vitreoscilla vhb haemoglobin: Topics by WorldWideScience.org

Sample records for vitreoscilla vhb haemoglobin

Recombinant E. coli expressing Vitreoscilla haemoglobin prefers ...

Indian Academy of Sciences (India)

Vitreoscilla hemoglobin. (Marked as 'VHb' in figure 1A and figure 2A and C). NCBI ID: gi|114816. Accession No.: P04252. Source organism: Vitreoscilla stercoraria. Length: 146 amino acids. MW/pI: 15774.34/5.27. Protein Sequence. 1 MLDQQTINII KATVPVLKEH GVTITTTFYK NLFAKHPEVR PLFDMGRQES LEQPKALAMT.
Constitutive expression of Vitreoscilla haemoglobin in Sphingomonas elodea to improve gellan gum production.

Science.gov (United States)

Wu, X C; Chen, Y M; Li, Y D; Li, O; Zhu, L; Qian, C D; Tao, X L; Teng, Y

2011-02-01

To improve a commercially used strain for gellan production by exogenous Vitreoscilla haemoglobin (VHb). VHb gene was expressed in Sphingomonas elodea under the control of constitutive bla promoter. Biochemical activity of expressed VHb was confirmed by CO-difference spectra analysis that exhibited a characteristic absorption maximum at 419 nm. During cultivation, not only enhanced cell growth was detected, but also 20% improvement in gellan production was observed after 48 h of incubation, with a maximum yield of 16·82 g l(-1). Moreover, maximum sucrose conversion efficiency (g gellan per g sucrose) was 57·8, 20% higher than that of the parental strain. We further examined the polysaccharide production of VHb-expressing strain at different aeration levels in Erlenmeyer flasks. Again, in all cases, a significant enhancement of gellan production was observed, and the enhancement was more significant under oxygen-limiting conditions (up to 26·8%). VHb exhibited positive effect on cell growth and gellan yield of S. elodea, especially under hypoxic conditions. This is the first application of VHb as an effective metabolic engineering strategy in S. elodea to regulate cell growth and optimize gellan yield. © 2010 The Authors. Journal of Applied Microbiology © 2010 The Society for Applied Microbiology.
Construction and Characterization of Vitreoscilla Hemoglobin (VHb) with Enhanced Peroxidase Activity for Efficient Degradation of Textile Dye.

Science.gov (United States)

Zhang, Zidong; Li, Wei; Li, Haichao; Zhang, Jing; Zhang, Yuebin; Cao, Yufeng; Ma, Jianzhang; Li, Zhengqiang

2015-09-01

Pollution resulting from the discharge of textile dyes into water systems has become a major global concern. Because peroxidases are known for their ability to decolorize and detoxify textile dyes, the peroxidase activity of Vitreoscilla hemoglobin (VHb) has recently been studied. It is found that VHb and variants of this enzyme show great promise for enzymatic decolorization of dyes and may play a role in achieving their successful removal from industrial wastewater. The level of VHb peroxidase activity correlates with two amino acid residues present within the conserved distal pocket, at positions 53 and 54. In this work, sitedirected mutagenesis of these residues was performed and resulted in improved VHb peroxidase activity. The double mutant, Q53H/P54C, shows the highest dye decolorization and removal efficiency, with 70% removal efficiency within 5 min. UV spectral studies of Q53H/P54C reveals a more compact structure and an altered porphyrin environment (λSoret = 413 nm) relative to that of wild-type VHb (λSoret = 406), and differential scanning calorimetry data indicate that the VHb variant protein structure is more stable. In addition, circular dichroism spectroscopic studies indicate that this variant's increased protein structural stability is due to an increase in helical structure, as deduced from the melting temperature, which is higher than 90°C. Therefore, the VHb variant Q53H/P54C shows promise as an excellent peroxidase, with excellent dye decolorization activity and a more stable structure than wild-type VHb under high-temperature conditions.
THE BIOCHEMISTRY OF VITREOSCILLA HEMOGLOBIN

Directory of Open Access Journals (Sweden)

Benjamin C. Stark

2012-10-01

Full Text Available The hemoglobin (VHb from Vitreoscilla was the first bacterial hemoglobin discovered. Its structure and function have been extensively investigated, and engineering of a wide variety of heterologous organisms to express VHb has been performed to increase their growth and productivity. This strategy has shown promise in applications as far-ranging as the production of antibiotics and petrochemical replacements by microorganisms to increasing stress tolerance in plants. These applications of “VHb technology” have generally been of the “black box” variety, wherein the endpoint studied is an increase in the levels of a certain product or improved growth and survival. Their eventual optimization, however, will require a thorough understanding of the various functions and activities of VHb, and how VHb expression ripples to affect metabolism more generally. Here we review the current knowledge of these topics. VHb's functions all involve oxygen binding (and often delivery in one way or another. Several biochemical and structure-function studies have provided an insight into the molecular details of this binding and delivery. VHb activities are varied. They include supply of oxygen to oxygenases and the respiratory chain, particularly under low oxygen conditions; oxygen sensing and modulation of transcription factor activity; and detoxification of NO, and seem to require interactions of VHb with “partner proteins”. VHb expression affects the levels of ATP and NADH, although not enormously. VHb expression may affect the level of many compounds of intermediary metabolism, and, apparently, alters the levels of expression of many genes. Thus, the metabolic changes in organisms engineered to express VHb are likely to be numerous and complicated.
Improved ethanol production from cheese whey, whey powder, and sugar beet molasses by "Vitreoscilla hemoglobin expressing" Escherichia coli.

Science.gov (United States)

Akbas, Meltem Yesilcimen; Sar, Taner; Ozcelik, Busra

2014-01-01

This work investigated the improvement of ethanol production by engineered ethanologenic Escherichia coli to express the hemoglobin from the bacterium Vitreoscilla (VHb). Ethanologenic E. coli strain FBR5 and FBR5 transformed with the VHb gene in two constructs (strains TS3 and TS4) were grown in cheese whey (CW) medium at small and large scales, at both high and low aeration, or with whey powder (WP) or sugar beet molasses hydrolysate (SBMH) media at large scale and low aeration. Culture pH, cell growth, VHb levels, and ethanol production were evaluated after 48 h. VHb expression in TS3 and TS4 enhanced their ethanol production in CW (21-419%), in WP (17-362%), or in SBMH (48-118%) media. This work extends the findings that "VHb technology" may be useful for improving the production of ethanol from waste and byproducts of various sources.
Clues for discovering a new biological function of Vitreoscilla hemoglobin in organisms: potential sulfide receptor and storage.

