals generation and impairment in cellular function and integrity. Extensive iron-induced injury develops in the heart, liver, pancreas and endocrine system. In regularly transfused patients, in the absence of iron-chelation therapy, death from iron-induced heart failure occurs by the mid-teenage years. Conventional treatment with the parenteral iron chelator desferrioxamine improves mortality but it is too expensive for middle and lowincome countries. Oral iron chelators, such as deferiprone (L1 and deferasirox, appear to be promising, however, they are still too expensive or need special monitoring. Serum ferritin has been used for many years as a guide for chelation therapy. However, recent studies demonstrated that using serum ferritin or liver iron measurements as a monitor of iron-chelation intensive therapy would have been discontinued long before the iron had cleared from the heart. There is evidence of the value of myocardial T2* measurements by MRI for the detection of early cardiac iron overload which cannot be predicted by liver iron or serum ferritin and for the monitoring of iron-chelation therapy. The major problem is the expensiveness of MRI measurement. In conclusion, the problem of iron chelation in low-income countries may be summarized as follows: i drugs, are not available in every countries that need the medicine, ii the cost of drugs is too high for most low income countries, iii there is poor education of doctor, parents/ patients and local government about the benefit of iron chelation, iv there is need

  19. Haemoglobin J-Baltimore can be detected by HbA1c electropherogram but with underestimated HbA1c value.

    Science.gov (United States)

    Brunel, Valéry; Lahary, Agnčs; Chagraoui, Abdeslam; Thuillez, Christian

    2016-01-01

    Glycated haemoglobin (HbA(1c)) is considered the gold standard for assessing diabetes compensation and treatment. In addition, fortuitous detection of haemoglobin variants during HbA1c measurement is not rare. Recently, two publications reported different conclusions on accuracy of HbA(1c) value using capillary electrophoresis method in presence of haemoglobin J-Baltimore (HbJ).
Here we describe the fortuitous detection of unknown HbJ using capillary electrophoresis for measurement of HbA(1c). A patient followed for gestational diabetes in our laboratory presented unknown haemoglobin on Capillarys 2 Flex Piercing analyser which was identified as HbJ. HbJ is not associated with haematological abnormalities. High Performance Liquid Chromatography methods are known to possibly underestimate HbA(1c) value in the presence of this variant. This variant and its glycated form are clearly distinguished on electropherogram but HbJ was responsible for underestimating the true area of HbA(1c).
 Capillary electrophoresis is a good method for detecting HbJ but does not seem suitable for evaluation of HbA(1C) value in patients in presence of HbJ variant.

  20. Rapid screening for glucose-6-phosphate dehydrogenase deficiency and haemoglobin polymorphisms in Africa by a simple high-throughput SSOP-ELISA method

    DEFF Research Database (Denmark)

    Enevold, Anders; Vestergaard, Lasse S; Lusingu, John

    2005-01-01

    BACKGROUND: Mutations in the haemoglobin beta-globin (HbB) and glucose-6-phosphate dehydrogenase (G6PD) genes cause widespread human genetic disorders such as sickle cell diseases and G6PD deficiency. In sub-Saharan Africa, a few predominant polymorphic variants of each gene account for a majority...

  1. Self-care activities and glycated haemoglobin in Iranian patients with type 2 diabetes: can coping styles and social support have a buffering role?

    Science.gov (United States)

    Shayeghian, Zeinab; Aguilar-Vafaie, Maria E; Besharat, Mohammad Ali; Amiri, Parisa; Parvin, Mahmoud; Gillani, Kobra Roohi; Hassanabadi, Hamidreza

    2015-01-01

    Diabetes self-care is a key element in the overall management of diabetes. However, the importance of psychosocial factors for successful disease management is under investigated. This study aimed at exploring the role of coping styles and social support in the relationship between self-care activities and glycated haemoglobin in patients with type 2 diabetes. One hundred adults (60% female, aged 40-70 years) with type 2 diabetes completed questionnaires assessing self-care activities, coping styles and social support. In addition, a blood test was performed to obtain glycated haemoglobin levels. Result showed significant relationships of glycated haemoglobin with self-care activities, coping styles and social support. Regression analysis indicated that social support had a moderating role on the relationship between self-care activities and glycated haemoglobin, such that, at very high levels of social support the association, between Self-Care and HbA1c disappears. Findings indicate that health care providers, within the context of the Iranian social and cultural situation, should pay more attention to psychosocial factors when addressing self-care activities. Delineation of the role of coping styles and social support might be useful for identifying patients in need of particular counselling and support for improving self-care activities and HbA1c levels.

  2. Diagnosis and dosimetry of exposure to sulfur mustard: Development of a standard operating procedure for mass spectrometric analysis of haemoglobin adducts - Exploratory research on albumin and keratin adducts

    NARCIS (Netherlands)

    Noort, D.; Fidder, A.; Hulst, A.G.; Jong, L.P.A. de; Benschop, H.P.

    2000-01-01

    Experiments were carried out to develop a standard operating procedure for analysis of sulfur mustard adducts to the N-terminal valine in haemoglobin and to explore adduct formation with albumin and keratin. In the first approach, gas chromatography-negative chemical ionization/mass spectrometry

  3. Prevalence of positive urinary dipstick analysis (leucocyte esterase, nitrite, haemoglobin, or glucose) in a population of 3645 adult subjects--consequence for measurement of urinary albumin excretion rate

    DEFF Research Database (Denmark)

    Clausen, P; Jensen, J S; Borch-Johnsen, K

    1998-01-01

    OBJECTIVES: To assess prevalence of positive urinary dipstick analysis for leucocyte esterase, nitrite, haemoglobin, or glucose in the general population and measure the urinary albumin excretion rate (UAER) in subjects with or without a positive dipstick analysis. DESIGN: A cross-sectional study...

  4. Haemoglobins with multiple reactive sulfhydryl groups: Reactions of 5,5'-dithiobis (2-nitrobenzoate with CysF9[93]β and CysH3[125]β of guinea pig haemoglobin

    Directory of Open Access Journals (Sweden)

    J. Oyebamiji Babalola

    2002-12-01

    Full Text Available Guinea pig haemoglobin has six sulfhydryl groups, one at each of the positions F9[93]β, G11[104]α and H3[125]β, which appear in pairs. Titration with p-hydroxymercuri(II-benzoic acid and with 5,5'-dithiobis(2-nitrobenzoic acid (DTNB indicate that four of the six sulfhydryls are reactive. The time course of the DTNB reaction is triphasic at pH greater than 7. The fast phase is about 2 orders of magnitude faster than the intermediate phase and can be clearly separated from it. The intermediate phase, where it exists, is about 3-4 times faster than the slow phase. However, the amplitude of the intermediate phase, which has a maximum of about 15% of the total signal amplitude, becomes negligible as it approaches pH 7, so that the kinetics eventually becomes biphasic. The pH dependence profile of kapp, the apparent second-order rate constant, for the fast phase resembles the titration curve of a diprotic acid. Quantitative analysis indicates that the reactivity of the sulfhydryl group to which this phase may be attributed is linked to two ionizable groups with pKas of 6.4 plus or minus 0.1 and 7.8 plus or minus 0.2. These values are assigned to HisHC3[146]β and CysF9[93]β, respectively. The pH dependence profile of kapp for the slow phase resembles the titration curve of a monoprotic acid. Quantitative analysis indicates that the sulfhydryl group to which this phase may be attributed is linked to a single ionizable group with a pKa of 6.1 plus or minus 0.2. Examination of the structure of guinea pig haemoglobin near the H3[125]β position shows that there is a lysine residue, LysA5[8]β, which is only 4  (0.4 nm away from CysH3[125]β. The presence of this lysine lowers the pKa of CysH3[125]β from the normal value for sulfhydryl groups (between 8 and 8.5 to 6.1.

  5. Antenatal Iron Supplementation Regimens for Pregnant Women in Rural Vietnam and Subsequent Haemoglobin Concentration and Anaemia among Their Infants.

    Directory of Open Access Journals (Sweden)

    Thach Duc Tran

    Full Text Available Little evidence about the effects of antenatal iron supplementation on infant anaemia is available. The aim was to compare effects on six-month-old infants' Haemoglobin (Hb concentration and anaemia of daily iron-folic acid (IFA, twice-weekly IFA with or without other micronutrients (MMN and usual antenatal care in rural Vietnam.Secondary data analysis from: a prospective population-based observational study (OS which examined effects of antenatal psychosocial factors, anaemia and iron deficiency on infant development and health; and a three-arm cluster randomised trial (CRT of different antenatal iron supplementation regimens. In the OS 497 women (<20 weeks gestation from 50 randomly-selected communes participated, and in the CRT 1,258 pregnant women (<16 weeks gestation in 104 communes were allocated randomly to trial arms. The main outcome was six-month-old infant Hb concentration. Baseline data included women's socio-demographic characteristics, reproductive health, Hb and serum ferritin. Mean differences in infant Hb and odds ratios of infant anaemia between CRT arms and OS were calculated by multivariable regression models, controlling for baseline differences and clustering, using robust standard errors. Infant anaemia prevalence was 68.6% in the OS, 47.2% daily IFA, 53.5% weekly IFA, and 50.3% MMN conditions. After adjustment, mean infant haemoglobin levels in daily IFA (mean difference = 0.95 g/dL; 95%CI 0.7-11.18; weekly IFA (0.91; 95%CI 0.69-1.12 and MMN (1.04; 95%CI 0.8-1.27 were higher than in the OS. After adjustment there were lower odds ratios of anaemia among infants in the daily IFA (OR = 0.31; 95% CI 0.22-0.43, weekly IFA (0.38; 95%CI 0.26-0.54 and MMN (0.33; 95%CI 0.23-0.48 groups than in the OS.Infant anaemia is a public health problem in Vietnam and other resource-constrained countries. All supplementation regimens could have clinically significant benefits for Hb and reduce anaemia risk among six-month-old infants

  6. Socioeconomic determinants of haemoglobin levels of African women are less important in areas with more health facilities: a multilevel analysis.

    Science.gov (United States)

    Haverkate, Manon; Smits, Jeroen; Meijerink, Hinta; van der Ven, André

    2014-02-01

    The prevalence of anaemia in Africa is the highest in the world. Especially women are at risk because of blood loss during menstruation and increased iron requirements during pregnancy. This study examined determinants of the haemoglobin (Hb) level of African women at individual/household, cluster, district, and national level. Special attention was paid to socioeconomic factors and the presence of health facilities. Data were derived from Demographic and Health Surveys conducted between 2003 and 2010 in 21 African countries. We included all women aged 15-49 who participated in a women's survey and had a Hb measurement. Multilevel models were used to examine the influence of various factors at different hierarchical levels simultaneously. 104 899 women were included in the study, of which 23.1% were anaemic (Hb<110 g/L). Socioeconomic factors were strongly related to the Hb level of women. Wealth, education, having a job, occupation of the partner, presence of a toilet facility, context educational level and preventive health measures were positively associated with the Hb level. Interaction analysis indicated that socioeconomic differences in the Hb level of women were reduced by the presence of health facilities. Interventions aimed at improving the Hb level of African women should take socioeconomic and contextual aspects into account. Increasing availability of health facilities might be a tool for reducing socioeconomic differences.

  7. Cryo-EM structure of haemoglobin at 3.2 Å determined with the Volta phase plate

    Science.gov (United States)

    Khoshouei, Maryam; Radjainia, Mazdak; Baumeister, Wolfgang; Danev, Radostin

    2017-01-01

    With the advent of direct electron detectors, the perspectives of cryo-electron microscopy (cryo-EM) have changed in a profound way. These cameras are superior to previous detectors in coping with the intrinsically low contrast and beam-induced motion of radiation-sensitive organic materials embedded in amorphous ice, and hence they have enabled the structure determination of many macromolecular assemblies to atomic or near-atomic resolution. Nevertheless, there are still limitations and one of them is the size of the target structure. Here, we report the use of a Volta phase plate in determining the structure of human haemoglobin (64 kDa) at 3.2 Å. Our results demonstrate that this method can be applied to complexes that are significantly smaller than those previously studied by conventional defocus-based approaches. Cryo-EM is now close to becoming a fast and cost-effective alternative to crystallography for high-resolution protein structure determination. PMID:28665412

  8. Body Mass Index, Haemoglobin, and Total Lymphocyte Count as a Surrogate for CD4 Count in Resource Limited Settings

    Science.gov (United States)

    Tunu, Bismark Kwame

    2017-01-01

    Background. In view of the lack of evidence on the possibility of an economically viable, easy, and readily available biomarker to substitute the traditional role of CD4 counts in HIV disease progression, this study seeks to investigate the potential use of body mass index (BMI), haemoglobin (Hb), and total lymphocyte count (TLC) as surrogate biomarkers for monitoring the disease. Methods. This cross-sectional study was undertaken at the antiretroviral clinic (ART) of the Bomso Hospital, Kumasi, Ghana. We recruited 384 individuals who were 18 years or older and confirmed HIV seropositive patients. Blood samples were assayed for TLC and Hb. Weight and height were determined and BMI was calculated. Result. At a cut-off point of 12.15 g/dL, Hb had sensitivity and specificity of 73.9% and 56.8%, respectively, whereas BMI had 69.6% and 80.1% sensitivity and specificity, respectively. The sensitivity and specificity were also 100% among the studied participants at a cut-off point of 1200 mm−3 for TLC. There was a significant positive correlation between CD4 count and Hb (rho 0.262, p = 0.0001), BMI (rho 0.301, p = 0.0001), and TLC (rho 0.834, p = 0.0001). Conclusion. The study demonstrates that TLC, Hb, and BMI may provide some useful prognostic information independent of that provided by CD4 count. PMID:28484663

  9. Alpha- and beta-cell abnormalities in haemoglobin A1c-defined prediabetes and type 2 diabetes

    DEFF Research Database (Denmark)

    Calanna, Salvatore; Scicali, Roberto; Di Pino, Antonino

    2014-01-01

    New recommendations for the use of glycated haemoglobin A1c (HbA1c) to diagnose prediabetes and type 2 diabetes have changed the constitution of the two populations. We aimed to investigate the pathophysiological characteristics of individuals with HbA1c-defined prediabetes and type 2 diabetes......-defined type 2 diabetes compatible with the previously described pathophysiology of plasma glucose-defined type 2 diabetes. Furthermore, in HbA1c-defined prediabetes, we show defective insulin response in combination with inappropriate suppression of glucagon, which may constitute new targets......, respectively. Ten subjects with HbA1c-defined prediabetes, i.e. HbA1c from 5.7 to 6.4 % (39-46 mmol/mol), eight newly diagnosed patients with HbA1c-defined type 2 diabetes [HbA1c ≥6.5 % (≥48 mmol/mol)], and ten controls with HbA1c lower than 5.7 % (

  10. Malaria and hookworm infections in relation to haemoglobin and serum ferritin levels in pregnancy in Masindi district, western Uganda.

    Science.gov (United States)

    Ndyomugyenyi, Richard; Kabatereine, Narcis; Olsen, Annette; Magnussen, Pascal

    2008-02-01

    This study examined the predictors of haemoglobin (Hb) concentration and serum ferritin (SF) levels in pregnant women in an area of stable malaria transmission and high prevalence of intestinal helminth infections. In total, 834 women attending antenatal care for the first time were examined. Blood slides for malaria parasites were prepared for 802, of which 154 were primigravidae (PG) and 648 were multigravidae (MG). Malaria parasitaemia rate was 42.6% (66) in PG and 33.3% (216) in MG (P=0.04). The geometric mean parasite density was 1695.8 (95% CI 1005.0-2386.5) in PG and 922.7 (95% CI 626.7-1382.6) in MG (P=0.02). Anaemia (Hb<100g/l) was found in 18.0% (94) of aparasitaemic women compared to 28.5% (80) among parasitaemic women (P<0.001). The prevalence of anaemia was 15.1% (42) in women without hookworm infection compared to 23.3% (129) among infected women (P=0.006). Malaria parasitaemia, hookworm infection, C-reactive protein, gravidity and gestational age were associated with Hb status. Malaria parasitaemia, Ascaris lumbricodes and Trichuris trichiura infections and age were associated with SF. Malaria, hookworm infections and iron deficiency were associated with anaemia in the study population.