Science.gov (United States)

Wang, Dandan; Liu, Li; Wang, Hui; Xu, Haoran; Chen, Lei; Ma, Li; Li, Zhengqiang

2016-04-01

The interaction between H2 S and Vitreoscilla hemoglobin (VHb) has been studied by UV-Vis and Resonance Raman spectroscopes to confirm the binding between the ligand and the protein. Kinetic constants, kon = 1.2 × 10(5) m(-1) ·s(-1) and koff = 2.5 × 10(-4) ·s(-1) , have been determined and compared with those for mammalian hemoglobins. Density Functional Theory study supports the binding of H2 S by modeling the configurations of HOMO dispersions. We hypothesized that VHb is involved in H2 S reception and storage. Different from Lucina pectinata HbI, a typical H2 S-binding hemoglobin, VHb, exhibits unusual properties on H2 S reactivity such as steric constraints playing an important role in modulating H2 S entry. A distinct mechanism of VHb interaction with H2 S is supported by studies of variant forms of VHb. © 2016 Federation of European Biochemical Societies.
Dicty_cDB: VHB478 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT
Evidence that Na+-pumping occurs through the D-channel in Vitreoscilla cytochrome bo

International Nuclear Information System (INIS)

Kim, Seong K.; Stark, Benjamin C.; Webster, Dale A.

2005-01-01

The operon (cyo) encoding the Na + -pumping respiratory terminal oxidase (cytochrome bo) of the bacterium Vitreoscilla was transformed into Escherichia coli GV100, a deletion mutant of cytochrome bo. This was done for the wild type operon and five mutants in three conserved Cyo subunit I amino acids known to be crucial for H + transport in the E. coli enzyme, one near the nuclear center, one in the K-channel, and one in the D-channel. CO-binding, NADH and ubiquinol oxidase, and Na + -pumping activities were all substantially inhibited by each mutation. The wild type Vitreoscilla cytochrome bo can pump Na + against a concentration gradient, resulting in a transmembrane concentration differential of 2-3 orders of magnitude. It is proposed that Vitreoscilla cytochrome bo pumps four Na + through the D-channel to the exterior and transports four H + through the K-channel for the reduction of each O 2
Vitreoscilla hemoglobin promotes Salecan production by Agrobacterium sp. ZX09.

Science.gov (United States)

Chen, Yun-mei; Xu, Hai-yang; Wang, Yang; Zhang, Jian-fa; Wang, Shi-ming

2014-11-01

Salecan is a novel exopolysaccharide produced by the strain Agrobacterium sp. ZX09, and it is composed of only glucose monomers. The unique chemical composition and excellent physicochemical properties make Salecan a promising material for applications in coagulation, lubrication, protection against acute liver injury, and alleviating constipation. In this study, we cloned the Vitreoscilla hemoglobin gene into a broad-host-range plasmid pCM158. Without antibiotic selection, there was negligible loss of the plasmid in the host Agrobacterium sp. ZX09 after one passage of cultivation. The expression of Vitreoscilla hemoglobin was demonstrated by carbon monoxide (CO) difference spectrum. The engineered strain Agrobacterium sp. ZX09 increased Salecan yield by 30%. The other physiological changes included its elevated respiration rate and cellular invertase activity.
Role of Asp544 in subunit I for Na+ pumping by Vitreoscilla cytochrome bo

International Nuclear Information System (INIS)

Chung, Yeon T.; Stark, Benjamin C.; Webster, Dale A.

2006-01-01

The conserved Glu540 in subunit I of Escherichia coli cytochrome bo (a H + pump) is replaced by Asp544 in the Vitreoscilla enzyme (a Na + pump). Site-directed mutagenesis of the Vitreoscilla cytochrome bo operon changed this Asp to Glu, and both wild type and mutant cyo's were transformed into E. coli strain GV100, which lacks cytochrome bo. Compared to the wild type transformant the Asp544Glu transformant had decreased ability to pump Na + as well as decreased stimulation in respiratory activity in the presence of Na + . Preliminary experiments indicated that this mutant also had increased ability to pump protons, suggesting that this single change may provide cation pumping specificity in this group of enzymes
Infección crónica por el VHB Chronic Hepatitis B Virus infection

OpenAIRE

C. Carretero; M. Herráiz

2004-01-01

Existen muchos factores implicados en la patogénesis de la infección crónica por el virus de la hepatitis B (VHB), como por ejemplo características del virus, la ingesta de etanol, la coinfección con otros virus (VHC, VIH, VHD), e intervenciones terapéuticas como el uso de fármacos citotóxicos o inmunosupresores, o agentes antivirales específicos. Las características clínicas, patológicas y serológicas de la hepatitis crónica por VHB, además, son muy heterogéneas. Se puede reconocer la infecc...
Repeated batch fermentation of immobilized E. coli expressing Vitreoscilla hemoglobin for long-term use.

Science.gov (United States)

Sar, Taner; Seker, Gamze; Erman, Ayse Gokce; Stark, Benjamin C; Yesilcimen Akbas, Meltem

2017-09-03

This study describes an efficient and reusable process for ethanol production from medium containing whey powder, using alginate immobilized ethanologenic E. coli strains either expressing (TS3) or not expressing (FBR5) Vitreoscilla hemoglobin. Reuseabilities of the FBR5 and TS3 strains were investigated regarding their ethanol production capacities over the course of 15 successive 96-h batch fermentations. The ethanol production was fairly stable over the entire duration of the experiment, with strain TS3 maintaining a substantial advantage over strain FBR5. Storage of both strains in 2 different solutions for up to 60 d resulted in only a modest loss of ethanol production, with strain TS3 consistently outperforming strain FBR5 by a substantial amount. Strains stored for 15 or 30 d maintained their abilities to produce ethanol without dimunition over the course of 8 successive batch fermentations; again strain TS3 maintained a substantial advantage over strain FBR5 throughout the entire experiment. Thus, immobilization is a useful strategy to maintain the advantage in ethanol productivity afforded by expression of Vitreoscilla hemoglobin over long periods of time and large numbers of repeated batch fermentations, including, as in this case, using media with food processing wastes as the carbon source.
Heterologous expression of VHb can improve the yield and quality of biocontrol fungus Paecilomyces lilacinus, during submerged fermentation.

Science.gov (United States)

Zhang, Shumeng; Wang, Jieping; Wei, Yale; Tang, Qing; Ali, Maria Kanwal; He, Jin

2014-10-10

Paecilomyces lilacinus is an egg-parasitic fungus which is effective against plant-parasitic nematodes and it has been successfully commercialized for the control of many plant-parasitic nematodes. However, during the large-scale industrial fermentation process of the filamentous fungus, the dissolved oxygen supply is a limiting factor, which influences yield, product quality and production cost. To solve this problem, we intended to heterologously express VHb in P. lilacinus ACSS. After optimizing the vgb gene, we fused it with a selection marker gene nptII, a promoter PgpdA and a terminator TtrpC. The complete expression cassette PgpdA-nptII-vgb-TtrpC was transferred into P. lilacinus ACSS by Agrobacterium tumefaciens-mediated transformation. Consequently, we successfully screened an applicable fungus strain PNVT8 which efficiently expressed VHb. The submerged fermentation experiments demonstrated that the expression of VHb not only increased the production traits of P. lilacinus such as biomass and spore production, but also improved the beneficial product quality and application value, due to the secretion of more protease and chitinase. It can be speculated that the recombinant strain harboring vgb gene will have a growth advantage over the original strain under anaerobic conditions in soil and therefore will possess higher biocontrol efficiency against plant-parasitic nematodes. Copyright © 2014 Elsevier B.V. All rights reserved.
Pseudomonas fluorescens ATCC 13525 Containing an Artificial Oxalate Operon and Vitreoscilla Hemoglobin Secretes Oxalic Acid and Solubilizes Rock Phosphate in Acidic Alfisols

OpenAIRE

Yadav, Kavita; Kumar, Chanchal; Archana, G.; Naresh Kumar, G.

2014-01-01

Oxalate secretion was achieved in Pseudomonas fluorescens ATCC 13525 by incorporation of genes encoding Aspergillus niger oxaloacetate acetyl hydrolase (oah), Fomitopsis plaustris oxalate transporter (FpOAR) and Vitreoscilla hemoglobin (vgb) in various combinations. Pf (pKCN2) transformant containing oah alone accumulated 19 mM oxalic acid intracellularly but secreted 1.2 mM. However, in the presence of an artificial oxalate operon containing oah and FpOAR genes in plasmid pKCN4, Pf (pKCN4) s...
VHB-JOURQUAL2: Method, Results, and Implications of the German Academic Association for Business Research's Journal Ranking

OpenAIRE

Schrader, Ulf; Hennig-Thurau, Thorsten

2009-01-01

VHB-JOURQUAL represents the official journal ranking of the German Academic Association for Business Research. Since its introduction in 2003, the ranking has become the most influential journal evaluation approach in German-speaking countries, impacting several key managerial decisions of German, Austrian, and Swiss business schools. This article reports the methodological approach of the ranking’s second edition. It also presents the main results and additional analyses on the validity of t...
Structure of the haptoglobin-haemoglobin complex

DEFF Research Database (Denmark)

Andersen, Christian Brix Folsted; Torvund-Jensen, Morten; Nielsen, Marianne Jensby

2012-01-01

to oxidative modification after exposure to haem-induced reactive oxygen species are buried in the haptoglobin-haemoglobin interface, thus showing a direct protective role of haptoglobin. The haptoglobin loop previously shown to be essential for binding of haptoglobin-haemoglobin to the macrophage scavenger...... that the rigid dimeric complex can bind two receptors. Such receptor cross-linkage may facilitate scavenging and explain the increased functional affinity of multimeric haptoglobin-haemoglobin for CD163 (ref. 4)....
Haemoglobin Rahere (beta Lys-Thr): A new high affinity haemoglobin associated with decreased 2, 3-diphosphoglycerate binding and relative polycythaemia.

Science.gov (United States)

Lorkin, P A; Stephens, A D; Beard, M E; Wrigley, P F; Adams, L; Lehmann, H

1975-01-01

A new haemoglobin with increased oxygen affinity, beta82 (EF6) lysine leads to threonine (Hb Rahere), was found during the investigation of a patient who was found to have a raised haemoglobin concentration after a routine blood count. The substitution affects one of the 2, 3-diphosphoglycerate binding sites, resulting in an increased affinity for oxygen, but both the haem-haem interaction and the alkaline Bohr effect are normal in the haemolysate. This variant had the same mobility as haemoglobin A on electrophoresis at alkaline pH but was detected by measuring the whole blood oxygen affinity; it could be separated from haemoglobin A, however, by electrophoresis in agar at acid pH. The raised haemoglobin concentration was mainly due to a reduction in plasma volume (a relative polycythaemia) and was associated with a persistently raised white blood count. This case emphasises the need to measure the oxygen affinity of haemoglobin in all patients with absolute or relative polycythaemia when some obvious cause is not evident. PMID:124
Variation of haemoglobin extinction coefficients can cause errors in the determination of haemoglobin concentration measured by near-infrared spectroscopy

International Nuclear Information System (INIS)

Kim, J G; Liu, H

2007-01-01

Near-infrared spectroscopy or imaging has been extensively applied to various biomedical applications since it can detect the concentrations of oxyhaemoglobin (HbO 2 ), deoxyhaemoglobin (Hb) and total haemoglobin (Hb total ) from deep tissues. To quantify concentrations of these haemoglobin derivatives, the extinction coefficient values of HbO 2 and Hb have to be employed. However, it was not well recognized among researchers that small differences in extinction coefficients could cause significant errors in quantifying the concentrations of haemoglobin derivatives. In this study, we derived equations to estimate errors of haemoglobin derivatives caused by the variation of haemoglobin extinction coefficients. To prove our error analysis, we performed experiments using liquid-tissue phantoms containing 1% Intralipid in a phosphate-buffered saline solution. The gas intervention of pure oxygen was given in the solution to examine the oxygenation changes in the phantom, and 3 mL of human blood was added twice to show the changes in [Hb total ]. The error calculation has shown that even a small variation (0.01 cm -1 mM -1 ) in extinction coefficients can produce appreciable relative errors in quantification of Δ[HbO 2 ], Δ[Hb] and Δ[Hb total ]. We have also observed that the error of Δ[Hb total ] is not always larger than those of Δ[HbO 2 ] and Δ[Hb]. This study concludes that we need to be aware of any variation in haemoglobin extinction coefficients, which could result from changes in temperature, and to utilize corresponding animal's haemoglobin extinction coefficients for the animal experiments, in order to obtain more accurate values of Δ[HbO 2 ], Δ[Hb] and Δ[Hb total ] from in vivo tissue measurements
Variation of haemoglobin extinction coefficients can cause errors in the determination of haemoglobin concentration measured by near-infrared spectroscopy

Science.gov (United States)

Kim, J. G.; Liu, H.