  11. Critical insight into the interaction of naringenin with human haemoglobin: A combined spectroscopic and computational modeling approaches

    Science.gov (United States)

    Maity, Subhajit; Chakraborty, Sandipan; Chakraborti, Abhay Sankar

    2017-02-01

    The present study demonstrates critical insight into the binding of a bioactive flavanone naringenin with normal human haemoglobin (NHb). Both spectrophotometric and spectrofluorimetric studies reveal that naringenin interacts with NHb. The binding affinity constant and number of binding sites appear to be approximately (1.5 ± 0.2) × 104 M-1 and 1, respectively. Static quenching seems to be an important factor in binding process, as evident from steady-state and time-resolved fluorescence spectroscopic studies. Far UV circular dichroism spectroscopy depicts that binding of naringenin to NHb causes no change in the secondary structure of the protein, which is also evident from Fourier transform infrared spectroscopic study. Free energy change (ΔG0) for naringenin-NHb interaction, determined by spectroscopic and isothermal calorimetric method, appears to be -5.67 kcal/mol and -6.90 kcal/mol, respectively, and is close to the docking energy -6.84 kcal/mol. Molecular docking suggests that naringenin binds near the cavity of the tetrameric heme protein, forming hydrogen bonds with surrounding amino acid residues. The binding site is away from the heme moieties, implicating naringenin binding does not affect the oxygen binding capacity of NHb, which makes the protein a suitable carrier of the flavonoid.

  12. Evaluation of a serodiagnostic test using Ascaris suum haemoglobin for the detection of roundworm infections in pig populations

    DEFF Research Database (Denmark)

    Vlaminck, Johnny; Nejsum, Peter; Vangroenweghe, Frédéric

    2012-01-01

    . suis infection was shown to be limited after analysing sera from pigs with an experimental T. suis mono-infection. Seroconversion was shown to occur from week 6 onwards in pigs receiving 100 A. suum eggs 5 times a week. Preliminary testing of the ELISA on six randomly selected farms confirmed......% of the tested samples were seropositive, while in 19.8% of the farms 80-100% of all pigs were seropositive. The results of this study suggest that the AsHb ELISA could provide pig farmers and veterinarians with an easier and more sensitive way to estimate the overall prevalence of A. suum on their farm....... of a novel indirect ELISA using the purified A. suum haemoglobin (AsHb) molecule as an antigen. Initial validation using sera from 190 pigs experimentally infected twice a week with A. suum and Trichuris suis (25 and 5 eggs kg(-1)day(-1) respectively) demonstrated that the AsHb ELISA is able to detect long...

  13. Crystallization and Preliminary Structural Analysis of the Giant Haemoglobin from Glossoscolex paulistus at 3.2 Angstrom

    Energy Technology Data Exchange (ETDEWEB)

    J Bachega; l Bleicher; E Horjales; p Santiago; R Garratt; M Tabak

    2011-12-31

    Glossoscolex paulistus is a free-living earthworm encountered in south-east Brazil. Its oxygen transport requirements are undertaken by a giant extracellular haemoglobin, or erythrocruorin (HbGp), which has an approximate molecular mass of 3.6 MDa and, by analogy with its homologue from Lumbricus terrestris (HbLt), is believed to be composed of a total of 180 polypeptide chains. In the present work the full 3.6 MDa particle in its cyanomet state was purified and crystallized using sodium citrate or PEG8000 as precipitant. The crystals contain one-quarter of the full particle in the asymmetric unit of the I222 cell and have parameters of a = 270.8 {angstrom}, b = 320.3 {angstrom} and c = 332.4 {angstrom}. Diffraction data were collected to 3.15 {angstrom} using synchrotron radiation on beamline X29A at the Brookhaven National Laboratory and represent the highest resolution data described to date for similar erythrocruorins. The structure was solved by molecular replacement using a search model corresponding to one-twelfth of its homologue from HbLt. This revealed that HbGp belongs to the type I class of erythrocruorins and provided an interpretable initial electron density map in which many features including the haem groups and disulfide bonds could be identified.

  14. Comparative clinical evaluation of glycosylated haemoglobin level in healthy and chronic periodontitis patients: A chairside diagnostic method

    Directory of Open Access Journals (Sweden)

    T S Srinivasa

    2015-01-01

    Full Text Available Objective and Background: Glycosylated haemoglobin (HbA1c level can consequently be interpreted as an average of the blood glucose present over the past 3-4 months. Periodontitis is associated with glycemic control in patients with diabetes. The purpose of this study was to determine the level of HbA1c in healthy and periodontitis patients who were previously not diagnosed with diabetes mellitus. Materials and Methods: A total of 40 patients were selected for study and divided into two groups. Group 1 included patients with a healthy periodontium, and Group 2 included patients suffering from chronic periodontitis. Finger stick blood was collected by special collection unit (A1CNOW +® Bayer Health Care, Tarrytown New York, USA, for estimating level of HbA1c. Result: Both groups showed similar HbA1c levels clinically with slight increase in levels in the test group, but was statistically significant (test - 5.66 ± 0.35%, control - 5.17 ± 0.3% P = 0.003. Conclusion: Indians are at a high-risk of developing periodontitis and diabetes. These data suggest a possible link between periodontitis and glycemic control in nondiabetic individuals, periodontal disease may be a potential contributor to the development of type 2 diabetes.

  15. The importance of haemoglobin level and effect of transfusion in HNSCC patients treated with radiotherapy--results from the randomized DAHANCA 5 study

    DEFF Research Database (Denmark)

    Hoff, Camilla Molich; Hansen, Hanne Sand; Overgaard, Marie

    2011-01-01

    Patients with head and neck squamous cell carcinoma (HNSCC) and a low level of haemoglobin (Hb) often have a poor response to radiation which may be related to hypoxia induced radioresistance. The aim of the study was to evaluate the prognostic significance of low Hb level and its modification by...... by transfusion in HNSCC patients treated with radiotherapy. The study was performed as a subrandomization in the DAHANCA 5 trial.......Patients with head and neck squamous cell carcinoma (HNSCC) and a low level of haemoglobin (Hb) often have a poor response to radiation which may be related to hypoxia induced radioresistance. The aim of the study was to evaluate the prognostic significance of low Hb level and its modification...

  16. Restoration of Haemoglobin Level Using Hydrodynamic Gene Therapy with Erythropoietin Does Not Alleviate the Disease Progression in an Anaemic Mouse Model for TGFβ1-Induced Chronic Kidney Disease

    DEFF Research Database (Denmark)

    Pedersen, Lea Hougaard; Wogensen, Lise; Marcussen, N.

    2015-01-01

    expressed in non-haematopoietic tissue and today, Epo is recognised as a cytokine with many pleiotropic effects. We hypothesize that hydrodynamic gene therapy with Epo can restore haemoglobin levels in anaemic transgenic mice and that this will attenuate the extracellular matrix accumulation in the kidneys....... The experiment is conducted by hydrodynamic gene transfer of a plasmid encoding murine Epo in a transgenic mouse model that overexpresses TGF-β1 locally in the kidneys. This model develops anaemia due to chronic kidney disease characterised by thickening of the glomerular basement membrane, deposition...... of mesangial matrix and mild interstitial fibrosis. A group of age matched wildtype littermates are treated accordingly. After a single hydrodynamic administration of plasmid DNA containing murine EPO gene, sustained high haemoglobin levels are observed in both transgenic and wildtype mice from 7.5 ± 0.6 mmol...

  17. Cross-linking with O-raffinose lowers oxygen affinity and stabilizes haemoglobin in a non-cooperative T-state conformation.

    Science.gov (United States)

    Jia, Yiping; Ramasamy, Somasundaram; Wood, Francine; Alayash, Abdu I; Rifkind, Joseph M

    2004-12-01

    O-R-polyHbA(0) is an intra- and intermolecularly O-raffinose cross-linked derivative of deoxygenated human haemoglobin developed as an oxygen therapeutic. When compared with its native protein (HbA(0)), O-R-polyHbA(0) was found to be locked in the T (tense) quaternary conformation with a lower oxygen affinity, a reduced Bohr effect (50% of HbA(0)) and no measurable cooperativity (h=1). The kinetics of oxygen and CO binding to the protein indicate lower 'on' rates and faster 'off' rates than HbA(0) and the absence of effects of inositol hexaphosphate (IHP) on the kinetics. Other properties consistent with a T-like conformation are inaccessibility of the betaCys-93 thiol group of O-R-polyHbA(0), the hyperfine splitting from nitrogen in the EPR spectrum of the Fe(II)NO complex of O-R-polyHbA(0) and decreased flexibility in the distal haem pocket, as indicated by low-spin bis-histidine complexes detected by EPR of oxidized chains. A comparison of the properties of O-R-polyHbA(0) with those of HbA(0) with and without IHP, as well as the reaction of nitrite with deoxygenated haemoglobin, provide additional insights into the variations in the conformation of T-state haemoglobin in solution (modifications of the T state produced by adding organic phosphates, like IHP and 2,3-diphosphoglycerate). Although the physiological ramifications of locking HbA(0) in the T conformation with the O-raffinose are still unknown, valuable insights into haemoglobin function are provided by these studies of O-R-polyHbA(0).

  18. Effect of feed supplementation with a-ketoglutarate, combined with vitamin B6 or C, on the performance and haemoglobin and amino acid levels in growing rats

    DEFF Research Database (Denmark)

    Pierzynowski, Stefan Grzegorz; Filip, Rafal; Harrison, Adrian Paul

    2007-01-01

    The aim of the study was to evaluate the influence of a-ketoglutarate (AKG), at pH 2 or 5, combined with vitamin B6 (AKG 2B, AKG 5B) or C (AKG 2C, AKG 5C), on the performance and haemoglobin and amino acid levels in growing rats. Eighty rats were divided into 5 treatment groups and stayed on trial...

  19. Simultaneous quantification of haemoglobin adducts of ethylene oxide, propylene oxide, acrylonitrile, acrylamide and glycidamide in human blood by isotope-dilution GC/NCI-MS/MS.

    Science.gov (United States)

    Schettgen, T; Müller, J; Fromme, H; Angerer, J

    2010-10-01

    Haemoglobin adducts are highly valuable biomarkers of cumulative exposure to carcinogenic substances. We have developed and applied an analytical method for the simultaneous quantification of five haemoglobin adducts of important occupational and environmental carcinogens. The N-terminal adducts were determined with gas chromatography as pentafluorophenylthiohydantoine derivatives according to the modified Edman-procedure and subsequent acetonization of the glycidamide adduct N-(R,S)-2-hydroxy-2-carbamoylethylvaline (GAVal). The use of self-synthesized labelled internal standards in combination with tandem mass spectrometry using negative chemical ionisation guarantees both high accuracy and sensitivity of our determination. The limit of detection for N-2-hydroxyethylvaline (HEVal), N-(R,S)-2-hydroxypropylvaline (HPVal), N-2-carbamoylethylvaline (AAVal) and N-(R,S)-2-hydroxy-2-carbamoylethylvaline (GAVal) was 2 pmol/g globin, for N-2-cyanoethylvaline (CEVal) it was determined as 0.5 pmol/g globin, which was sufficient to determine the background levels of these adducts in the non-smoking general population. The between-day-precision for all analytes using a human blood sample as quality control material ranged from 4.7 to 12.3%. We investigated blood samples of a small group (n=104) of non-smoking persons of the general population for the background levels of these haemoglobin adducts. The median values for HEVal, HPVal, CEVal, AAVal and GAVal in a group of 92 non-smoking persons were 18.1, 4.1, acrylonitrile caused by passive smoking as indicated by higher levels of the corresponding haemoglobin adduct CEVal. Copyright © 2009 Elsevier B.V. All rights reserved.

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Bini Ramachandran. Articles written in Journal of Biosciences. Volume 37 Issue 4 September 2012 pp 617-633 Articles. Recombinant E. coli expressing Vitreoscilla haemoglobin prefers aerobic metabolism under microaerobic conditions: A proteome-level study · Bini Ramachandran ...

  1. Global, regional, and national trends in haemoglobin concentration and prevalence of total and severe anaemia in children and pregnant and non-pregnant women for 1995-2011: a systematic analysis of population-representative data

    National Research Council Canada - National Science Library

    Stevens, Gretchen A; Finucane, Mariel M; De-Regil, Luz Maria; Paciorek, Christopher J; Flaxman, Seth R; Branca, Francesco; Peña-Rosas, Juan Pablo; Bhutta, Zulfiqar A; Ezzati, Majid

    2013-01-01

    .... We estimated trends in the distributions of haemoglobin concentration and in the prevalence of anaemia and severe anaemia in young children and pregnant and non-pregnant women between 1995 and 2011...

  2. Haemoglobin A1c, fasting glucose, serum C-peptide and insulin resistance in relation to serum uric acid levels-the Third National Health and Nutrition Examination Survey

    National Research Council Canada - National Science Library

    Choi, H. K; Ford, E. S

    2008-01-01

    Objective. To evaluate haemoglobin A1c (HbA1c), fasting glucose, serum C-peptide and insulin resistance in relation to serum uric acid levels in a nationally representative sample of men and women. Methods...

  3. The effects of age on associations between markers of HIV progression and markers of metabolic function including albumin, haemoglobin and lipid concentrations.

    Science.gov (United States)

    Samuel, M; Jose, S; Winston, A; Nelson, M; Johnson, M; Chadwick, D; Fisher, M; Leen, C; Gompels, M; Gilson, R; Post, F A; Hay, P; Sabin, C A

    2014-05-01

    We investigated whether age modified associations between markers of HIV progression, CD4 T lymphocyte count and HIV RNA viral load (VL), and the following markers of metabolic function: albumin, haemoglobin, high-density lipoprotein cholesterol (HDL-C), low-density lipoprotein cholesterol (LDL-C) and total cholesterol (TC). A retrospective analysis of data from the United Kingdom Collaborative HIV Cohort was carried out. Analyses were limited to antiretroviral-naïve subjects to focus on the impact of HIV disease itself. A total of 16670 subjects were included in the analysis. Multilevel linear regression models assessed associations between CD4 count/VL and each of the outcomes. Statistical tests for interactions assessed whether associations differed among age groups. After adjustment for gender and ethnicity, there was evidence that lower CD4 count and higher VL were associated with lower TC, LDL-C, haemoglobin and albumin concentrations but higher triglyceride concentrations. Age modified associations between CD4 count and albumin (P 50 and > 50 years, a 50 cells/μL lower CD4 count correlated with a 2.4 [95% confidence interval (CI) 1.7-3.0], 3.6 (95% CI 3.2-4.0) and 5.1 (95% CI 4.0-6.1) g/L lower haemoglobin concentration and a 0.09 (95% CI 0.07-0.11), 0.12 (95% CI 0.11-0.13) and 0.16 (95% CI 0.13-0.19) g/L lower albumin concentration, respectively. We present evidence that age modifies associations between CD4 count and plasma albumin and haemoglobin levels. A given reduction in CD4 count was associated with a greater reduction in haemoglobin and albumin concentrations among older people living with HIV. These findings increase our understanding of how the metabolic impact of HIV is influenced by age. © 2013 The Authors. HIV Medicine published by John Wiley & Sons Ltd on behalf of British HIV Association.

  4. Glucose-6-Phosphate Dehydrogenase Deficiency and Haemoglobin Drop after Sulphadoxine-Pyrimethamine Use for Intermittent Preventive Treatment of Malaria during Pregnancy in Ghana – A Cohort Study

    Science.gov (United States)

    Owusu, Ruth; Asante, Kwaku Poku; Mahama, Emmanuel; Awini, Elizabeth; Anyorigiya, Thomas; Dosoo, David; Amu, Alberta; Jakpa, Gabriel; Ofei, Emmanuel; Segbaya, Sylvester; Oduro, Abraham Rexford; Gyapong, Margaret; Hodgson, Abraham; Bart-Plange, Constance; Owusu-Agyei, Seth

    2015-01-01

    Background Sulphadoxine-Pyrimethamine (SP) is still the only recommended antimalarial for use in intermittent preventive treatment of malaria during pregnancy (IPTp) in some malaria endemic countries including Ghana. SP has the potential to cause acute haemolysis in G6PD deficient people resulting in significant haemoglobin (Hb) drop but there is limited data on post SP-IPTp Hb drop. This study determined the difference, if any in proportions of women with significant acute haemoglobin drop between G6PD normal, partial deficient and full deficient women after SP-IPTp. Methods and Findings Prospectively, 1518 pregnant women who received SP for IPTp as part of their normal antenatal care were enrolled. Their G6PD status were determined at enrollment followed by assessments on days 3, 7,14 and 28 to document any adverse effects and changes in post-IPTp haemoglobin (Hb) levels. The three groups were comparable at baseline except for their mean Hb (10.3 g/dL for G6PD normal, 10.8 g/dL for G6PD partial deficient and 10.8 g/dL for G6PD full defect women).The prevalence of G6PD full defect was 2.3% and 17.0% for G6PD partial defect. There was no difference in the proportions with fractional Hb drop ≥ 20% as compared to their baseline value post SP-IPTp among the 3 groups on days 3, 7, 14. The G6PD full defect group had the highest median fractional drop at day 7. There was a weak negative correlation between G6PD activity and fractional Hb drop. There was no statistical difference between the three groups in the proportions of those who started the study with Hb ≥ 8g/dl whose Hb level subsequently fell below 8g/dl post-SP IPTp. No study participant required transfusion or hospitalization for severe anaemia. Conclusions There was no significant difference between G6PD normal and deficient women in proportions with significant acute haemoglobin drop post SP-IPTp and lower G6PD enzyme activity was not strongly associated with significant acute drug-induced haemoglobin

  5. Glucose-6-Phosphate Dehydrogenase Deficiency and Haemoglobin Drop after Sulphadoxine-Pyrimethamine Use for Intermittent Preventive Treatment of Malaria during Pregnancy in Ghana - A Cohort Study.