2007-10-01

Near-infrared spectroscopy or imaging has been extensively applied to various biomedical applications since it can detect the concentrations of oxyhaemoglobin (HbO2), deoxyhaemoglobin (Hb) and total haemoglobin (Hbtotal) from deep tissues. To quantify concentrations of these haemoglobin derivatives, the extinction coefficient values of HbO2 and Hb have to be employed. However, it was not well recognized among researchers that small differences in extinction coefficients could cause significant errors in quantifying the concentrations of haemoglobin derivatives. In this study, we derived equations to estimate errors of haemoglobin derivatives caused by the variation of haemoglobin extinction coefficients. To prove our error analysis, we performed experiments using liquid-tissue phantoms containing 1% Intralipid in a phosphate-buffered saline solution. The gas intervention of pure oxygen was given in the solution to examine the oxygenation changes in the phantom, and 3 mL of human blood was added twice to show the changes in [Hbtotal]. The error calculation has shown that even a small variation (0.01 cm-1 mM-1) in extinction coefficients can produce appreciable relative errors in quantification of Δ[HbO2], Δ[Hb] and Δ[Hbtotal]. We have also observed that the error of Δ[Hbtotal] is not always larger than those of Δ[HbO2] and Δ[Hb]. This study concludes that we need to be aware of any variation in haemoglobin extinction coefficients, which could result from changes in temperature, and to utilize corresponding animal's haemoglobin extinction coefficients for the animal experiments, in order to obtain more accurate values of Δ[HbO2], Δ[Hb] and Δ[Hbtotal] from in vivo tissue measurements.
Variation of haemoglobin extinction coefficients can cause errors in the determination of haemoglobin concentration measured by near-infrared spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Kim, J G; Liu, H [Joint Graduate Program in Biomedical Engineering, University of Texas at Arlington/University of Texas Southwestern Medical Center at Dallas, Arlington, TX 76019 (United States)

2007-10-21

Near-infrared spectroscopy or imaging has been extensively applied to various biomedical applications since it can detect the concentrations of oxyhaemoglobin (HbO{sub 2}), deoxyhaemoglobin (Hb) and total haemoglobin (Hb{sub total}) from deep tissues. To quantify concentrations of these haemoglobin derivatives, the extinction coefficient values of HbO{sub 2} and Hb have to be employed. However, it was not well recognized among researchers that small differences in extinction coefficients could cause significant errors in quantifying the concentrations of haemoglobin derivatives. In this study, we derived equations to estimate errors of haemoglobin derivatives caused by the variation of haemoglobin extinction coefficients. To prove our error analysis, we performed experiments using liquid-tissue phantoms containing 1% Intralipid in a phosphate-buffered saline solution. The gas intervention of pure oxygen was given in the solution to examine the oxygenation changes in the phantom, and 3 mL of human blood was added twice to show the changes in [Hb{sub total}]. The error calculation has shown that even a small variation (0.01 cm{sup -1} mM{sup -1}) in extinction coefficients can produce appreciable relative errors in quantification of {delta}[HbO{sub 2}], {delta}[Hb] and {delta}[Hb{sub total}]. We have also observed that the error of {delta}[Hb{sub total}] is not always larger than those of {delta}[HbO{sub 2}] and {delta}[Hb]. This study concludes that we need to be aware of any variation in haemoglobin extinction coefficients, which could result from changes in temperature, and to utilize corresponding animal's haemoglobin extinction coefficients for the animal experiments, in order to obtain more accurate values of {delta}[HbO{sub 2}], {delta}[Hb] and {delta}[Hb{sub total}] from in vivo tissue measurements.

Haemoglobin variants among voluntary blood donors in Jos, Nigeria ...

African Journals Online (AJOL)

This study aimed to determine the haemoglobin variants among voluntary blood donors in Jos. METHOD: Records of the age, sex, Haemoglobin level, and the haemoglobin genotype of all voluntary blood donors who donated blood at the National Blood Transfusion Service Centre, Jos, Nigeria between January 2011 and ...
Non-symbiotic haemoglobins-What's happening beyond nitric oxide scavenging?

Science.gov (United States)

Hill, Robert D

2012-01-01

Non-symbiotic haemoglobins have been an active research topic for over 30 years, during which time a considerable portfolio of knowledge has accumulated relative to their chemical and molecular properties, and their presence and mode of induction in plants. While progress has been made towards understanding their physiological role, there remain a number of unanswered questions with respect to their biological function. This review attempts to update recent progress in this area and to introduce a hypothesis as to how non-symbiotic haemoglobins might participate in regulating hormone signal transduction. Advances have been made towards understanding the structural nuances that explain some of the differences in ligand association characteristics of class 1 and class 2 non-symbiotic haemoglobins. Non-symbiotic haemoglobins have been found to function in seed development and germination, flowering, root development and differentiation, abiotic stress responses, pathogen invasion and symbiotic bacterial associations. Microarray analyses under various stress conditions yield uneven results relative to non-symbiotic haemoglobin expression. Increasing evidence of the role of nitric oxide (NO) in hormone responses and the known involvement of non-symbiotic haemoglobins in scavenging NO provide opportunities for fruitful research, particularly at the cellular level. Circumstantial evidence suggests that non-symbiotic haemoglobins may have a critical function in the signal transduction pathways of auxin, ethylene, jasmonic acid, salicylic acid, cytokinin and abscisic acid. There is a strong need for research on haemoglobin gene expression at the cellular level relative to hormone signal transduction.
Anaemia prevalence and factors associated with haemoglobin ...

African Journals Online (AJOL)

Information on social-clinical characteristics, cancer type and associated factors as well as haemoglobin level before and after radiation were obtained. The prevalence of anaemia was determined as a proportion and linear regression was used to determine factors associated with haemoglobin change. Results: A total of ...
Misleading presentation of haemoglobin electrophoresis data | Adu ...

African Journals Online (AJOL)

Haemoglobinopathies are common in sub-Saharan Africa. As such haemoglobin electrophoresis are required to inform clinical decision making. However, haemoglobin electrophoresis is an assay that detects protein at either alkaline or acidic pH. Such assays do not interrogate gene sequences but rather the product of a ...
fasting blood glucose and glycosylated haemoglobin levels

African Journals Online (AJOL)

Prince Acheampong

(HbA1c) levels of diabetes mellitus patients as an index of glycaemic control. It was a prospective case- finding study using laboratory and general practice records. ... range of glycosylated haemoglobins, and the cut-off values for some clinical .... quality of glycaemic control by glycated haemoglobin in out-patient diabetic ...
Seroprevalencia de VHB, VHC y VIH en donadores de sangre en Irapuato, México Seroprevalence of HBV, HCV and HIV in blood donors in Irapuato, Mexico

Directory of Open Access Journals (Sweden)

Miguel Angel Carreto-Vélez

2003-01-01

Full Text Available OBJETIVO: Investigar la seroprevalencia de marcadores virales de los virus de la inmunodeficiencia humana (VIH, y de las hepatitis B (VHB y C (VHC, en donadores de sangre atendidos en el Hospital General de Zona con Medicina Familiar No. 2, del Instituto Mexicano del Seguro Social de Irapuato, México. MATERIAL Y MÉTODOS: Estudio transversal descriptivo. Se registraron datos en formatos del banco de sangre, y se investigaron factores de riesgo y enfermedades en 7 056 donadores de sangre al Hospital General de Zona con Medicina Familiar No. 2, del Instituto Mexicano del Seguro Social de Irapuato, Guanajuato, México, en un lapso de dos años (de julio de 1998 a junio de 2000, obteniéndose una muestra de 4 010 donadores de recuperación, sometidos estos últimos a pruebas serológicas de VHB, VHC y VIH, serotipos 1 y 2, mediante un inmunoensayo enzimático de micropartículas de tercera generación, en suero o plasma humano; se calculó la seroprevalencia porcentual de los donadores seropositivos y se estratificó por edades y sexo. RESULTADOS: La seroprevalencia absoluta de los casos positivos (VHB, VHC y VIH fue de 2.5% (101; para el VHC fue de 1.14% (46; para el VHB, 1.12% (45, y para el VIH 0.24% (10. Para el sexo masculino el VHB fue de 1.04% (33; VHC, 1.07% (34, y el VIH, 0.28% (9. Para el sexo femenino el VHB fue de 1.42% (12; el VHC, de 1.42% (12, y el VIH de 0.11% (1. Los hombres seropositivos tuvieron una razón 2.4 veces más alta que las mujeres. CONCLUSIONES: La seroprevalencia de marcadores virales fue mayor que la reportada en los estudios previos hechos en México y sugiere que la transmisión sexual fue el mecanismo principal de la infección; esto refleja la pobre educación sanitaria y la necesidad de seleccionar cuidadosamente a los donadores potenciales.OBJECTIVE: To investigate the seroprevalence of viral markers for the human immunodeficiency virus (HIV, and the hepatitis B (HBV and C (HCV viruses, in blood donors at the
Haemoglobin polymorphism in wild and cultured African catfish ...

African Journals Online (AJOL)

Haemoglobin polymorphism, haemoglobin concentration, blood group and genotypes of wild and cultured Clarias gariepinus were investigated. Blood samples of Clarias gariepinus collected from Lake Alau (wild) and Dalori fish farm (cultured) were subjected to cellulose acetate electrophoresis to reveal the activities of ...
Field evaluation of a novel haemoglobin measuring device ...

African Journals Online (AJOL)

Objective. To evaluate the use of a robust, cheap method for haemoglobin estimation by non-laboratory-trained personnel in a rural setting. Design. Comparative study. Setting. Tintswalo Hospital. Acomhoek. Participants. 7 nursing sisters, 4 medical students, 2 lay persons. Outcome measures. Haemoglobin estimates ...
Evaluation of a reference material for glycated haemoglobin

NARCIS (Netherlands)

Weykamp, CW; Penders, TJ; Muskiet, FAJ; vanderSlik, W

The use of lyophilized blood as a reference material for glycated haemoglobin was investigated with respect to IFCC criteria for calibrators and control materials. Ninety-two laboratories, using 11 methods, detected no changes in glycated haemoglobin content when the lyophilizate was stored for one
E.s.r. radiation studies of erythrocyte membrane-haemoglobin interaction

International Nuclear Information System (INIS)

Koter, M.; Kowalska, M.A.; Leyko, W.; Waterman, M.

1977-01-01

The dependence of the yield of free radicals in gamma-irradiated, freeze-dried erythrocyte membranes on their haemoglobin content was studied. A non-monotonous relationship was found, different from that observed in mixtures of freeze-dried membranes and haemoglobin, which suggests the existence of radiation-energy transfer between the membranes and bound haemoglobin. (author)
Haemoglobin variants may cause significant differences in haemoglobin A1c as measured by high-performance liquid chromatography and enzymatic methods in diabetic patients: a cross-sectional study.

Science.gov (United States)

Otabe, Shuichi; Nakayama, Hitomi; Ohki, Tsuyoshi; Soejima, Eri; Tajiri, Yuji; Yamada, Kentaro

2017-07-01

Background We aimed to determine whether the discrepancy between haemoglobin A1c values determined by high-performance liquid chromatography and enzymatic haemoglobin A1c measurements in diabetic patients was clinically relevant. Methods We randomly recruited 1421 outpatients undergoing diabetic treatment and follow-up who underwent at least three haemoglobin A1c measurements between April 2014 and March 2015 at our clinic. In 6369 samples, haemoglobin A1c was simultaneously measured by HA-8160 and MetaboLead (enzymatic assay), and the values were compared. Results haemoglobin A1c measurements by high-performance liquid chromatography and enzymatic assay were strongly correlated (correlation coefficient: 0.9828, linear approximation curve y = 0.9986x - 0.2507). Mean haemoglobin A1c (6.8 ± 1.0%) measured by high-performance liquid chromatography was significantly higher than that measured by enzymatic assay (6.5 ± 1.0%, P liquid chromatography than those from enzymatic assay. Of these, three had Hb Toranomon [β112 (G14) Cys→Trp]. The fourth had Hb Ube-2 [α68 (E17) Asn→Asp]. One other subject presented consistently higher haemoglobin A1c values (>1%) by high-performance liquid chromatography than those from enzymatic assay and was diagnosed with a -77 (T > C) mutation in the δ-globin gene. These unrelated asymptomatic subjects had normal erythrocyte profiles, without anaemia. Conclusions We showed that haemoglobin A1c values measured by high-performance liquid chromatography were significantly higher than those measured by enzymatic assay in diabetic subjects. However, when an oversized deviation (>0.7%) between glycaemic control status and haemoglobin A1c is apparent, clinicians should check the methods used to measure haemoglobin A1c and consider the possible presence of a haemoglobin variant.
Low-grade inflammation is associated with lower haemoglobin levels in healthy individuals