    Directory of Open Access Journals (Sweden)

    Ruth Owusu

    Full Text Available Sulphadoxine-Pyrimethamine (SP is still the only recommended antimalarial for use in intermittent preventive treatment of malaria during pregnancy (IPTp in some malaria endemic countries including Ghana. SP has the potential to cause acute haemolysis in G6PD deficient people resulting in significant haemoglobin (Hb drop but there is limited data on post SP-IPTp Hb drop. This study determined the difference, if any in proportions of women with significant acute haemoglobin drop between G6PD normal, partial deficient and full deficient women after SP-IPTp.Prospectively, 1518 pregnant women who received SP for IPTp as part of their normal antenatal care were enrolled. Their G6PD status were determined at enrollment followed by assessments on days 3, 7,14 and 28 to document any adverse effects and changes in post-IPTp haemoglobin (Hb levels. The three groups were comparable at baseline except for their mean Hb (10.3 g/dL for G6PD normal, 10.8 g/dL for G6PD partial deficient and 10.8 g/dL for G6PD full defect women.The prevalence of G6PD full defect was 2.3% and 17.0% for G6PD partial defect. There was no difference in the proportions with fractional Hb drop ≥ 20% as compared to their baseline value post SP-IPTp among the 3 groups on days 3, 7, 14. The G6PD full defect group had the highest median fractional drop at day 7. There was a weak negative correlation between G6PD activity and fractional Hb drop. There was no statistical difference between the three groups in the proportions of those who started the study with Hb ≥ 8g/dl whose Hb level subsequently fell below 8g/dl post-SP IPTp. No study participant required transfusion or hospitalization for severe anaemia.There was no significant difference between G6PD normal and deficient women in proportions with significant acute haemoglobin drop post SP-IPTp and lower G6PD enzyme activity was not strongly associated with significant acute drug-induced haemoglobin drop post SP-IPTp but a larger

  6. Significantly elevated foetal haemoglobin levels in individuals with glucose 6-phosphate dehydrogenase disease and/or sickle cell trait: a cross-sectional study in Cape Coast, Ghana.

    Science.gov (United States)

    Adu, Patrick; Bashirudeen, Essel K M; Haruna, Florence; Adela, Edward Morkporkpor; Ephraim, Richard K D

    2017-01-01

    Previously published data have demonstrated that sickle red blood cells produce twice as much reactive oxygen species (ROS) suggesting that co-inheritance of sickle cell disease (SCD) and glucose 6-phosphate dehydrogenase (G6PD) enzymopathy could lead to more severe anaemia during sickling crises. Elevated foetal haemoglobin (Hb F) levels have been shown to have positive modulatory effects on sickling crises and disease outcomes. This study sought to assess how inheritance of G6PD enzymopathy affects the level of Hb F and haemoglobin concentration in adults in steady state. This cross-sectional study selected 100 out-patients (41 males and 59 females) visiting the University of Cape Coast hospital, between January, 2016 and May, 2016. Cellulose acetate electrophoresis (pH 8.2-8.6), methaemoglobin reductase test, modified Betke alkaline denaturation methods were used to investigate haemoglobin variants, qualitative G6PD status, and %Hb F levels in venous blood samples drawn from these participants. Data was analysed with GraphPad Prism 6 and SPSS and significance set at p Sickle cell trait, SCT). 5% of the participants co-inherited SCT and G6PD enzymopathy. %Hb F levels in G6PD deficient males was significantly higher than in G6PD deficient females [(p = 0.0003, 2.696% (males) vs 1.975% (females)], although the %Hb F levels was comparable in non-G6PD deficient individuals. %Hb F levels were significantly elevated in males with SCT only (p < 0.05), or G6PD enzymopathy only (p < 0.0001), or SCT + G6PD enzymopathy (p < 0.0001) compared to males with none of these pathologies even though their respective haemoglobin levels were comparable. Male participants with G6PD enzymopathy + SCT co-inheritance had significantly elevated %Hb F when compared to their counterparts with only G6PD enzymopathy (p < 0.001). Male gender [(p = 0.001, OR: 6.912 (2.277-20.984)] partial defective G6PD enzyme [(p = 0.00, OR: 7.567E8 (8.443E7-6.782E9)] SCT [(p = 0.026, OR: 4

  7. Evaluation of a serodiagnostic test using Ascaris suum haemoglobin for the detection of roundworm infections in pig populations.

    Science.gov (United States)

    Vlaminck, Johnny; Nejsum, Peter; Vangroenweghe, Frédéric; Thamsborg, Stig Milan; Vercruysse, Jozef; Geldhof, Peter

    2012-10-26

    The significant economical consequences of infections with Ascaris suum in pigs are already well documented. However, due to the subclinical nature of the disease and the lack of practical diagnostic means, ascariasis often remains undiagnosed. Here we describe the development and evaluation of a novel indirect ELISA using the purified A. suum haemoglobin (AsHb) molecule as an antigen. Initial validation using sera from 190 pigs experimentally infected twice a week with A. suum and Trichuris suis (25 and 5 eggs kg(-1)day(-1) respectively) demonstrated that the AsHb ELISA is able to detect long-term exposure to A. suum with a high sensitivity and specificity (99.5% and 100.0% respectively). Furthermore, this serological technique proved to be more sensitive than faecal examination on week 7 and 14 of the experiment (99.5% and 100% compared to 59.5% and 68.4% respectively). Cross-reactivity caused by T. suis infection was shown to be limited after analysing sera from pigs with an experimental T. suis mono-infection. Seroconversion was shown to occur from week 6 onwards in pigs receiving 100 A. suum eggs 5 times a week. Preliminary testing of the ELISA on six randomly selected farms confirmed the results obtained in the artificial infection trials, showing a higher sensitivity of the serologic method compared to faecal examination. Finally, the ELISA was used to investigate Ascaris infection rates on 101 conventional Flemish pig farms. The results showed that on 38.6% of the farms less than 20% of the tested samples were seropositive, while in 19.8% of the farms 80-100% of all pigs were seropositive. The results of this study suggest that the AsHb ELISA could provide pig farmers and veterinarians with an easier and more sensitive way to estimate the overall prevalence of A. suum on their farm. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Despite Inflammation, Supplemented Essential Amino Acids May Improve Circulating Levels of Albumin and Haemoglobin in Patients after Hip Fractures.

    Science.gov (United States)

    Aquilani, Roberto; Zuccarelli, Ginetto Carlo; Condino, Anna Maria; Catani, Michele; Rutili, Carla; Del Vecchio, Consiglia; Pisano, Pietro; Verri, Manuela; Iadarola, Paolo; Viglio, Simona; Boschi, Federica

    2017-06-21

    Essential amino acids (EAAs) are nutritional substrates that promote body protein synthesis; thus we hypothesised that their supplementation may improve circulating albumin (Alb) and haemoglobin (Hb) in rehabilitative elderly patients following hip fractures (HF). Out of the 145 HF patients originally enrolled in our study, 112 completed the protocol. These subjects were divided into two randomised groups, each containing 56 patients. For a period of two months, one group (age 81.4 ± 8.1 years; male/female 27/29) received a placebo, and the other (age 83.1 ± 7.5 years; male/female 25/31) received 4 + 4 g/day oral EAAs. At admission, the prevalence of both hypoAlb (<3.5 g/dL) and hypoHb (<13 g/dL male, <12 g/dL female) was similar in the placebo group (64.3% hypoAlb, 66% hypoHb) and the treated group of patients (73.2% hypoAlb, 67.8% hypoHb). At discharge, however, the prevalence of hypoAlb had reduced more in EAAs than in placebo subjects (31.7% in EAAs vs. 77.8% in placebo; p < 0.001). There was a 34.2% reduction of anaemia in hypoHb in EAA subjects and 18.9% in placebo subjects, but the difference was not statistically significant. Oral supplementation of EAAs improves hypoAlb and, to a lesser extent, Hb in elderly rehabilitative subjects with hip fractures. Anaemia was reduced in more than one third of patients, which, despite not being statistically significant, may be clinically relevant.

  9. Single-particle cryo-EM using alignment by classification (ABC: the structure of Lumbricus terrestris haemoglobin

    Directory of Open Access Journals (Sweden)

    Pavel Afanasyev

    2017-09-01

    Full Text Available Single-particle cryogenic electron microscopy (cryo-EM can now yield near-atomic resolution structures of biological complexes. However, the reference-based alignment algorithms commonly used in cryo-EM suffer from reference bias, limiting their applicability (also known as the `Einstein from random noise' problem. Low-dose cryo-EM therefore requires robust and objective approaches to reveal the structural information contained in the extremely noisy data, especially when dealing with small structures. A reference-free pipeline is presented for obtaining near-atomic resolution three-dimensional reconstructions from heterogeneous (`four-dimensional' cryo-EM data sets. The methodologies integrated in this pipeline include a posteriori camera correction, movie-based full-data-set contrast transfer function determination, movie-alignment algorithms, (Fourier-space multivariate statistical data compression and unsupervised classification, `random-startup' three-dimensional reconstructions, four-dimensional structural refinements and Fourier shell correlation criteria for evaluating anisotropic resolution. The procedures exclusively use information emerging from the data set itself, without external `starting models'. Euler-angle assignments are performed by angular reconstitution rather than by the inherently slower projection-matching approaches. The comprehensive `ABC-4D' pipeline is based on the two-dimensional reference-free `alignment by classification' (ABC approach, where similar images in similar orientations are grouped by unsupervised classification. Some fundamental differences between X-ray crystallography versus single-particle cryo-EM data collection and data processing are discussed. The structure of the giant haemoglobin from Lumbricus terrestris at a global resolution of ∼3.8 Å is presented as an example of the use of the ABC-4D procedure.

  10. Optimizing preoperative haemoglobin in major orthopaedic surgery using intravenous iron with or without erythropoietin. An epidemiologic study.

    Science.gov (United States)

    Basora, M; Colomina, M J; Tio, M; Mora, L; Sánchez-Etayo, G; Salazar, F; Ciércoles, E; Paños, M; Guerrero, E; Berge, R

    2015-01-01

    To evaluate the effectiveness of intravenous iron treatment, with or without associated erythropoietin (rHuEPO), measured as haemoglobin (Hb) increase. The relationships between the Hb increase and parameters used to evaluate anaemia were analysed. Retrospective observational study carried out in two third-level hospitals between January 2005 and December 2009. The study included patients with iron deficiency anaemia scheduled for elective orthopaedic surgery and treated with intravenous iron sucrose alone or associated with rHuEPO. Treatment efficacy was analysed based on the Hb increase from baseline to just before surgery. A total of 412 patients who received a median of 800mg of iron sucrose were included; 125 of them (30.4%) additionally received 2.4 vials of rHuEPO. The Hb increase was 0.8 (1.1) g/dL in patients treated with intravenous iron and 1.5 (1.3) g/dL in those additionally given rHuEPO(P<.01). The percentage of hypochromic red blood cells (r=0.52) and soluble transferrin receptor (r=0.59) value were significantly correlated to the Hb increase in patients receiving iron. In patients with iron deficiency anaemia, the effectiveness of iron sucrose treatment to optimize Hb before surgery was moderate; adjuvant administration of erythropoietin improved the results. Determination of functional iron status parameters may improve the treatment effectiveness. Copyright © 2014 Sociedad Española de Anestesiología, Reanimación y Terapéutica del Dolor. Publicado por Elsevier España, S.L.U. All rights reserved.

  11. Integrating the markers Pan I and haemoglobin with the genetic linkage map of Atlantic cod (Gadus morhua

    Directory of Open Access Journals (Sweden)

    Simpson Gary

    2010-10-01

    Full Text Available Abstract Background Haemoglobin (Hb and pantophysin (Pan I markers have been used intensively in population studies of Atlantic cod (Gadus morhua and in the analysis of traits such as temperature tolerance, growth characteristics and sexual maturation. We used an Illumina GoldenGate panel and the KASPar SNP genotyping system to analyse SNPs in three Atlantic cod families, one of which was polymorphic at the Hb β1 locus, and to generate a genetic linkage map integrating Pan I and multiple Hb loci. Findings Data generated allowed the mapping of nine Hb loci, the Pan I locus, and other 122 SNPs onto an existing linkage genetic map for Atlantic cod. Four Hb genes (i.e. α1, α4, β1 and β5 have been mapped on linkage group (LG 2 while the other five (i.e. α2, α3, β2, β3 and β4 were placed on LG18. Pan I was mapped on LG 1 using a newly developed KASPar assay for a SNP variable only in Pan IA allelic variants. The new linkage genetic map presented here comprises 1046 SNPs distributed between 23 linkage groups, with a length of 1145.6 cM. A map produced by forcing additional loci, resulting in a reduced goodness-of-fit for mapped markers, allowed the mapping of a total of 1300 SNPs. Finally, we compared our genetic linkage map data with the genetic linkage map data produced by a different group and identified 29 shared SNPs distributed on 10 different linkage groups. Conclusions The genetic linkage map presented here incorporates the marker Pan I, together with multiple Hb loci, and integrates genetic linkage data produced by two different research groups. This represents a useful resource to further explore if Pan I and Hbs or other genes underlie quantitative trait loci (QTL for temperature sensitivity/tolerance or other phenotypes.

  12. Malaria in Pregnancy Is a Predictor of Infant Haemoglobin Concentrations during the First Year of Life in Benin, West Africa.

    Directory of Open Access Journals (Sweden)

    Manfred Accrombessi

    Full Text Available Anaemia is an increasingly recognized health problem in Africa, particularly in infants and pregnant women. Although malaria is known to be the main risk factor of anaemia in both groups, the consequences of maternal factors, particularly malaria in pregnancy (MiP, on infant haemoglobin (Hb concentrations during the first months of life are still unclear.We followed-up a cohort of 1005 Beninese pregnant women from the beginning of pregnancy until delivery. A subsample composed of the first 400 offspring of these women were selected at birth and followed until the first year of life. Placental histology and blood smear at 1st clinical antenatal visit (ANC, 2nd ANC and delivery were used to assess malaria during pregnancy. Infant Hb concentrations were measured at birth, 6, 9 and 12 months of age. A mixed multi-level model was used to assess the association between MiP and infant Hb variations during the first 12 months of life.Placental malaria (difference mean [dm] = - 2.8 g/L, 95% CI [-5.3, -0.3], P = 0.03 and maternal peripheral parasitaemia at delivery (dm = - 4.6 g/L, 95% CI [-7.9, -1.3], P = 0.007 were the main maternal factors significantly associated with infant Hb concentrations during the first year of life. Poor maternal nutritional status and malaria infection during infancy were also significantly associated with a decrease in infant Hb.Antimalarial control and nutritional interventions before and during pregnancy should be reinforced to reduce specifically the incidence of infant anaemia, particularly in Sub-Saharan countries.