DEFF Research Database (Denmark)

Kotzé, S R; Pedersen, O B; Petersen, M S

2016-01-01

status. Results: LGI was associated with lower haemoglobin (0·08 mm lower [0·12 g/dl], 95% confidence interval (CI): −0·11–0·05) and increased risk of low haemoglobin (OR = 1·22, 95% CI: 1·05–1·43) in non-smokers. Conversely, LGI was associated with higher haemoglobin in smokers (0·12 mm [0·19 g/dl], 95......% CI: 0·06–0·18). Conclusion: In this first study of LGI and haemoglobin in healthy individuals, there was a negative association between LGI and haemoglobin in non-smokers. The association was positive in smokers, probably because smoking leads to both increased inflammation and increased haemoglobin...
Vessel calibre and haemoglobin effects on pulse oximetry

International Nuclear Information System (INIS)

McEwen, M P; Reynolds, K J; Bull, G P

2009-01-01

Despite its success as a clinical monitoring tool, pulse oximetry may be improved with respect to the need for empirical calibration and the reports of biases in readings associated with peripheral vasoconstriction and haemoglobin concentration. To effect this improvement, this work aims to improve the understanding of the photoplethysmography signal—as used by pulse oximeters—and investigates the effect of vessel calibre and haemoglobin concentration on pulse oximetry. The digital temperature and the transmission of a wide spectrum of light through the fingers of 57 people with known haemoglobin concentrations were measured and simulations of the transmission of that spectrum of light through finger models were performed. Ratios of pulsatile attenuations of light as used in pulse oximetry were dependent upon peripheral temperature and on blood haemoglobin concentration. In addition, both the simulation and in vivo results showed that the pulsatile attenuation of light through fingers was approximately proportional to the absorption coefficients of blood, only when the absorption coefficients were small. These findings were explained in terms of discrete blood vessels acting as barriers to light transmission through tissue. Due to the influence of discrete blood vessels on light transmission, pulse oximeter outputs tend to be dependent upon haemoglobin concentration and on the calibre of pulsing blood vessels—which are affected by vasoconstriction/vasodilation. The effects of discrete blood vessels may account for part of the difference between the Beer–Lambert pulse oximetry model and empirical calibration
Reference values of glycosylated haemoglobin and fructosamin in dogs

Directory of Open Access Journals (Sweden)

Olair Carlos Beltrame

2014-09-01

Full Text Available Glycated haemoglobin and fructosamin levels are not commonly used to diagnosis Diabetes mellitus in dogs due to a lack of reference values. To estabilish the reference values and determination methods of glycated haemoglobin and frutosamine, both male and females, healthy dogs, 2-8 years old (n=100 were used. The methodologies used were the ionic resin and the kinetic method by the reduction of blue nitrotetrazolium, respectively. Medium values of glycated haemoglobin of 5.3-7.01% and 277.52-387. 30 for fructosamin established by Brazilian Diabetes Society methods can be adopted for dogs, both males and females.
Haemoglobin A1c : Historical overview and current concepts

NARCIS (Netherlands)

Lenters-Westra, Erna; Schindhelm, Roger K.; Bilo, Henk J.; Slingerland, Robbert J.

Since the discovery of the relation between increased concentrations of fast haemoglobin fractions in patients with diabetes mellitus compared to concentrations in subjects without diabetes mellitus by Samuel Rahbar and co-workers in 1969, glycated haemoglobin A1c (HbA1c) has become a "gold
Crystallization and preliminary crystallographic analysis of human glycosylated haemoglobin

International Nuclear Information System (INIS)

Syakhovich, Vitaly E.; Saraswathi, N. T.; Ruff, Marc; Bokut, Sergey B.; Moras, Dino

2006-01-01

Non enzymatic modification of haemoglobin by glucose plays an important role in diabetes pathogenesis. Here the purification, characterization and crystallization of human glycosylated haemoglobin are reported. Human glycosylated haemoglobin A 1C is a stable minor variant formed in vivo by post-translational modification of the main form of haemoglobin by glucose. Crystals of oxyHbA 1C were obtained using the hanging-drop vapour-diffusion method and PEG as precipitant. The diffraction pattern of the crystal extends to a resolution of 2.3 Å at 120 K. The crystals belong to space group C2, with unit-cell parameters a = 237.98, b = 59.27, c = 137.02 Å, α = 90.00, β = 125.40, γ = 90.00°. The presence of two and a half molecules per asymmetric unit gives a crystal volume per protein weight (V M ) of 9.70 Å 3 Da −1 and a solvent content of 49%
Crystallization and preliminary crystallographic analysis of human glycosylated haemoglobin

Energy Technology Data Exchange (ETDEWEB)

Syakhovich, Vitaly E. [Department of Biochemistry and Biophysics, International Sakharov Environmental University, Dolgobrodskaya St 23, 220009 Minsk (Belarus); Saraswathi, N. T.; Ruff, Marc, E-mail: ruff@igbmc.u-strasbg.fr [Département de Biologie et Génomique Structurales, Institut de Génétique et de Biologie Moléculaire et Cellulaire, 1 Rue Laurent Fries, BP 10142, 67404 Illkirch (France); Bokut, Sergey B. [Department of Biochemistry and Biophysics, International Sakharov Environmental University, Dolgobrodskaya St 23, 220009 Minsk (Belarus); Moras, Dino [Département de Biologie et Génomique Structurales, Institut de Génétique et de Biologie Moléculaire et Cellulaire, 1 Rue Laurent Fries, BP 10142, 67404 Illkirch (France); Department of Biochemistry and Biophysics, International Sakharov Environmental University, Dolgobrodskaya St 23, 220009 Minsk (Belarus)

2006-02-01

Non enzymatic modification of haemoglobin by glucose plays an important role in diabetes pathogenesis. Here the purification, characterization and crystallization of human glycosylated haemoglobin are reported. Human glycosylated haemoglobin A{sub 1C} is a stable minor variant formed in vivo by post-translational modification of the main form of haemoglobin by glucose. Crystals of oxyHbA{sub 1C} were obtained using the hanging-drop vapour-diffusion method and PEG as precipitant. The diffraction pattern of the crystal extends to a resolution of 2.3 Å at 120 K. The crystals belong to space group C2, with unit-cell parameters a = 237.98, b = 59.27, c = 137.02 Å, α = 90.00, β = 125.40, γ = 90.00°. The presence of two and a half molecules per asymmetric unit gives a crystal volume per protein weight (V{sub M}) of 9.70 Å{sup 3} Da{sup −1} and a solvent content of 49%.
Maternal haemoglobin and short-term neonatal outcome in preterm neonates.

Directory of Open Access Journals (Sweden)

Elodie Savajols

Full Text Available To determine whether there is a significant association between maternal haemoglobin measured before delivery and short-term neonatal outcome in very preterm neonates.We included prospectively all live births occurring from 25 to 32+6 weeks of gestation in a tertiary care centre between January 1(st 2009 and December 31(st 2011. Outborn infants and infants presenting with lethal malformations were excluded. Three hundred and thirty-nine mothers and 409 infants met the inclusion criteria. For each mother-infant pair a prospective record of epidemiologic data was performed and maternal haemoglobin concentration recorded within 24 hours before delivery was retrospectively researched. Maternal haemoglobin was divided into quartiles with the second and the third one regarded as reference as they were composed of normal haemoglobin values. Short-term outcome was defined as poor in case of death during hospital stay and/or grades III/IV intraventricular haemorrhage and/or periventricular leukomalacia and/or necessity of ventriculoperitoneal shunt.The global rate of poor short-term neonatal outcome was 11.4% and was significantly associated with low maternal haemoglobin values. This association remained significant after adjustment for antenatal corticosteroids therapy, gestational age, parity, mechanism of preterm birth, mode of delivery and birth weight (aOR = 2.97 CI 95% [1.36-6.47]. There was no relation between short-term neonatal outcome and high maternal haemoglobin concentration values.We show that low maternal haemoglobin concentration at delivery is an independent risk factor for poor short-term neonatal outcome in very preterm neonates. This study is one of the first to show such an association within the preterm population.
Should haemoglobin A be used for the diagnosis of diabetes ...

African Journals Online (AJOL)

2011-04-05

Apr 5, 2011 ... Review Article: Should haemoglobin A1c be used for the diagnosis of diabetes mellitus in South Africa? 122 .... and this is the basis for the high-performance liquid .... the ionic charge of the haemoglobin molecule, and this.
The effects of maternal haemoglobin as an indicator of maternal ...

African Journals Online (AJOL)

Background: Maternal measles antibodies (MMA) are actively transferred through the placenta from mother to foetus. A relationship could exist between MMA of mother-infant pairs and maternal nutritional indicator (haemoglobin). Objectives: This study reviewed the effects of maternal haemoglobin (Hb) on MMA of ...

The effects of maternal haemoglobin as an indicator of maternal ...

African Journals Online (AJOL)

EB

relationship could exist between MMA of mother-infant pairs and maternal nutritional indicator (haemoglobin). Objectives: This study reviewed the effects of maternal haemoglobin (Hb) on MMA of mother-infant pairs at birth. Methods: One hundred and fifty three mother-infant pairs were enrolled in this study using the ...
Bone disease in haemoglobin disorders

Directory of Open Access Journals (Sweden)

Ersi Voskaridou

2013-03-01

Full Text Available Bone disease represents a prominent cause of morbidity in patients with thalassaemia and other haemoglobin disorders. The delay in sexual maturation, the presence of diabetes and hypothyroidism, the parathyroid gland dysfunction, the haemolytic anaemia, the progressive marrow expansion, the iron toxicity on osteoblasts, the iron chelators, and the deficiency of growth hormone or insulin growth factors have been identified as major causes of osteoporosis in thalassaemia. Adequate hormonal replacement, effective iron chelation, improvement of hemoglobin levels, calcium and vitamin D administration, physical activity, and smoking cessation are the main to-date measures for the management of the disease. During the last decade, novel pathogenetic data suggest that the reduced osteoblastic activity, which is believed to be the basic mechanism of bone loss in thalassemia, is accompanied by a comparable or even greater increase in bone resorption. Therefore, potent inhibitors of osteoclast activation, such as the aminobisphosphonates, arise as key drugs for the management of osteoporosis in thalassaemia patients and other haemoglobin disorders.
Artificial citrate operon and Vitreoscilla hemoglobin gene enhanced mineral phosphate solubilizing ability of Enterobacter hormaechei DHRSS.

Science.gov (United States)

Yadav, Kavita; Kumar, Chanchal; Archana, G; Kumar, G Naresh

2014-10-01

Mineral phosphate solubilization by bacteria is mediated through secretion of organic acids, among which citrate is one of the most effective. To overproduce citrate in bacterial systems, an artificial citrate operon comprising of genes encoding NADH-insensitive citrate synthase of E. coli and Salmonella typhimurium sodium-dependent citrate transporter was constructed. In order to improve its mineral phosphate solubilizing (MPS) ability, the citrate operon was incorporated into E. hormaechei DHRSS. The artificial citrate operon transformant secreted 7.2 mM citric acid whereas in the native strain, it was undetectable. The transformant released 0.82 mM phosphate in flask studies in buffered medium containing rock phosphate as sole P source. In fermenter studies, similar phenotype was observed under aerobic conditions. However, under microaerobic conditions, no citrate was detected and P release was not observed. Therefore, an artificial citrate gene cluster containing Vitreoscilla hemoglobin (vgb) gene under its native promoter, along with artificial citrate operon under constitutive tac promoter, was constructed and transformed into E. hormaechei DHRSS. This transformant secreted 9 mM citric acid under microaerobic conditions and released 1.0 mM P. Thus, incorporation of citrate operon along with vgb gene improves MPS ability of E. hormaechei DHRSS under buffered, microaerobic conditions mimicking rhizospheric environment.
Two novel haemoglobin variants that affect haemoglobin A1c measurement by ion-exchange chromatography

NARCIS (Netherlands)

Bots, Michael; Stroobants, An K.; Delzenne, Barend; Soeters, Maarten R.; de Vries, Johan E.; Weykamp, Cas W.; Norg, Roelf J. C.; Veldthuis, Martijn; van Zwieten, Rob

2015-01-01

Haemoglobin (Hb) variants are well-known factors interfering with accurate HbA1c testing. This report describes two novel Hb variants leading to inappropriate quantification of HbA1c by ion-exchange chromatography. Glycated forms of novel Hb variants were recognised in the blood of two patients with
Haemoglobin concentrations appear to be lower in indigenous Greenlanders than in Danes

DEFF Research Database (Denmark)