  13. Malaria in Pregnancy Is a Predictor of Infant Haemoglobin Concentrations during the First Year of Life in Benin, West Africa

    Science.gov (United States)

    Accrombessi, Manfred; Ouédraogo, Smaïla; Agbota, Gino Cédric; Gonzalez, Raquel; Massougbodji, Achille; Menéndez, Clara; Cot, Michel

    2015-01-01

    Background Anaemia is an increasingly recognized health problem in Africa, particularly in infants and pregnant women. Although malaria is known to be the main risk factor of anaemia in both groups, the consequences of maternal factors, particularly malaria in pregnancy (MiP), on infant haemoglobin (Hb) concentrations during the first months of life are still unclear. Methods We followed-up a cohort of 1005 Beninese pregnant women from the beginning of pregnancy until delivery. A subsample composed of the first 400 offspring of these women were selected at birth and followed until the first year of life. Placental histology and blood smear at 1st clinical antenatal visit (ANC), 2nd ANC and delivery were used to assess malaria during pregnancy. Infant Hb concentrations were measured at birth, 6, 9 and 12 months of age. A mixed multi-level model was used to assess the association between MiP and infant Hb variations during the first 12 months of life. Results Placental malaria (difference mean [dm] = - 2.8 g/L, 95% CI [-5.3, -0.3], P = 0.03) and maternal peripheral parasitaemia at delivery (dm = - 4.6 g/L, 95% CI [-7.9, -1.3], P = 0.007) were the main maternal factors significantly associated with infant Hb concentrations during the first year of life. Poor maternal nutritional status and malaria infection during infancy were also significantly associated with a decrease in infant Hb. Conclusion Antimalarial control and nutritional interventions before and during pregnancy should be reinforced to reduce specifically the incidence of infant anaemia, particularly in Sub-Saharan countries. PMID:26052704

  14. Crystallization and preliminary structural analysis of the giant haemoglobin from Glossoscolex paulistus at 3.2 Å

    Energy Technology Data Exchange (ETDEWEB)

    Bachega, J. F. R., E-mail: bachega@ursa.if.sc.usp.br; Bleicher, L.; Horjales, E. R. [Centro de Biotecnologia Molecular Estrutural, Instituto de Fisica de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil); Santiago, P. S. [Instituto de Química de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil); Garratt, R. C. [Centro de Biotecnologia Molecular Estrutural, Instituto de Fisica de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil); Tabak, M., E-mail: bachega@ursa.if.sc.usp.br [Instituto de Química de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil)

    2011-01-01

    Diffraction data to 3.2 Å from crystals of the 3.6 MDa erythrocruorin from a Brazilian earthworm represent the highest resolution reported to date for similar complexes. An unambiguous molecular replacement solution shows the particle to belong to the type I class. Glossoscolex paulistus is a free-living earthworm encountered in south-east Brazil. Its oxygen transport requirements are undertaken by a giant extracellular haemoglobin, or erythrocruorin (HbGp), which has an approximate molecular mass of 3.6 MDa and, by analogy with its homologue from Lumbricus terrestris (HbLt), is believed to be composed of a total of 180 polypeptide chains. In the present work the full 3.6 MDa particle in its cyanomet state was purified and crystallized using sodium citrate or PEG8000 as precipitant. The crystals contain one-quarter of the full particle in the asymmetric unit of the I222 cell and have parameters of a = 270.8 Å, b = 320.3 Å and c = 332.4 Å. Diffraction data were collected to 3.15 Å using synchrotron radiation on beamline X29A at the Brookhaven National Laboratory and represent the highest resolution data described to date for similar erythrocruorins. The structure was solved by molecular replacement using a search model corresponding to one-twelfth of its homologue from HbLt. This revealed that HbGp belongs to the type I class of erythrocruorins and provided an interpretable initial electron density map in which many features including the haem groups and disulfide bonds could be identified.

  15. Single-particle cryo-EM using alignment by classification (ABC): the structure of Lumbricus terrestris haemoglobin.

    Science.gov (United States)

    Afanasyev, Pavel; Seer-Linnemayr, Charlotte; Ravelli, Raimond B G; Matadeen, Rishi; De Carlo, Sacha; Alewijnse, Bart; Portugal, Rodrigo V; Pannu, Navraj S; Schatz, Michael; van Heel, Marin

    2017-09-01

    Single-particle cryogenic electron microscopy (cryo-EM) can now yield near-atomic resolution structures of biological complexes. However, the reference-based alignment algorithms commonly used in cryo-EM suffer from reference bias, limiting their applicability (also known as the 'Einstein from random noise' problem). Low-dose cryo-EM therefore requires robust and objective approaches to reveal the structural information contained in the extremely noisy data, especially when dealing with small structures. A reference-free pipeline is presented for obtaining near-atomic resolution three-dimensional reconstructions from heterogeneous ('four-dimensional') cryo-EM data sets. The methodologies integrated in this pipeline include a posteriori camera correction, movie-based full-data-set contrast transfer function determination, movie-alignment algorithms, (Fourier-space) multivariate statistical data compression and unsupervised classification, 'random-startup' three-dimensional reconstructions, four-dimensional structural refinements and Fourier shell correlation criteria for evaluating anisotropic resolution. The procedures exclusively use information emerging from the data set itself, without external 'starting models'. Euler-angle assignments are performed by angular reconstitution rather than by the inherently slower projection-matching approaches. The comprehensive 'ABC-4D' pipeline is based on the two-dimensional reference-free 'alignment by classification' (ABC) approach, where similar images in similar orientations are grouped by unsupervised classification. Some fundamental differences between X-ray crystallography versus single-particle cryo-EM data collection and data processing are discussed. The structure of the giant haemoglobin from Lumbricus terrestris at a global resolution of ∼3.8 Å is presented as an example of the use of the ABC-4D procedure.

  16. A STUDY ON RELATIONSHIP OF GLYCATED HAEMOGLOBIN WITH SEVERITY OF CORONARY ARTERY DISEASE IN TYPE 2 DIABETES USING SYNTAX SCORE

    Directory of Open Access Journals (Sweden)

    Bornali Dutta

    2016-11-01

    Full Text Available BACKGROUND Glycosylated Haemoglobin (HbA1c is an established marker of long-term glycaemic control in patients with diabetes mellitus (DM and elevated HbA1c levels are associated with an increased risk for further microvascular and macrovascular disease. There have been few studies, which have shown HbA1c to be predictive of coronary artery disease and only in limited studies HbA1c has been correlated with angiographically proven CAD (coronary artery disease using Syntax score. To aim the study to evaluate the relationship between increasing HbA1c level and severity of coronary artery disease in type 2 diabetic patients using syntax score in a cohort of proven Coronary Artery Disease (CAD on angiography at Gauhati Medical College. MATERIALS AND METHODS We prospectively collected data of diabetic patients with proven CAD on angiography from June 2014 to June 2015. Patients were divided into four groups (interquartiles according to HbA1c levels, less than 6.7%, 6.7% to 7.1%, 7.1% to 7.6% and >7.6%. Severity of coronary artery disease was assessed using syntax score and the number of coronary vessels diseased. We compared different quartiles of HbA1c with regard to syntax score and number of diseased vessels. RESULTS A total of 133 patients were included in the study. Mean age was 58.1±10.4 years. 87.2% (116 were males, 54.1% (72 were hypertensives, 21.1% (28 were smokers and 39.1% (52 were dyslipidaemic. Among diabetics, mean HbA1c was 7.1%. On analysis, we found that Coronary Artery Disease (CAD severity by syntax score as well as number of vessels involved was significantly different among quartiles (p values 7.6, respectively. In syntax subgroups (32, mean HbA1c values were 6.8±0.2, 7.4±0.5 and 8.0±0.4, respectively. In subgroup analysis where only chronic stable angina patients were considered, there was significant linear correlation between HbA1c and severity of CAD by syntax score (R-0.820; p7% was an independent predictor of syntax

  17. Global migration and the changing distribution of sickle haemoglobin: a quantitative study of temporal trends between 1960 and 2000.

    Science.gov (United States)

    Piel, Frédéric B; Tatem, Andrew J; Huang, Zhuojie; Gupta, Sunetra; Williams, Thomas N; Weatherall, David J

    2014-02-01

    Changes in the geographical distribution of genetic disorders are often thought to happen slowly, especially when compared with infectious diseases. Whereas mutations, genetic drift, and natural selection take place over many generations, epidemics can spread through large populations within a few days or weeks. Nevertheless, population movements can interfere with these processes, and few studies have been done of their eff ect on genetic disorders. We aimed to investigate the eff ect of global migration on the distribution of the sickle-cell gene-the most common and clinically significant haemoglobin structural variant. For each country, we extracted data from the World Bank’s Global Bilateral Migration Database about international human migrations between 1960 and 2000. We combined this information with evidence-based estimates of national HbS allele frequencies, generated within a Bayesian geostatistical framework, to analyse temporal changes in the net numbers of migrants, and classified countries with an index summarising these temporal trends. The number of international migrants increased from 92.6 million in 1960, to 165.2 million in 2000. The estimated global number of migrants with HbS increased from about 1.6 million in 1960, to 3.6 million in 2000. This increase was largely due to an increase in the number of migrants from countries with HbS allele frequencies higher than 10%, from 3.1 million in 1960, to 14.2 million in 2000. Additionally, the mean number of countries of origin for each destination country increased from 70 (SE 46) in 1960, to 98 (48) in 2000, showing an increasing diversity in the network of international migrations between countries. Our index of change map shows a patchy distribution of the magnitude of temporal changes, with the highest positive and negative values scattered across all continents. Global human population movements have had a substantial eff ect on the distribution of the HbS gene. Population movements can create

  18. Soroepidemiologia para o virus da hepatite B (VHB em gestantes/parturientes e sua transmissão para recém-nascidos em Goiânia, GO

    Directory of Open Access Journals (Sweden)

    Divina das Dores P. Cardoso

    1996-08-01

    Full Text Available Foram coletadas, entre março de 1990 e julho de 1992, 1459 amostras sanguíneas de mulheres gestantes/parturientes na cidade de Goiânia-GO, objetivando detecção da infecção pelo vírus da hepatite B (VHB, através dos marcadores sorológicos AgHBs e anti-HBs. O percentual depositividade encontrado, pelo teste imunoenzimãtico, foi de 7,5%, sendo 0,5%para AgHBs e 7,0%para anti-HBs. A análise efetuada, considerando a faixa etária, mostra que 7 de 8 mulheres AgHBs-positivas pertenciam à faixa etária de até 30 anos, situação semelhante em relação ao anti-HBs(83/101. Das 8 mulheres positivas, 4 tiveram seus recém-nascidos submetidos a tratamento profilático com vacina (Engerix B e imunoglobulina humana anti-hepatite B (HBIG. Além disso, 3 dessas crianças foram analisadas sorologicamente, sendo que uma era AgHBs-positiva ao nascimento. Doença sexualmente transmissível e transfusão sanguínea foram fatores de risco que coirelacionaram significantemente com a infecção. Esses resultados parece-nos reforçar a indicação de triagem à infecção pelo vírus da hepatite B no período pré-natal, assim como a adoção de medidas imunoprofiláticas nas crianças nascidas de mães positivas.

  19. In vitro effects of anthocyanin extracts from Justicia secunda Vahl on the solubility of haemoglobin S and membrane stability of sickle erythrocytes.

    Science.gov (United States)

    Mpiana, Pius T; Ngbolua, KotoTe Niwa N; Bokota, Matthieu T; Kasonga, Teddy K; Atibu, Emmanuel K; Tshibangu, Damien S T; Mudogo, Virima

    2010-10-01

    Sickle cell disease or drepanocytosis is caused by the polymerisation of abnormal haemoglobin S when oxygen tension decreases. This lead to the changes in the shape of red blood cells and anaemia. It has also been postulated that the red cells of patients with sickle cell disease contain a higher than normal concentration of calcium ions. These ions are bound to membrane proteins resulting in dehydration and loss of red blood cell deformability and cell-to-cell adherence. Anthocyanins extracted from some Congolese plants used in traditional medicine against sickle cell disease have recently been shown to have anti-sickling activity in vitro. Justicia secunda is a plant used in Congo by Jehovah's Witnesses, well known for their refusal of blood transfusions, against anaemia. Emmel, Itano and osmotic fragility tests were used to test the effect of anthocyanin extracts from Justicia secunda leaves on haemoglobin S solubility and sickle cell membrane stability. Anthocyanins from Justicia secunda were found to possess anti-sickling activity. Treated SS red blood cells recovered a normal, classical biconcave form with a radius of 3.3±0.3 μm, similar to that of normal erythrocytes. The solubility of deoxyhaemoglobin S increased and the osmotic fragility of drepanocytes decreased upon treatment with anthocyanin extracts. These findings suggest that anthocyanin extracts play a role in both stabilising the red blood cell membrane and inhibiting polymerisation of haemoglobin S. This provides a possible molecular basis for earlier reports on the anti-sickling properties of anthocyanins from some Congolese plants and their use in the management of sickle cell disease by Congolese traditional healers.

  20. Melatonin Restores White Blood Cell Count, Diminishes Glycated Haemoglobin Level and Prevents Liver, Kidney and Muscle Oxidative Stress in Mice Exposed to Acute Ethanol Intoxication.

    Science.gov (United States)

    Kurhaluk, Natalia; Sliuta, Alina; Kyriienko, Svitlana; Winklewski, Pawel J

    2017-09-01

    The aim of the study was to examine the effects of melatonin impact on changes in haematological profile, biomarkers of oxidative stress (dienes conjugates, malondialdehyde (MDA), oxidatively modified protein levels, total antioxidant capacity and antioxidant enzyme activity) in liver, muscle, kidney and erythrocytes, and glycated haemoglobin (HBA1c) in mice during acute ethanol stress. Assays were carried out in quadruplicate: control, melatonin (10 mg/kg, 10 days), acute ethanol stress (0.75 g/kg/day, 10 days) and acute ethanol stress plus melatonin groups. Acute ethanol stress caused a significant increase in the total number of white blood cells (WBC), especially neutrophils in the blood, and HBA1c levels vs. control mice. The correlation between lipid peroxidation and the glycated haemoglobin level was shown (r = 0.93, P = 0.007). Ethanol reduced the antioxidant capacity by increasing reactive oxygen species (ROS) production and the level of oxidatively modified protein content, diene conjugates and MDA. Melatonin administration in animals during acute ethanol stress reduced antioxidant stress biomarkers, WBC, HBA1c levels and ROS production. Melatonin had protective effects on liver, kidney and muscle tissues by preventing the intensive lipid peroxidation processes in initial (diene conjugation production) and late stages (MDA level), and significantly reduced the level of aldehyde and ketone protein derivatives. Furthermore, melatonin restored elevated WBC count and HBA1c level and diminished ROS production. Ethanol reduces antioxidant capacity and leads to exaggerated reactive oxygen species production and consequent increases in oxidatively modified proteins. Melatonin exerts protective effects by preventing the intensive lipid peroxidation processes. Melatonin significantly reduces the level of aldehyde and ketone protein derivatives, restores glycated haemoglobin level and white blood cell count.

  1. Erythrocytes and the regulation of human skeletal muscle blood flow and oxygen delivery: role of erythrocyte count and oxygenation state of haemoglobin.

    Science.gov (United States)

    González-Alonso, José; Mortensen, Stefan P; Dawson, Ellen A; Secher, Niels H; Damsgaard, Rasmus

    2006-04-01

    Blood flow to dynamically contracting myocytes is regulated to match O(2) delivery to metabolic demand. The red blood cell (RBC) itself functions as an O(2) sensor, contributing to the control of O(2) delivery by releasing the vasodilators ATP and S-nitrosohaemoglobin with the offloading of O(2) from the haemoglobin molecule. Whether RBC number is sensed remains unknown. To investigate the role of RBC number, in isolation and in combination with alterations in blood oxygenation, on muscle and systemic perfusion, we measured local and central haemodynamics during one-legged knee-extensor exercise ( approximately 50% peak power) in 10 healthy males under conditions of normocythaemia (control), anaemia, anaemia + plasma volume expansion (PVX), anaemia + PVX + hypoxia, polycythaemia, polycythaemia + hyperoxia and polycythaemia + hypoxia, which changed either RBC count alone or both RBC count and oxyhaemoglobin. Leg blood flow (LBF), cardiac output (Q) and vascular conductance did not change with either anaemia or polycythaemia alone. However, LBF increased with anaemia + PVX (28 +/- 4%) and anaemia + PVX + hypoxia (46 +/- 6%) and decreased with polycythaemia + hyperoxia (18 +/- 5%). LBF and Q with anaemia + PVX + hypoxia (8.0 +/- 0.5 and 15.8 +/- 0.7 l min(-1), respectively) equalled those during maximal knee-extensor exercise. Collectively, LBF and vascular conductance were intimately related to leg arterial-venous (a-v) O(2) difference (r(2)= 0.89-0.93; P < 0.001), suggesting a pivotal role of blood O(2) gradients in muscle microcirculatory control. The systemic circulation accommodated to the changes in muscle perfusion. Our results indicate that, when coping with severe haematological challenges, local regulation of skeletal muscle blood flow and O(2) delivery primarily senses alterations in the oxygenation state of haemoglobin and, to a lesser extent, alterations in the number of RBCs and haemoglobin molecules.

  2. Determination of melanin and haemoglobin in the skin of idiopathic cutaneous hyperchromia of the orbital region (ICHOR: A study of Indian patients

    Directory of Open Access Journals (Sweden)

    Michèle Verschoore

    2012-01-01

    Full Text Available Background: Idiopathic cutaneous hyperchromia at the orbital region (ICHOR is a cutaneous hyperchromia characterised by bilateral darkening of the eyelid and orbital skin that contrasts with the adjoining facial skin. ICHOR is frequent in dark skin. It interferes with the face appearance which often causes difficulties in societal acceptance and may impact quality of life. Objective : The aim of this investigation was to study the epidemiology, clinical features and risk factors associated with ICHOR in Indian patients and also to study the distribution of melanin and haemoglobin in ICHOR patients. This study also assessed the relevance of SIAscopy technique (spectrophotometric intracutaneous analysis (SIA, a new objective non-invasive method to measure melanin and haemoglobin concentration in vivo. Materials and Methods: Thirty-three patients diagnosed with ICHOR at the All India Institute of Medical Sciences, New Dehli, India, were included in the study. Epidemiological data were collected through a self-administrated questionnaire. Standard photographs were taken from each patient and SIAscopy measurements were done on dark circles and normal skin. Results: Surprisingly our study showed no significant correlation between ICHOR prevalence and family history, atopic and contact dermatitis, contemporaneous melasma and hormonal factors. The study confirms that sun exposure is a risk factor of dark circles aggravation. Indeed patients tend to reduce sun exposure after the onset of dark circles. SIAscopy analysis reveals significant differences in the concentration of total melanin, of dermal melanin and of haemoglobin between ICHOR skin and normal skin of the same patient. Conclusion: This study confirms that melanin deposits and blood stasis in dark circles may play a role in ICHOR pathogenesis and cause the darkening of skin under eyes. SIAscopy provides objective diagnostic information about ICHOR.

  3. Rapid screening for glucose-6-phosphate dehydrogenase deficiency and haemoglobin polymorphisms in Africa by a simple high-throughput SSOP-ELISA method

    Directory of Open Access Journals (Sweden)

    Theander Thor G

    2005-12-01

    Full Text Available Abstract Background Mutations in the haemoglobin beta-globin (HbB and glucose-6-phosphate dehydrogenase (G6PD genes cause widespread human genetic disorders such as sickle cell diseases and G6PD deficiency. In sub-Saharan Africa, a few predominant polymorphic variants of each gene account for a majority of these deficiencies. Examining at a larger scale the clinical importance of these independent genetic disorders, their possible association with malaria pathogenesis and innate resistance, and their relevance for antimalarial drug treatment, would be easier if an accurate screening method with limited costs was available. Methods A simple and rapid technique was developed to detect the most prominent single nucleotide polymorphisms (SNPs in the HbB and G6PD genes. The method is able to detect the different haemoglobin polymorphisms A, S, C and E, as well as G6PD polymorphisms B, A and A- based on PCR-amplification followed by a hybridization step using sequence-specific oligonucleotide probes (SSOPs specific for the SNP variants and quantified by ELISA. Results The SSOP-ELISA method was found to be specific, and compared well to the commonly used PCR-RFLP technique. Identical results were obtained in 98% (haemoglobin and 95% (G6PD of the tested 90 field samples from a high-transmission area in Tanzania, which were used to validate the new technique. Conclusion The simplicity and accuracy of the new methodology makes it suitable for application in settings where resources are limited. It would serve as a valuable tool for research purposes by monitoring genotype frequencies in relation to disease epidemiology.

  4. Survival of primary irradiated patients with NSCLC in dependence of the pretherapeutical haemoglobin level; Ueberlebenszeiten ausschliesslich bestrahlter NSCLC-Patienten. Die Bedeutung des praetherapeutischen Haemoglobinwerts

    Energy Technology Data Exchange (ETDEWEB)

    Wilhelm, R.; Kovacs, G.; Heinrichsohn, D.; Galalae, R.; Kimmig, B. [Kiel Univ. (Germany). Klinik fuer Strahlentherapie (Radioonkologie)

    1998-03-01

    We have analysed the files of 96 primary radiated patients to evaluate the pre-therapeutic haemoglobin level as well as sex, age, histopathology, total dose and fractionation. The analysis of Karnofsky-status or patient condition was not performed as there was a lack of sufficient data in the patient files. Histopathology, sex, age as well as total dose and fractionation of the radiation treatment were similar in the cohort building 3 groups: Hb<11 g/dl, Hb between 11 to 15 g/dl and Hb>15 g/dl. The investigation resulted in the observation, that lower levels of initial serum haemoglobin concentration compared to levels over 15 g/dl are negative prognostic factors. Higher initial haemoglobin concentration is a high significant positive prognostic factor (p=0,0001). The applied total dose (>30 Gy, >50 Gy, >55 Gy) was not a significant prognostic factor in this patient material, where two thirds of the patients had an advanced cancer (stage IIIB or Stage IV). (orig./MG) [Deutsch] Wir werteten retrospektiv fuer 96 Patienten den Serum-Hb-Wert, der vor einer primaeren perkutanen Strahlentherapie bestimmt wurde, anhand der Krankenunterlagen aus. Tumorhistologie, Geschlecht und Altersverteilung sowie Dosis und Fraktionierung der Strahlentherapie wurden fuer die Gruppen Hb<11 g/dl, Hb von 11 bis 15 g/dl und Hb>15 g/dl ueberprueft und in allen Gruppen als annaehernd homogen festgestellt. Eine Rekonstruktion von Daten zum Allgemeinzustand der Patienten oder eine Klassifizierung nach dem Karnofsky-Index konnte aufgrund fehlender oder unvollstaendiger Dokumentation nicht durchgefuehrt werden. Hoehere praetherapeutische Haemoglobinkonzentrationen (>15 g/dl) korrelierten mit hochsignifikant laengeren Ueberlebenszeiten (p=0,0001). Unterschiedlich hohe Gesamtdosen (>30 Gy, >50 Gy, 55 bis 60 Gy) hatten keinen signifikanten Einfluss auf das Ueberleben in einem Patientengut, von dem zwei Drittel unter Stadium IIIB- oder Stadium-VI-Tumoren litten. (orig./MG)

  5. Calibration of the HemoCue point-of-care analyser for determining haemoglobin concentration in a lizard and a fish

    OpenAIRE

    Andrewartha, Sarah J.; Munns, Suzanne L.; Edwards, Ashley

    2016-01-01

    Haemoglobin concentration ([Hb]) is measured for a wide variety of animal studies. The use of point-of-care devices, such as the HemoCue, is becoming increasingly common because of their portability, relative ease of use and low cost. In this study, we aimed to determine whether the [Hb] of blue-tongued skink (Tiliqua nigrolutea) blood can be determined accurately using the HemoCue and whether the HemoCue overestimates the [Hb] of reptile blood in a similar manner to fish blood. Additionally,...

  6. The sites of respiratory gas exchange in the planktonic crustacean daphnia magna: an in vivo study employing blood haemoglobin as an internal oxygen probe

    Science.gov (United States)

    Pirow; Wollinger; Paul

    1999-11-01

    Recent studies on Daphnia magna have revealed that the feeding current is important for uptake of oxygen from the ambient medium. Respiratory gas exchange should therefore mainly occur within the filtering chamber, whose boundaries are formed by the trunk and the extended carapace shell valves. The precise site of gas exchange in the genus Daphnia is, however, a matter of conjecture. We have developed a method of imaging the haemoglobin oxygen-saturation in the circulatory system of transparent animals, which provides an opportunity to localize oxygen uptake from the environment and oxygen release to the tissues. Experiments were carried out at 20 degrees C on 2.8-3.0 mm long parthenogenetic females maintained in hypoxic culturing conditions, which had resulted in an increased haemoglobin content in the haemolymph. In lateral views of D. magna, the highest values of haemoglobin oxygen-saturation occurred near the posterior margin of the carapace and, surprisingly, in the rostral part of the head. The ambient oxygen partial pressures at which haemoglobin was half-oxygenated were 15 mmHg (2.0 kPa) for the posterior carapace region and 6 mmHg (0.8 kPa) for the rostrum. Although not all parts of the circulatory system could be analyzed using this technique, the data obtained from the accessible regions suggest that the inner wall of the carapace is a major site of respiratory gas exchange. Taking the circulatory pattern and the flow pattern of the medium in the filtering chamber into consideration, it becomes clear that the haemolymph, after passing from the limbs to the carapace lacuna, becomes oxygenated while flowing through the ventral part of the double-walled carapace in a posterior direction. The laterally flattened rostral region, where sensory and central nervous system structures are located, seems to have direct diffusive access to ambient oxygen, which could be especially advantageous during severe hypoxia when the convective transport systems fail to

  7. Prevalence of polymorphisms in glucose-6-phosphate dehydrogenase, sickle haemoglobin and nitric oxide synthase genes and their relationship with incidence of uncomplicated malaria in Iganga, Uganda.

    Science.gov (United States)

    Lwanira, Catherine Nassozi; Kironde, Fred; Kaddumukasa, Mark; Swedberg, Göte

    2017-08-09

    Host genetics play an important role in Plasmodium falciparum malaria susceptibility. However, information on host genetic factors and their relationships with malaria in the vaccine trial site of Iganga, Uganda is limited. The main objective of this study was to determine the prevalence of selected host genetic markers and their relationship to malaria incidence in the vaccine trial site of Iganga, Uganda. In a 1-year longitudinal cohort study, 423 children aged below 9 years were recruited and their malaria episodes were investigated. Host genetic polymorphisms were assessed by PCR-RFLP, haemoglobin electrophoresis and DNA sequencing. Using a multivariate negative binomial regression model, estimates of the impact of human genetic polymorphisms on malaria incidence were performed. In all statistical tests, a P value of sickle cell haemoglobin trait, G6PD c.202 G>A (rs 1050828) and NOS2 -954 G>C (rs 1800482) variants were 26.6, 22.7 and 17.3%, respectively. Inducible nitric oxide synthase 2 (NOS2 -954 G>C; rs 1800482) heterozygosity was associated with lower incidence of malaria in all age groups {Adjusted incident rates ratio (aIRR) 0.59; 95% CI [0.386-0.887]; P = 0.012)}. About 4% of study subjects had co-existence of sickle cell Hb trait and G6PD deficiency. Sickle cell Hb heterozygotes (Hb AS) aged less than 1 year experienced significantly more malaria episodes annually than children with normal haemoglobin (Hb AA) {aIRR = 1.98; 95% CI [1.240-3.175]; P = 0.004}. There was no significant influence of the sickle cell trait on malaria incidence among older children of 1-9 years. Mutation (NOS2 -954 G>C; rs 1800482) of nitric oxide synthase 2 gene promoter was associated with a lower incidence of acute malaria. The normal haemoglobin (wild genotype; HbAA) was associated with reduced malaria incidence rates during the first year of life. More understanding of the interplay between host genetics and malaria susceptibility is required.

  8. Comparative study of nitro blue tetrazolium (NBT) reduction method for estimation of glycated haemoglobin with glycated HbA1c estimated on DCA2000+analyzer (immunoagglutination inhibition).

    Science.gov (United States)

    Sahu, Ashok; Gupta, Trapti; Sarkar, Purnima Dey

    2010-01-01

    Glycated haemoglobin is a diagnostic tool, used for the monitoring of the glycemic status among diabetic patients. The present study is designed to compare and correlate modified NBT reduction method for the estimation of Glycated protein (Glycated Haemoglobin) with HbA1C estimated on DCA+2000Analyzer. Glycated protein reduces Nitro Blue Tetrazolium (NBT) reagent in alkaline medium to tetrazinolyl radical NBT+ which is disproportional to yield a highly colored formazan dye (MF+) (monoformazen), absorbance of colored compound was measured which gives the concentration of glycated proteins present in the sample. Heme free globin (glycated hemoglobin) was extracted out and dissolved immediately in 1 ml normal saline. Dissolved globin was treated with modified NBT reagent, absorbance of color developed was recorded in milli delta A/min. The results of modified NBT were then compared with HbA1c estimated by immunoagglutination inhibition method. Correlation coefficient between Glycated hemoglobin and HbAlc was found to be r=0.926 using Schimadzu CL-750 spectrophotometer and r=0.902 using colorimeter. Results of this study were found to be statistically significant p NBT reduction method is as sensitive as HbAlc estimated by DCA2000+Analyzer (immunoagglutination inhibition). Hence it could be used for routine monitoring of blood glucose control level in diabetic subjects.

  9. Trend overtime of total haemoglobin, iron metabolism and trace minerals in veal calves fed high amounts of two different solid feeds

    Directory of Open Access Journals (Sweden)

    Anna-Lisa Stefani

    2010-01-01

    Full Text Available Fifty Polish Friesian veal calves were administrated high amounts of two different solid feeds (maize grain and a mix diet containing 10% of straw and 8% of soy in addition to the traditional milk replacer diet. Compared to the mix diet, maize grain had a lower content of iron, copper and zinc and a minor fibre level. Effects of the two diets on calves’ blood haemoglobin, iron, iron metabolism parameters, copper and zinc concentrations were studied. Haemoglobin concentration resulted higher at the end of the fattening for calves fed the mix diet, as expected. Values remained, however, within ranges that allowed acceptable carcass paleness. Haematic iron, unsaturated iron binding capacity (UIBC and total iron binding capacity (TIBC levels were not significantly different between the two solid feeds. Lower copper and zinc blood concentrations resulted for calves fed the mix diet were likely due to the feed fibre interfering with the bioavailability of the two minerals, according to what happens for iron.

  10. Benefits of combination of insulin degludec and liraglutide are independent of baseline glycated haemoglobin level and duration of type 2 diabetes

    DEFF Research Database (Denmark)

    Rodbard, Helena W; Buse, John B; Woo, Vincent C

    2016-01-01

    of disease progression stage including baseline glycated haemoglobin (HbA1c), disease duration and previous insulin dose. RESULTS: Across four categories of baseline HbA1c (≤7.5-9.0%), HbA1c reductions were significantly greater with IDegLira (1.1-2.5%) compared with IDeg or liraglutide alone in DUAL I...... liraglutide, irrespective of baseline HbA1c. In DUAL II, insulin dose and hypoglycaemia rate were similar with IDegLira and IDeg (maximum dose limited to 50 U) independent of baseline HbA1c. The reduction in HbA1c with IDegLira was independent of disease duration and previous insulin dose but varied depending...

  11. Sustainability of the effects of medicinal iron and iron rich food supplementation on haemoglobin, intelligence quotient and growth of school aged girls

    Directory of Open Access Journals (Sweden)

    Monika Jain

    2014-12-01

    Full Text Available Anaemia in school aged girls is an important but neglected issue. Since iron supplementation programmes have had little reported success in reducing anaemia, interest is turning to food based approaches that have higher potential for achieving far reaching benefits. The purpose of the study was to observe sustainability of the effect of iron and food supplementation on haemoglobin (Hb, intelligence quotient (IQ and growth of the subjects. At baseline, estimation of haemoglobin (Hb, red cell indices, serum iron, total iron binding capacity, serum transferrin saturation and serum ferritin was done. IQ, weight and height were measured using standard procedures. Anaemic subjectswere divided into three groups, viz., (i twice weekly supplementation of iron folic acid syrup (53 mg iron/week; (ii daily supplementation of 4 niger seed and defatted soyaflour biscuits plus 2 lemons (45 mg iron/week and (iii control. Non anaemic group(NAC was not intervened. Endline data was collected after 120 days. Follow up for Hb, IQ, weight and height was done 4 months after cessation of supplementation. The prevalence of anaemia was 77% in the study population; 46% subjects had mild anaemia and 32% had moderate anaemia. Iron status was lower in anaemic subjects (p<0.001.Iron supplementation was more effective in raising Hb and building iron stores than iron rich food supplementation. Iron supplementation improved IQ but did not bring about catch up of anaemics to non anaemics. Iron rich food supplementation was better than medicinal iron in promoting growth in anaemic girls. The impact of iron rich food supplementation on Hb, IQ and growth sustained for 4 months while that of medicinal iron did not. Effects of food supplementation are sustainable for 4 months, therefore, this strategy holds more potential to control anaemia, in school aged girls.

  12. Elevated fetal haemoglobin is a predictor of better outcome in MDS/AML patients receiving 5-aza-2'-deoxycytidine (Decitabine).

    Science.gov (United States)

    Lübbert, Michael; Ihorst, Gabriele; Sander, Philipp N; Bogatyreva, Ljudmila; Becker, Heiko; Wijermans, Pierre W; Suciu, Stefan; Bissé, Emmanuel; Claus, Rainer

    2017-02-01

    Although azanucleoside DNA-hypomethylating agents (HMAs) are routinely used for the treatment of myelodysplastic syndrome/acute myeloid leukaemia (MDS/AML), very few outcome predictors have been established. Expression of the β-like globin gene locus is tightly regulated by DNA methylation, is HMA-sensitive in vitro, and fetal haemoglobin (HbF) expression is under study as a potential biomarker for response of MDS patients to azacitidine. We determined HbF expression in 16 MDS and 36 AML patients receiving decitabine (DAC). Pre-treatment HbF was already elevated (>1·0% of total haemoglobin) in 7/16 and 12/36 patients, and HbF was induced by DAC in 81%/54% of MDS/AML patients, respectively. Elevated pre-treatment HbF was associated with longer median overall survival (OS): 26·6 vs. 8·6 months for MDS (hazard ratio [HR] 8·56, 95% confidence interval [CI] 1·74-42·49, P = 0·008, with similarly longer progression-free and AML-free survival), and 10·0 vs. 2·9 months OS for AML (HR 3·01, 95% CI 1·26-7·22, P = 0·014). In a multivariate analysis, the prognostic value of HbF was retained. Time-dependent Cox models revealed that the prognostic value of treatment-induced HbF induction was inferior to that of pre-treatment HbF. In conclusion, we provide first evidence for in vivo HbF induction by DAC in MDS/AML, and demonstrate prognostic value of elevated pre-treatment HbF, warranting prospective, randomized studies. © 2016 John Wiley & Sons Ltd.

  13. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

    NARCIS (Netherlands)

    Prins, M.|info:eu-repo/dai/nl/304836176; van Leeuwen, M.W.; Teske, E.|info:eu-repo/dai/nl/114300240

    2009-01-01

    Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.

  14. Prevalência de infecção por HIV, HTLV, VHB e de sífilis e clamídia em gestantes numa unidade de saúde terciária na Amazônia ocidental brasileira

    OpenAIRE

    Machado Filho,Amantino Camilo; Sardinha,José Felipe Jardim; Ponte,Rossicléia Lins; Costa,Elenice Pontes da; da Silva,Sabrina Silva; Martinez-Espinosa,Flor Ernestina

    2010-01-01

    OBJETIVO: estimar a prevalência de infecção por vírus da imunodeficiência humana (HIV), vírus linfotrópicos de células T humanas (HTLV), vírus da hepatite B (VHB), Chlamydia trachomatis (C. trachomatis) e de sífilis em gestantes, bem como fatores de risco associados a essas infecções, na Fundação de Medicina Tropical do Amazonas (FMTAM). MÉTODOS: foi realizado um estudo transversal incluindo 674 gestantes atendidas consecutivamente da demanda espontânea da FMTAM no período de Março a Setembro...

  15. Risk factors associated with a decrease ≥2 g/dL in haemoglobin and/or ≥10% haematocrit in osteoarthritis patients taking celecoxib or a nonselective NSAID plus a PPI in a large randomised controlled trial (CONDOR).

    Science.gov (United States)

    Lanas, A; Goldstein, J L; Chan, F K L; Wilcox, C M; Peura, D A; Li, C; Sands, G H; Scheiman, J M

    2012-09-01

    Nonsteroidal anti-inflammatory drugs are associated with gastrointestinal (GI) damage. The Celecoxib vs. Omeprazole and Diclofenac for At-Risk Osteoarthritis and Rheumatoid Arthritis Patients (CONDOR) trial showed that a haemoglobin drop ≥2 g/dL adjudicated as either of defined or presumed GI origin was the most frequent component/event for the composite GI primary end point. This adverse event is potentially clinically relevant in long-term NSAID treatment. To define potential risk factors associated with a decrease in haemoglobin/haematocrit. Post hoc analysis of the CONDOR trial was conducted in the intention-to-treat population. Clinically significant blood loss was defined as: (i) a haemoglobin drop ≥2 g/dL and/or a haematocrit drop ≥10%; and (ii) blood loss adjudicated as either of defined or presumed GI origin. Fifteen risk factors were evaluated by stepwise logistic regression. Each factor had to be significant at osteoarthritis (OA) patients had decreased haemoglobin/haematocrit and were adjudicated to the GI endpoint. Significant risk factors, at the 0.20 α level found to be associated with clinically significant blood loss in OA patients included [odds ratio (80% CI)] baseline C-reactive protein (CRP) levels [2.27 (1.46-3.53)], history of gastritis and history of GI intolerance [1.55 (1.06-2.28)], positive Helicobacter pylori at screening [1.54 (1.07-2.22)], increasing age [1.17 (1.04-1.32)] and body mass index [BMI; 1.03 (1.00-1.06)]. Monitoring for decreases in haemoglobin should be considered for all OA patients and especially those with an increased age, BMI, history of gastritis and GI intolerance, CRP levels >1 mg/dL and/or positive H. pylori status, as this may affect their clinical management. © 2012 Blackwell Publishing Ltd.

  16. Soroepidemiologia para o virus da hepatite B (VHB em gestantes/parturientes e sua transmissão para recém-nascidos em Goiânia, GO

    Directory of Open Access Journals (Sweden)

    Divina das Dores P. Cardoso

    1996-08-01

    Full Text Available Foram coletadas, entre março de 1990 e julho de 1992, 1459 amostras sanguíneas de mulheres gestantes/parturientes na cidade de Goiânia-GO, objetivando detecção da infecção pelo vírus da hepatite B (VHB, através dos marcadores sorológicos AgHBs e anti-HBs. O percentual depositividade encontrado, pelo teste imunoenzimãtico, foi de 7,5%, sendo 0,5%para AgHBs e 7,0%para anti-HBs. A análise efetuada, considerando a faixa etária, mostra que 7 de 8 mulheres AgHBs-positivas pertenciam à faixa etária de até 30 anos, situação semelhante em relação ao anti-HBs(83/101. Das 8 mulheres positivas, 4 tiveram seus recém-nascidos submetidos a tratamento profilático com vacina (Engerix B e imunoglobulina humana anti-hepatite B (HBIG. Além disso, 3 dessas crianças foram analisadas sorologicamente, sendo que uma era AgHBs-positiva ao nascimento. Doença sexualmente transmissível e transfusão sanguínea foram fatores de risco que coirelacionaram significantemente com a infecção. Esses resultados parece-nos reforçar a indicação de triagem à infecção pelo vírus da hepatite B no período pré-natal, assim como a adoção de medidas imunoprofiláticas nas crianças nascidas de mães positivas.In order to detect hepatitis B vírus (HBV, 1459 serum samples from pregnant/parturient women were collected at two public hospitals in Goiânia, GO. These samples were tested by enzyme linked immunosorbent assay forHBsAg and anti-HBs. 109 (7.5% serum samples were positive. Eight (0.5% sera were positive for HBsAg and 101 (7.0% for anti-HBs. Viral positivity for both HBsAg and anti- HBs were observed in women which age ranged from 15 to 30 years. Four newborns from HBsAg positive mothers were submitted to the treatment with HBV vaccine (Engerix B and with hyperimmune gammaglobulin (HBIG - Abbott Laboratories - Brazil. Cord blood from one of the newborns was positive for HBsAg. A positive association was found between hepatitis B and sexually

  17. Inaccuracy of haemoglobin A1c among HIV-infected men: effects of CD4 cell count, antiretroviral therapies and haematological parameters

    Science.gov (United States)

    Slama, Laurence; Palella, Frank J.; Abraham, Alison G.; Li, Xiuhong; Vigouroux, Corinne; Pialoux, Gilles; Kingsley, Lawrence; Lake, Jordan E.; Brown, Todd T.; Margolick, Joseph B.; Crain, Barbara; Dobs, Adrian; Farzadegan, Homayoon; Gallant, Joel; Johnson-Hill, Lisette; Plankey, Michael; Sacktor, Ned; Selnes, Ola; Shepard, James; Thio, Chloe; Wolinsky, Steven M.; Phair, John P.; Badri, Sheila; O'Gorman, Maurice; Ostrow, David; Palella, Frank; Ragin, Ann; Detels, Roger; Martínez-Maza, Otoniel; Aronow, Aaron; Bolan, Robert; Breen, Elizabeth; Butch, Anthony; Jamieson, Beth; Miller, Eric N.; Oishi, John; Vinters, Harry; Wiley, Dorothy; Witt, Mallory; Yang, Otto; Young, Stephen; Zhang, Zuo Feng; Rinaldo, Charles R.; Kingsley, Lawrence A.; Becker, James T.; Cranston, Ross D.; Martinson, Jeremy J.; Mellors, John W.; Silvestre, Anthony J.; Stall, Ronald D.; Jacobson, Lisa P.; Munoz, Alvaro; Abraham, Alison; Althoff, Keri; Cox, Christopher; D'Souza, Gypsyamber; Golub, Elizabeth; Schollenberger, Janet; Seaberg, Eric C.; Su, Sol; Huebner, Robin E.; Dominguez, Geraldina

    2014-01-01

    Background There is limited evidence that among HIV-infected patients haemoglobin A1c (HbA1c) values may not accurately reflect glycaemia. We assessed HbA1c discordance (observed HbA1c − expected HbA1c) and associated factors among HIV-infected participants in the Multicenter AIDS Cohort Study (MACS). Methods Fasting glucose (FG) and HbA1c were measured at each semi-annual MACS visit since 1999. All HIV-infected and HIV-uninfected men for whom at least one FG and HbA1c pair measurement was available were evaluated. Univariate median regression determined the association between HbA1c and FG by HIV serostatus. The relationship between HbA1c and FG in HIV-uninfected men was used to determine the expected HbA1c. Generalized estimating equations determined factors associated with the Hb1Ac discordance among HIV-infected men. Clinically significant discordance was defined as observed HbA1c − expected HbA1c ≤−0.5%. Results Over 13 years, 1500 HIV-uninfected and 1357 HIV-infected men were included, with a median of 11 visits for each participant. At an FG of 125 mg/dL, the median HbA1c among HIV-infected men was 0.21% lower than among HIV-uninfected men and the magnitude of this effect increased with FG >126 mg/dL. Sixty-three percent of HIV-infected men had at least one visit with clinically significant HbA1c discordance, which was independently associated with: low CD4 cell count (<500 cells/mm3); a regimen containing a protease inhibitor, a non-nucleoside reverse transcriptase inhibitor or zidovudine; high mean corpuscular volume; and abnormal corpuscular haemoglobin. Conclusion HbA1c underestimates glycaemia in HIV-infected patients and its use in patients with risk factors for HbA1c discordance may lead to under-diagnosis and to under-treatment of established diabetes mellitus. PMID:25096078

  18. Calibration of the HemoCue point-of-care analyser for determining haemoglobin concentration in a lizard and a fish.

    Science.gov (United States)

    Andrewartha, Sarah J; Munns, Suzanne L; Edwards, Ashley

    2016-01-01

    Haemoglobin concentration ([Hb]) is measured for a wide variety of animal studies. The use of point-of-care devices, such as the HemoCue, is becoming increasingly common because of their portability, relative ease of use and low cost. In this study, we aimed to determine whether the [Hb] of blue-tongued skink (Tiliqua nigrolutea) blood can be determined accurately using the HemoCue and whether the HemoCue overestimates the [Hb] of reptile blood in a similar manner to fish blood. Additionally, we aimed to test whether ploidy affected [Hb] determined by the HemoCue using blood from diploid and triploid Atlantic salmon (Salmo salar). The HemoCue Hb 201(+) systematically overestimated [Hb] in both blue-tongued skinks and Atlantic salmon, and there was no difference between calibration equations determined for diploid or triploid salmon. The overestimation was systematic in both species and, as such, [Hb] determined by the HemoCue can be corrected using appropriate calibration equations.

  19. Mapping of calf muscle oxygenation and haemoglobin content during dynamic plantar flexion exercise by multi-channel time-resolved near-infrared spectroscopy.

    Science.gov (United States)

    Torricelli, Alessandro; Quaresima, Valentina; Pifferi, Antonio; Biscotti, Giovanni; Spinelli, Lorenzo; Taroni, Paola; Ferrari, Marco; Cubeddu, Rinaldo

    2004-03-07

    A compact and fast multi-channel time-resolved near-infrared spectroscopy system for tissue oximetry was developed. It employs semiconductor laser and fibre optics for delivery of optical signals. Photons are collected by eight 1 mm fibres and detected by a multianode photomultiplier. A time-correlated single photon counting board is used for the parallel acquisition of time-resolved reflectance curves. Estimate of the reduced scattering coefficient is achieved by fitting with a standard model of diffusion theory, while the modified Lambert-Beer law is used to assess the absorption coefficient. In vivo measurements were performed on five healthy volunteers to monitor spatial changes in calf muscle (medial and lateral gastrocnemius; MG, LG) oxygen saturation (SmO2) and total haemoglobin concentration (tHb) during dynamic plantar flexion exercise performed at 50% of the maximal voluntary contraction. At rest SmO2 was 73.0 +/- 0.9 and 70.5 +/- 1.7% in MG and LG, respectively (P = 0.045). At the end of the exercise, SmO2 decreased (69.1 +/- 1.8 and 63.8 +/- 2.1% in MG and LG, respectively; P < 0.01). The LG desaturation was greater than the MG desaturation (P < 0.02). These results strengthen the role of time-resolved near-infrared spectroscopy as a powerful tool for investigating the spatial and temporal features of muscle SmO2 and tHb.

  20. Associations of glycated haemoglobin A1c and glycated albumin with subclinical atherosclerosis in middle-aged and elderly Chinese population with impaired glucose regulation.

    Science.gov (United States)

    Ma, Xiaojing; Shen, Yun; Hu, Xiang; Hao, Yaping; Luo, Yuqi; Tang, Junling; Zhou, Jian; Bao, Yuqian; Jia, Weiping

    2015-06-01

    The aim of this study was to investigate the correlations of glycated haemoglobin A1c (HbA1c) and glycated albumin (GA) with subclinical atherosclerosis in middle-aged and elderly Chinese populations with impaired glucose regulation (IGR). In total, 640 subjects with IGR and no history of cardiovascular disease or carotid artery plaque were recruited for this study (256 men, 384 women; age range, 40-70 years). The carotid intima-media thickness (C-IMT) measured by carotid ultrasonography was used as an indicator of subclinical atherosclerosis. Increased C-IMT was defined as ≥ 0.70 mm (upper quartile). HbA1c and GA were measured with high-performance liquid chromatography and enzymatic method, respectively. The average HbA1c and GA among all 640 subjects were 5.7 ± 0.3% and 14.0 ± 1.1%, respectively. HbA1c and GA were higher in subjects with increased C-IMT than in subjects with normal C-IMT (5.8 ± 0.3% vs 5.7 ± 0.3% and 14.2 ± 1.0% vs 13.9 ± 1.1%, respectively; both P subclinical atherosclerosis in middle-aged and elderly Chinese populations with IGR. © 2015 Wiley Publishing Asia Pty Ltd.

  1. A randomised placebo-controlled trial to determine the effect of iron supplementation on pregnancy outcome in pregnant women with haemoglobin > or = 13.2 g/dl.

    Science.gov (United States)

    Ziaei, S; Norrozi, M; Faghihzadeh, S; Jafarbegloo, E

    2007-06-01

    To study the effect of iron supplementation on pregnancy outcome in pregnant women with haemoglobin (Hb) > or = 13.2 g/dl. A randomised, double-blind, placebo-controlled trial. Routine health services. Seven hundred and twenty-seven pregnant women with Hb > or = 13.2 g/dl in the early stage of the second trimester. Each woman took one ferrous sulphate [DOSAGE ERROR CORRECTED] tablet (150 g tablet, containing 50 mg of elemental iron) [DOSAGE ERROR CORRECTED] daily in the case group (n = 370) or placebo in the control group (n = 357) throughout pregnancy. Pregnancy outcome. While there were no significant differences in demographic and obstetric characteristics between the two groups before any intervention, small-for-gestational-age birth rate and the number of women with hypertension disorder increased significantly in the case group in comparison with the control group (57 [15.7%] versus 36 [10.3%], P = 0.035, 10 [2.7%] versus 3 [8%], P = 0.05, respectively). Our finding proves that routine iron supplementation in nonanaemic women is not rational and may be harmful.

  2. Assessment of the impact of malaria on CD4+ T Cells and haemoglobin levels of HIV-malaria co-infected patients.

    Science.gov (United States)

    Tagoe, Daniel Nii Aryee; Boachie, Joseph

    2012-09-17

    The human immunodeficiency virus (HIV) and malaria destroy important cells required for proper immunological and haematological functioning of the body. This research therefore aimed to assess the effect of malaria on CD4+ and haemoglobin (Hb) levels of HIV-malaria co-infected patients. The study was performed by sampling 220 adult HIV patients on highly active anti retroviral therapy (HAART) who routinely visited the Tema General Hospital in Ghana. Blood samples were obtained for both blood film microscopy identification of malaria parasites and analysis using rapid diagnostic test kits. A BD Facscount Analyzer was used in the quantification of CD4+ levels. Of the 220 patients sampled, 34 (15.5%) were HIV-malaria co-infected, all of whom (34; 100%) had CD4+ counts below the normal range, while 23 (12.9%) of the HIV mono-infected patients had normal CD4+ counts. Almost all HIV-malaria co-infected patients (33; 97.1%) had low Hb levels, whereas 79 (42.5%) of the HIV mono-infected patients had normal Hb. Malaria infection strongly correlated positively and significantly with both low CD4+ count (χ2 = 0.828, P = 0.003) and Hb (χ2 = 0.817, P = 0.004) levels. Malaria co-infection with HIV decreases CD4+ T cells and Hb levels in patients. It is therefore recommended that HIV patients in malaria endemic areas should adhere to malaria preventive measures.

  3. The association of haemoglobin A{sub 1C} levels with the clinical and CT characteristics of Klebsiella pneumoniae liver abscesses in patients with diabetes mellitus

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hong-Hau [Tri-Service General Hospital, National Defense Medical Center, Department of Radiology, Taipei (China); Tri-Service General Hospital Songshan Branch. National Defense Medical Center, Department of Radiology, Taipei (China); Tsai, Shih-Hung [Tri-Service General Hospital, National Defense Medical Center, Department of Emergency Medicine, Taipei (China); Yu, Chih-Yung; Hsu, Hsian-He; Liu, Chang-Hsien; Huang, Guo-Shu; Chang, Wei-Chou [Tri-Service General Hospital, National Defense Medical Center, Department of Radiology, Taipei (China); Lin, Jung-Chung [Tri-Service General Hospital, National Defense Medical Center, Division of Infectious Diseases and Tropical Medicine, Department of Internal Medicine, Taipei (China); Cheng, Wei-Tung; Chen, Ching-Yang [Tri-Service General Hospital Songshan Branch. National Defense Medical Center, Department of Radiology, Taipei (China); Tung, Ho-Jui [Asia University, Department of Healthcare Administration, Taichung (China)

    2014-05-15

    To compare the characteristics of Klebsiella pneumoniae liver abscesses (KPLA) in diabetic patients with different levels of glycaemic control. The institutional review board approved this retrospective study. A total of 221 patients with KPLA were included. Clinical features of KPLA were compared. We divided the 120 diabetic patients with KPLA into three subgroups based on haemoglobin A{sub 1C} (HbA{sub 1C}) concentration (good, HbA{sub 1C} ≤ 7.0 %; suboptimal, 7.0 % < HbA{sub 1C} ≤ 9.0 %; poor, HbA{sub 1C} > 9.0 %). In this study, we used a semiautomated quantitative method to assess the gas and total abscess volumes in KPLA. Statistical analysis was performed with the chi-squared test and one-way analysis of variance. The mortality rate did not significantly differ between the nondiabetic and diabetic groups. However, patients with poor glycaemic control had significantly more complications and therefore a longer hospital stay (P < 0.05). In our study, CT and quantitative analyses found that patients in the group with poor glycaemic control had a significantly higher incidence of gas formation and hepatic venous thrombophlebitis and a higher gas-to-abscess volume ratio than patients with suboptimal and good glycaemic control (P < 0.05). Diabetic patients with a high HbA{sub 1C} concentration (>9.0 %) have an association with hepatic venous thrombophlebitis, gas formation and metastatic infection complications associated with KPLA. (orig.)

  4. Diagnosing gestational diabetes mellitus: implications of recent changes in diagnostic criteria and role of glycated haemoglobin (HbA1c).

    Science.gov (United States)

    Hanna, Fahmy W; Duff, Christopher J; Shelley-Hitchen, Ann; Hodgson, Ellen; Fryer, Anthony A

    2017-04-01

    Gestational diabetes mellitus (GDM; approximately 5% of pregnancies) represents the most important risk factor for development of later-onset diabetes mellitus. We examined concordance between GDM diagnosis defined using the original 1999 World Health Organization (WHO) criteria and the more recent 2013 WHO criteria and 2015 National Institute for Health and Care Excellence (NICE) criteria. We studied two groups: a case-control group of 257 GDM positive and 266 GDM negative cases, and an incident cohort 699 GDM positive and 6,231 GDM negative cases. In the incident cohort, GDM prevalence was 3.7% (WHO 1999 criteria), 11.4% (NICE 2015 criteria) and 13.7% (WHO 2013 criteria). Our results showed that a significant number of additional cases are detected using the more recent NICE and WHO criteria than the original 1999 WHO criteria, but these additional cases represent an intermediate group with 'moderate' dysglycaemia (abnormal blood glucose levels). Our results also show that use of these newer criteria misses a similar group of intermediate cases that were defined as GDM by the 1999 WHO criteria and that glycated haemoglobin in isolation is unlikely to replace the oral glucose tolerance test in GDM diagnosis. © Royal College of Physicians 2017. All rights reserved.

  5. Mapping of calf muscle oxygenation and haemoglobin content during dynamic plantar flexion exercise by multi-channel time-resolved near-infrared spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Torricelli, Alessandro [INFM-Dipartimento di Fisica and IFN-CNR, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milan (Italy); Quaresima, Valentina [Department of Biomedical Sciences and Technologies, University of L' Aquila, I-67100 L' Aquila (Italy); Pifferi, Antonio [INFM-Dipartimento di Fisica and IFN-CNR, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milan (Italy); Biscotti, Giovanni [INFM-Dipartimento di Fisica and IFN-CNR, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milan (Italy); Spinelli, Lorenzo [INFM-Dipartimento di Fisica and IFN-CNR, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milan (Italy); Taroni, Paola [INFM-Dipartimento di Fisica and IFN-CNR, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milan (Italy); Ferrari, Marco [Department of Biomedical Sciences and Technologies, University of L' Aquila, I-67100 L' Aquila (Italy); Cubeddu, Rinaldo [INFM-Dipartimento di Fisica and IFN-CNR, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milan (Italy)

    2004-03-07

    A compact and fast multi-channel time-resolved near-infrared spectroscopy system for tissue oximetry was developed. It employs semiconductor laser and fibre optics for delivery of optical signals. Photons are collected by eight 1 mm fibres and detected by a multianode photomultiplier. A time-correlated single photon counting board is used for the parallel acquisition of time-resolved reflectance curves. Estimate of the reduced scattering coefficient is achieved by fitting with a standard model of diffusion theory, while the modified Lambert-Beer law is used to assess the absorption coefficient. In vivo measurements were performed on five healthy volunteers to monitor spatial changes in calf muscle (medial and lateral gastrocnemius; MG, LG) oxygen saturation (SmO{sub 2}) and total haemoglobin concentration (tHb) during dynamic plantar flexion exercise performed at 50% of the maximal voluntary contraction. At rest SmO{sub 2} was 73.0 {+-} 0.9 and 70.5 {+-} 1.7% in MG and LG, respectively (P = 0.045). At the end of the exercise, SmO{sub 2} decreased (69.1 {+-} 1.8 and 63.8 {+-} 2.1% in MG and LG, respectively; P < 0.01). The LG desaturation was greater than the MG desaturation (P < 0.02). These results strengthen the role of time-resolved near-infrared spectroscopy as a powerful tool for investigating the spatial and temporal features of muscle SmO{sub 2} and tHb.

  6. Incidental detection of haemoglobin (Hb) variants during high performance liquid chromatography (HPLC) analysis of HbA1c: is it time for a standardised approach to reporting?

    Science.gov (United States)

    Reeve, J; Blake, L; Griffin, D; O'Shea, P

    2015-06-01

    Haemoglobin (Hb) variants are genetic variations in the globin genes that code for an abnormal globin protein structure. The prevalence of Hb variants has increased in Ireland due to the number of emigrants from Africa and Southeast Asia. The rate of incidentally detected Hb variants, in laboratories employing HPLC to measure HbA1c, has increased in parallel. The presence of a Hb variant can compromise HbA1c measurement and interpretation. In such cases, HbA1c cannot be used to diagnose diabetes or to assess concordance with glycaemic targets. To establish the number of incidentally identified Hb variants during 10 months of routine HbA1c analysis, and the percentage of HbA1c reports alerting the requesting clinician to the presence of a Hb variant. The laboratory database was interrogated to extract all records of HbA1c requests and incidentally identified Hb variants from March to December 2012. A total of 32,636 HbA1c analyses were performed during the evaluation period. Seventy-three Hb variants were identified in a total of 46 patients. In 32.6% (15 of 46) the haemoglobinopathy status was known prior to testing and 97% of HbA1c reports communicated the presence of the Hb variant to the requesting clinician. Hb variants may invalidate the results of HbA1c analysis and could result in a missed diagnosis or a misdiagnosis of diabetes or mismanagement of a patient with diabetes mellitus. It is, therefore, imperative that a comment alerting the requesting clinician to the presence of the Hb variant is appended to the HbA1c result.

  7. The impact of preoperative testing for blood glucose concentration and haemoglobin A1c on mortality, changes in management and complications in noncardiac elective surgery: a systematic review.

    Science.gov (United States)

    Bock, Matthias; Johansson, Tim; Fritsch, Gerhard; Flamm, Maria; Hansbauer, Bernhard; Mann, Eva; Sönnichsen, Andreas

    2015-03-01

    The risks associated with surgery are elevated in patients with diabetes mellitus. For this reason, preoperative diagnostics frequently include the measurement of blood glucose and haemoglobin A1c (HbA1c), but it is unclear whether these tests contribute to improved perioperative or postoperative outcomes. This systematic review aimed to evaluate the evidence that preoperative testing for blood glucose and HbA1c might influence the following outcome parameters: changes in clinical management; mortality; and the incidence of perioperative and postoperative complications in patients undergoing elective, noncardiac surgery. We performed a systematic search of the literature from January 2001 to March 2013, thus updating a review carried out by the National Institute for Health and Clinical Excellence (NICE) up to the year 2001. Controlled studies including cohort and case-control studies with a population of at least 60 patients were eligible. The search retrieved 1346 records (including hand-search). Twenty-two studies met all inclusion criteria and were included in the review. Fifteen cohort and two case-control studies evaluated the effectiveness of preoperative blood glucose testing and nine studies the effectiveness of testing HbA1c. Four of the included studies evaluated both tests. There were no data derived from high-quality studies supporting routine preoperative testing for blood glucose or HbA1c in otherwise healthy adult patients undergoing elective noncardiac surgery. Only in vascular and orthopaedic surgery may screening identify patients at an increased risk. Preoperative blood glucose testing and testing for HbA1c is not required in nondiabetic patients unless there are clinical sings arousing suspicion. Patients scheduled for vascular and orthopaedic surgery carry an elevated risk justifying preoperative testing for blood glucose or HbA1c as a screening tool.

  8. Community Rates of IgG4 Antibodies to Ascaris Haemoglobin Reflect Changes in Community Egg Loads Following Mass Drug Administration.

    Directory of Open Access Journals (Sweden)

    Johnny Vlaminck

    2016-03-01

    Full Text Available Conventional diagnostic methods for human ascariasis are based on the detection of Ascaris lumbricoides eggs in stool samples. However, studies of ascariasis in pigs have shown that the prevalence and the number of eggs detected in the stool do not correlate well with exposure of the herd to the parasite. On the other hand, an ELISA test measuring antibodies to Ascaris suum haemoglobin (AsHb has been shown to be useful for estimating transmission intensity on pig farms. In this study, we further characterized the AsHb antigen and screened samples from a population-based study conducted in an area that is endemic for Ascaris lumbricoides in Indonesia to assess changes in AsHb antibody rates and levels in humans following mass drug administration (MDA.We developed and evaluated an ELISA to detect human IgG4 antibodies to AsHb. We tested 1066 plasma samples collected at different times from 599 subjects who lived in a village in rural Indonesia that was highly endemic for ascariasis. The community received 6 rounds of MDA for lymphatic filariasis with albendazole plus diethylcarbamazine between 2002 and 2007. While the AsHb antibody assay was not sensitive for detecting all individuals with Ascaris eggs in their stools, the percentage of seropositive individuals decreased rapidly following MDA. Reductions in antibody rates reflected decreased mean egg output per person both at the community level and in different age groups. Two years after the last round of MDA the community egg output and antibody prevalence rate were reduced by 81.6% and 78.9% respectively compared to baseline levels.IgG4 antibody levels to AsHb appear to reflect recent exposure to Ascaris. The antibody prevalence rate may be a useful indicator for Ascaris transmission intensity in communities that can be used to assess the impact of control measures on the force of transmission.

  9. Dynamic population pharmacokinetic-pharmacodynamic modelling and simulation supports similar efficacy in glycosylated haemoglobin response with once or twice-daily dosing of canagliflozin.

    Science.gov (United States)

    de Winter, Willem; Dunne, Adrian; de Trixhe, Xavier Woot; Devineni, Damayanthi; Hsu, Chyi-Hung; Pinheiro, Jose; Polidori, David

    2017-05-01

    Canagliflozin is an SGLT2 inhibitor approved for the treatment of type-2 diabetes. A dynamic population pharmacokinetic-pharmacodynamic (PK/PD) model relating 24-h canagliflozin exposure profiles to effects on glycosylated haemoglobin was developed to compare the efficacy of once-daily and twice-daily dosing. Data from two clinical studies, one with once-daily, and the other with twice-daily dosing of canagliflozin as add-on to metformin were used (n = 1347). An established population PK model was used to predict full 24-h profiles from measured trough concentrations and/or baseline covariates. The dynamic PK/PD model incorporated an Emax relationship between 24-h canagliflozin exposure and HbA1c-lowering with baseline HbA1c affecting the efficacy. Internal and external model validation demonstrated that the model adequately predicted HbA1c-lowering for canagliflozin once-daily and twice-daily dosing regimens. The differences in HbA1c reduction between the twice-daily and daily mean profiles were minimal (at most 0.023% for 100 mg total daily dose [TDD] and 0.011% for 300 mg TDD, up to week 26, increasing with time and decreasing with TDD) and not considered clinically meaningful. Simulations using this model demonstrated the absence of clinically meaningful between-regimen differences in efficacy, supported the regulatory approval of a canagliflozin-metformin immediate release fixed-dose combination tablet and alleviated the need for an additional clinical study. © 2016 The British Pharmacological Society.

  10. Effects of age and sex in the diagnosis of type 2 diabetes using glycated haemoglobin in Japan: the Yuport Medical Checkup Centre study.

    Science.gov (United States)

    Inoue, Machiko; Inoue, Kazuo; Akimoto, Kimihiko

    2012-01-01

    We examined how the prevalence of individuals diagnosed with diabetes differs by age and sex using the diagnostic criteria of fasting plasma glucose (FPG) and/or glycated haemoglobin (HbA1c) in a large Japanese population. We conducted a cross-sectional study using a dataset of 33,959 people (16,869 men and 17,090 women) without known diabetes who underwent health checkups from 1998 to 2006. We divided the age range of the participants into six groups of similar numbers. We compared the prevalence of diabetes using the criteria of FPG ≥7.0 mmol/l (126 mg/dl), HbA1c ≥48 mmol/mol (6.5%), or both, in men and women in each age group. Men had higher prevalence of diabetes than women using the criterion of either FPG or HbA1c (7.5% men vs. 3.4% women, P<0.001), or both (4.3% men vs. 1.8% women, P<0.001). HbA1c increased steadily in women through the six age groups. In the oldest group (≥66 years), the proportion of women among those diagnosed with diabetes was as high as 42.3% (215/508) using the criterion of either FPG or HbA1c, and 41.6% (116/279) using both criteria. Using either FPG or HbA1c, the prevalence of people diagnosed with diabetes would almost double compared to using the criterion of both scores, and this would include more elderly women than men. The impact of introducing HbA1c for diabetes diagnosis should be considered in terms of age and sex.

  11. Life on the edge: O2 binding in Atlantic cod red blood cells near their southern distribution limit is not sensitive to temperature or haemoglobin genotype.

    Science.gov (United States)

    Barlow, Samantha L; Metcalfe, Julian; Righton, David A; Berenbrink, Michael

    2017-02-01

    Atlantic cod are a commercially important species believed to be threatened by warming seas near their southern, equatorward upper thermal edge of distribution. Limitations to circulatory O2 transport, in particular cardiac output, and the geographic distribution of functionally different haemoglobin (Hb) genotypes have separately been suggested to play a role in setting thermal tolerance in this species. The present study assessed the thermal sensitivity of O2 binding in Atlantic cod red blood cells with different Hb genotypes near their upper thermal distribution limit and modelled its consequences for the arterio-venous O2 saturation difference, Sa-vO2 , another major determinant of circulatory O2 supply rate. The results showed statistically indistinguishable red blood cell O2 binding between the three HbI genotypes in wild-caught Atlantic cod from the Irish Sea (53° N). Red blood cells had an unusually low O2 affinity, with reduced or even reversed thermal sensitivity between pH 7.4 and 7.9, and 5.0 and 20.0°C. This was paired with strongly pH-dependent affinity and cooperativity of red blood cell O2 binding (Bohr and Root effects). Modelling of Sa-vO2  at physiological pH, temperature and O2 partial pressures revealed a substantial capacity for increases in Sa-vO2  to meet rising tissue O2 demands at 5.0 and 12.5°C, but not at 20°C. Furthermore, there was no evidence for an increase of maximal Sa-vO2  with temperature. It is suggested that Atlantic cod at such high temperatures may solely depend on increases in cardiac output and blood O2 capacity, or thermal acclimatisation of metabolic rate, for matching circulatory O2 supply to tissue demand. © 2017. Published by The Company of Biologists Ltd.

  12. [Introduction of capillary glycosylated haemoglobin determination in a Primary Care Health Area: Multicentre study of the evolution of patients with type 2 diabetes mellitus].

    Science.gov (United States)

    Núñez-Sánchez, M Á; Cervantes-Cuesta, M Á; Brocal-Ibañez, P; Salmeron-Arjona, E; León-Martínez, L P; Cerezo-Sanmartin, M

    The aim of this study was to evaluate the efficiency of a joint intervention that included educational components, self-assessment, and information to optimise diabetes control through the introduction of instant capillary glycosylated haemoglobin (HbA1c) determination in Primary Care. A multicentre prospective descriptive study was carried out over 3years in 10Primary Care Centres of the Area VII Murcia East. At the end of the study there were 804 patients with type 2 diabetes (DM2). Patients were divided into 4 groups based on initial values of HbA1c, and if changes in their treatment were needed. HbA1c, body mass index, and blood pressure were monitored. A financial assessment was also performed on the impact of the implementation of a protocol to measure instant capillary RESULTS: A significant reduction was observed in HbA1c values. The initial HbA1c mean value was 7.4±1.4%, which decreased to a final value of 6.9±1.0% (P<.001). At the end of the study, 71.4% of patients included reached diabetic control objectives. In addition, the financial assessment demonstrated that the implementation of this diabetes control system led to a decrease of the 24.7% in spending on glucose strips after the first year of study in Area VII Murcia Health Service. The introduction of capillary HbA1c determination in Primary Care has demonstrated to improve diabetes control and the efficiency of the health personnel. Furthermore, a reduction in the health costs of patients with DM2 was also shown. Copyright © 2016 SECA. Publicado por Elsevier España, S.L.U. All rights reserved.

  13. Treatment of renal anaemia with erythropoiesis-stimulating agents in predialysis chronic kidney disease patients: Haemoglobin profile during the 6 months before initiation of dialysis.

    Science.gov (United States)

    Kawahara, Kazuhiko; Minakuchi, Jun; Yokota, Narushi; Suekane, Hiroto; Tsuchida, Kenji; Kawashima, Shu

    2015-12-01

    Erythropoiesis-stimulating agents (ESAs) are all effective for renal anaemia in patients with chronic kidney disease (CKD). However, it was reported that the haemoglobin (Hb) concentration decreases to 8.4 g/dL during the initial phase of dialysis despite treatment with recombinant human erythropoietin (rHuEPO). This study compared Hb at the initiation of dialysis among patients treated with three different ESAs (rHuEPO, darbepoetin alfa [DA], and a continuous erythropoietin receptor activator [CERA]). The subjects were 82 CKD patients who started dialysis at Kawashima Hospital between 1 January 2009 and 28 February 2015 and who received only one kind of ESA for at least 6 months before initiation of dialysis. Baseline characteristics and laboratory data at initiation of dialysis were compared among the three groups. Then changes of the Hb, ESA dose, and erythropoiesis resistance index were assessed over time during the 6 months before initiation of dialysis. Differences of Hb at the initiation of dialysis were also assessed. Among the 82 patients, 36 received rHuEPO, 13 received DA, and 33 received CERA. Baseline characteristics and laboratory data of the patients showed no significant differences among the three groups. The monthly Hb decreased gradually during the 6-month period before initiation of dialysis in all three groups. Hb was significantly higher in the CERA group than the rHuEPO group at the initiation of dialysis. Long-acting ESAs may be more useful for predialysis patients with CKD because they do not attend hospital frequently, unlike haemodialysis patients. © 2015 Asian Pacific Society of Nephrology.

  14. Increasing oxygen availability for improving poly(3-hydroxybutyrate) production by Halomonas.

    Science.gov (United States)

    Ouyang, Pengfei; Wang, Huan; Hajnal, Ivan; Wu, Qiong; Guo, Yingying; Chen, Guo-Qiang

    2017-11-16

    Technologies enabling high-cell-density growth are required for economical industrial production of most biotechnological products. However, the key factor limiting cell density in bioreactors is the availability of oxygen during the late phases of fermentation. Although the expression of bacterial Vitreoscilla hemoglobin (VHb) is useful for enhanced oxygen availability, bacterial cell membrane makes efficient hemoglobin-oxygen contact a challenge. On the other hand, periplasmic spaces of Gram-negative microorganisms offer an excellent compartment for the intermittent storage of hemoglobin-bound oxygen. In this study, the cell growth was increased by a remarkable 100% using the twin-arginine translocase (Tat) pathway to export active VHb into the periplasm of Escherichia coli, Halomonas bluephagenesis TD01 and H. campaniensis LS21. Furthermore, eight low-oxygen-inducible vgb promoters were constructed in tandem to become a strong promoter cassette termed P8vgb, which better induces expression of both gene vgb encoding VHb and the PHB synthesis operon microaerobically. Both the P8vgb and VHb performed excellently in E. coli and two Halomonas spp., demonstrating their universal applicability for various organisms. Copyright © 2017 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  15. Improved Production of Aspergillus usamii endo-β-1,4-Xylanase in Pichia pastoris via Combined Strategies

    Directory of Open Access Journals (Sweden)

    Jianrong Wang

    2016-01-01

    Full Text Available A series of strategies were applied to improve expression level of recombinant endo-β-1,4-xylanase from Aspergillus usamii (A. usamii in Pichia pastoris (P. pastoris. Firstly, the endo-β-1,4-xylanase (xynB gene from A. usamii was optimized for P. pastoris and expressed in P. pastoris. The maximum xylanase activity of optimized (xynB-opt gene was 33500 U/mL after methanol induction for 144 h in 50 L bioreactor, which was 59% higher than that by wild-type (xynB gene. To further increase the expression of xynB-opt, the Vitreoscilla hemoglobin (VHb gene was transformed to the recombinant strain containing xynB-opt. The results showed that recombinant strain harboring the xynB-opt and VHb (named X33/xynB-opt-VHb displayed higher biomass, cell viability, and xylanase activity. The maximum xylanase activity of X33/xynB-opt-VHb in 50 L bioreactor was 45225 U/mL, which was 35% and 115% higher than that by optimized (xynB-opt gene and wild-type (xynB gene. Finally, the induction temperature of X33/xynB-opt-VHb was optimized in 50 L bioreactor. The maximum xylanase activity of X33/xynB-opt-VHb reached 58792 U/mL when the induction temperature was 22°C. The results presented here will greatly contribute to improving the production of recombinant proteins in P. pastoris.

  16. Improved Production of Aspergillus usamii endo-β-1,4-Xylanase in Pichia pastoris via Combined Strategies.

    Science.gov (United States)

    Wang, Jianrong; Li, Yangyuan; Liu, Danni

    2016-01-01

    A series of strategies were applied to improve expression level of recombinant endo-β-1,4-xylanase from Aspergillus usamii (A. usamii) in Pichia pastoris (P. pastoris). Firstly, the endo-β-1,4-xylanase (xynB) gene from A. usamii was optimized for P. pastoris and expressed in P. pastoris. The maximum xylanase activity of optimized (xynB-opt) gene was 33500 U/mL after methanol induction for 144 h in 50 L bioreactor, which was 59% higher than that by wild-type (xynB) gene. To further increase the expression of xynB-opt, the Vitreoscilla hemoglobin (VHb) gene was transformed to the recombinant strain containing xynB-opt. The results showed that recombinant strain harboring the xynB-opt and VHb (named X33/xynB-opt-VHb) displayed higher biomass, cell viability, and xylanase activity. The maximum xylanase activity of X33/xynB-opt-VHb in 50 L bioreactor was 45225 U/mL, which was 35% and 115% higher than that by optimized (xynB-opt) gene and wild-type (xynB) gene. Finally, the induction temperature of X33/xynB-opt-VHb was optimized in 50 L bioreactor. The maximum xylanase activity of X33/xynB-opt-VHb reached 58792 U/mL when the induction temperature was 22°C. The results presented here will greatly contribute to improving the production of recombinant proteins in P. pastoris.

  17. Developing a classification system for haemoglobin management in patients with end-stage renal disease on haemodialysis: a secondary data analysis.

    Science.gov (United States)

    Kesztyüs, Tibor; Simonsmeier, Ulrich; Kesztyüs, Dorothea

    2017-11-08

    Ongoing discussion on anaemia management and target haemoglobin (Hb) levels in patients on haemodialysis with erythropoietin treatment require a systematic approach in evaluating current practice. Aim of the present study was to develop a new classification system to easily monitor Hb trajectories and categorise patients on haemodialysis. Routine data from five dialysis centres in the USA collected between 2010 and 2016. Data were anonymised and only those from patients with fortnightly Hb values were included in the analysis. Entries on blood parameters and medication were standardised to achieve overall comparability. Data from each patient was grouped in periods of 120 days. Hb values above or below the target level of 10-12 g/dL were counted for each period. Periods were then assigned to Hb-classes according to the number of Hb values out of range per period: Hb-class I with 0-2, Hb-class II for 3-5 and Hb-class III for ≥6 values out of range. Records from 3349 patients with fortnightly Hb values, information on haemodialysis data, laboratory parameters correlated to red blood cells and data on medication with erythropoiesis-stimulating agents (ESAs) were available. Patients were 64.4±15.9 years old; 55.0% were men. Statistical analysis revealed significant differences between Hb-classes in all of the examined parameters, except erythrocytes mean corpuscular volume and C reactive protein above the threshold, with more critical values in higher Hb-classes. The usage of ESAs showed a mean difference between Hb-class III and Hb-class I of 6.4 units/day and kilogram body weight in a 120-day period. Our classification system allows an easily achievable overview of the patients' responsiveness and performance of Hb management. Integrated into a disease management programme or continuous quality improvement, the classification delivers an instant appraisal without complex statistical or mathematical processing. © Article author(s) (or their employer(s) unless

  18. Local descriptive body weight and dietary norms, food availability, and 10-year change in glycosylated haemoglobin in an Australian population-based biomedical cohort

    Directory of Open Access Journals (Sweden)

    Suzanne J. Carroll

    2017-02-01

    Full Text Available Abstract Background Individual-level health outcomes are shaped by environmental risk conditions. Norms figure prominently in socio-behavioural theories yet spatial variations in health-related norms have rarely been investigated as environmental risk conditions. This study assessed: 1 the contributions of local descriptive norms for overweight/obesity and dietary behaviour to 10-year change in glycosylated haemoglobin (HbA1c, accounting for food resource availability; and 2 whether associations between local descriptive norms and HbA1c were moderated by food resource availability. Methods HbA1c, representing cardiometabolic risk, was measured three times over 10 years for a population-based biomedical cohort of adults in Adelaide, South Australia. Residential environmental exposures were defined using 1600 m participant-centred road-network buffers. Local descriptive norms for overweight/obesity and insufficient fruit intake (proportion of residents with BMI ≥ 25 kg/m2 [n = 1890] or fruit intake of <2 serves/day [n = 1945], respectively were aggregated from responses to a separate geocoded population survey. Fast-food and healthful food resource availability (counts were extracted from a retail database. Separate sets of multilevel models included different predictors, one local descriptive norm and either fast-food or healthful food resource availability, with area-level education and individual-level covariates (age, sex, employment status, education, marital status, and smoking status. Interactions between local descriptive norms and food resource availability were tested. Results HbA1c concentration rose over time. Local descriptive norms for overweight/obesity and insufficient fruit intake predicted greater rates of increase in HbA1c. Neither fast-food nor healthful food resource availability were associated with change in HbA1c. Greater healthful food resource availability reduced the rate of increase in HbA1c

  19. Local descriptive body weight and dietary norms, food availability, and 10-year change in glycosylated haemoglobin in an Australian population-based biomedical cohort.

    Science.gov (United States)

    Carroll, Suzanne J; Paquet, Catherine; Howard, Natasha J; Coffee, Neil T; Adams, Robert J; Taylor, Anne W; Niyonsenga, Theo; Daniel, Mark

    2017-02-02

    Individual-level health outcomes are shaped by environmental risk conditions. Norms figure prominently in socio-behavioural theories yet spatial variations in health-related norms have rarely been investigated as environmental risk conditions. This study assessed: 1) the contributions of local descriptive norms for overweight/obesity and dietary behaviour to 10-year change in glycosylated haemoglobin (HbA1c), accounting for food resource availability; and 2) whether associations between local descriptive norms and HbA1c were moderated by food resource availability. HbA1c, representing cardiometabolic risk, was measured three times over 10 years for a population-based biomedical cohort of adults in Adelaide, South Australia. Residential environmental exposures were defined using 1600 m participant-centred road-network buffers. Local descriptive norms for overweight/obesity and insufficient fruit intake (proportion of residents with BMI ≥ 25 kg/m(2) [n = 1890] or fruit intake of Fast-food and healthful food resource availability (counts) were extracted from a retail database. Separate sets of multilevel models included different predictors, one local descriptive norm and either fast-food or healthful food resource availability, with area-level education and individual-level covariates (age, sex, employment status, education, marital status, and smoking status). Interactions between local descriptive norms and food resource availability were tested. HbA1c concentration rose over time. Local descriptive norms for overweight/obesity and insufficient fruit intake predicted greater rates of increase in HbA1c. Neither fast-food nor healthful food resource availability were associated with change in HbA1c. Greater healthful food resource availability reduced the rate of increase in HbA1c concentration attributed to the overweight/obesity norm. Local descriptive health-related norms, not food resource availability, predicted 10-year change in HbA1c. Null

  20. Effect of 3-week high-intensity interval training on VO2max, total haemoglobin mass, plasma and blood volume in well-trained athletes.

    Science.gov (United States)

    Menz, Verena; Strobl, Jochen; Faulhaber, Martin; Gatterer, Hannes; Burtscher, Martin

    2015-11-01

    This study examined the haematological adaptations to high-intensity interval training (HIT), i.e. total haemoglobin mass (tHb-mass), blood volume (BV), and plasma volume (PV), and its effects on VO2max in well-trained athletes. Twenty-seven male and eight female well-trained (VO2max 63.7 ± 7.7 ml/min/kg) athletes were randomly assigned to the HIT (HITG, N = 19) or the control group (CG, N = 16). Over a 3-week period, the HITG performed 11 HIT sessions, consisting of four 4-min interval bouts at an exercise intensity of 90-95 % of the individual maximal heart rate (HRmax), separated by 4-min active recovery periods. Before and 5 ± 2 days after the intervention, tHb-mass, BV and PV were determined by the CO-rebreathing method. VO2max was assessed in a laboratory treadmill test. tHb-mass (from 753 ± 124 to 760 ± 121 g), BV (from 5.6 ± 0.8 to 5.6 ± 0.9 l) and PV (from 3.2 ± 0.5 to 3.2 ± 0.5 l) remained unchanged after HIT and did not show an interaction (group × time). Within the HITG, VO2max improved from baseline by +3.5 % (p = 0.011), but remained unchanged in the CG. No interaction (group × time) was seen for VO2max. The HITG showed a significant reduction in HRmax compared to the baseline measurement (-2.3 %, p ≤ 0.001), but HRmax remained unchanged in the CG. There was a significant interaction (group × time) for HRmax (p = 0.006). Also, oxygen pulse significantly increased only in HITG from 22.9 ± 4.4 to 23.9 ± 4.2 ml/beat, with no interaction (p = 0.150). Eleven HIT sessions added to usual training did neither improve VO2max nor haematological parameters compared to the CG.