Milman, N; Byg, K E; Mulvad, G

2001-01-01

's correlation coefficient (rs). RESULTS: Greenlanders: Haemoglobin levels were not correlated with age or consumption of traditional foods, and were not significantly different in the three residential areas. Mean haemoglobin was higher in men, 146+/-9.6 (SD) g/L, than in women, 132+/-9.6 g/L (p... haemoglobin in iron-replete men with serum ferritin >32 microg/L (n=104) was 146+/-9.3 g/L, and in iron-replete women (n=68) 133+/-10.4 g/L (pwomen 118 g/L (7.3 mmol/L). The prevalence of iron deficiency anaemia...... (i.e. ferritin women) was 0% in men, 2.78% in women women >50 yr of age. Danes: Mean haemoglobin in men was 154+/-10.0 g/L and in women 138+/-10.4 g/L (p
Identification of the haemoglobin scavenger receptor

DEFF Research Database (Denmark)

Kristiansen, M; Graversen, Jonas Heilskov; Jacobsen, C

2001-01-01

Intravascular haemolysis is a physiological phenomenon as well as a severe pathological complication when accelerated in various autoimmune, infectious (such as malaria) and inherited (such as sickle cell disease) disorders. Haemoglobin released into plasma is captured by the acute phase protein...
Seasonal changes in cell mediated immune responses to soluble Plasmodium falciparum antigens in children with haemoglobin AA and haemoglobin AS

DEFF Research Database (Denmark)

Abu-Zeid, Y A; Abdulhadi, N H; Theander, T G

1992-01-01

of tuberculin (PPD). The lymphoproliferative responses to SPAg of the paired PBMC samples showed 2 distinct seasonal changes in relation to the haemoglobin phenotype. In HbAA children, the lymphoproliferative responses to SPAg were suppressed during the malaria season. In contrast, they were enhanced in Hb......AS children during the malaria season. No distinct seasonal change in the response to PPD was found in relation to the haemoglobin phenotype. The study points to the role of the sickle cell trait in modulating the cellular immune responses to falciparum malaria....
d-Ribose as a Contributor to Glycated Haemoglobin

Directory of Open Access Journals (Sweden)

Xixi Chen

2017-11-01

Full Text Available Glycated haemoglobin (HbA1c is the most important marker of hyperglycaemia in diabetes mellitus. We show that d-ribose reacts with haemoglobin, thus yielding HbA1c. Using mass spectrometry, we detected glycation of haemoglobin with d-ribose produces 10 carboxylmethyllysines (CMLs. The first-order rate constant of fructosamine formation for d-ribose was approximately 60 times higher than that for d-glucose at the initial stage. Zucker Diabetic Fatty (ZDF rat, a common model for type 2 diabetes mellitus (T2DM, had high levels of d-ribose and HbA1c, accompanied by a decrease of transketolase (TK in the liver. The administration of benfotiamine, an activator of TK, significantly decreased d-ribose followed by a decline in HbA1c. In clinical investigation, T2DM patients with high HbA1c had a high level of urine d-ribose, though the level of their urine d-glucose was low. That is, d-ribose contributes to HbA1c, which prompts future studies to further explore whether d-ribose plays a role in the pathophysiological mechanism of T2DM.
Relationship between glycated haemoglobin and fasting plasma ...

African Journals Online (AJOL)

Emmanuel Musenge

2016-07-30

Jul 30, 2016 ... Relationship between glycated haemoglobin and fasting plasma glucose ... major stakeholders in the management of diabetes mellitus to consider FPG as an ..... HbA1c among customers of health examination services.
Differences in iron acquisition from human haemoglobin among strains of Actinobacillus actinomycetemcomitans

DEFF Research Database (Denmark)

Hayashida, H.; Poulsen, Knud; Kilian, Mogens

2002-01-01

. actinomycetemcomitans strains examined harboured a single genomic sequence with homology to the hgpA gene encoding haemoglobin-binding protein A in Haemophilus influenzae. However, in all three strains belonging to the JP2 clone and in one serotype e strain hgpA was a pseudogene. Seven other strains possessed...... a functional hgpA gene which, according to insertion mutagenesis experiments, was responsible for the ability of these strains to utilize haemoglobin as a source of iron. Thus, the presence of an hgpA pseudogene and the inability to use human haemoglobin as an iron source discriminate the high-toxic JP2 clone...
Predicting postoperative haemoglobin changes after burn surgery

African Journals Online (AJOL)

Burn surgery is associated with significant peri-operative haemoglobin. (Hb) changes. ... operative factors predictive of an Hb <7 g/dL on the first day after surgery, which were ..... clinical judgement, taking into consideration the risk associated.
Higher vs. lower haemoglobin threshold for transfusion in septic shock

DEFF Research Database (Denmark)

Rygård, S L; Holst, L B; Wetterslev, J

2017-01-01

. a lower haemoglobin threshold. METHODS: In post-hoc analyses of the full trial population of 998 patients from the Transfusion Requirements in Septic Shock (TRISS) trial, we investigated the intervention effect on 90-day mortality in patients with severe comorbidity (chronic lung disease, haematological......BACKGROUND: Using a restrictive transfusion strategy appears to be safe in sepsis, but there may be subgroups of patients who benefit from transfusion at a higher haemoglobin level. We explored if subgroups of patients with septic shock and anaemia had better outcome when transfused at a higher vs.......51), in those who had undergone surgery (P = 0.99) or in patients with septic shock by the new definition (P = 0.20). CONCLUSION: In exploratory analyses of a randomized trial in patients with septic shock and anaemia, we observed no survival benefit in any subgroups of transfusion at a haemoglobin threshold...
Purification, crystallization and preliminary X-ray analysis of haemoglobin from ostrich (Struthio camelus)

International Nuclear Information System (INIS)

Sundaresan, S. S.; Ramesh, P.; Sivakumar, K.; Ponnuswamy, M. N.

2009-01-01

Purification, crystallization and preliminary X-ray analysis of haemoglobin from ostrich (Struthio camelus) has been carried out under 293 K temperature conditions. The ostrich is a large flightless bird which contains inositol tetrakisphosphate in erythrocytes and its whole blood oxygen affinity is higher. Efforts have been made to explore the structure–function relationship of ostrich heamoglobin. Haemoglobin is a tetrameric protein that carries oxygen from the lungs to tissues and carbon dioxide from tissues back to the lungs. The oxygen-binding properties of haemoglobin are regulated through the binding of allosteric effectors. The respiratory system of avian species is unique and complex in nature when compared with that of mammals. In avian species, inositol pentaphosphate (inositol-P 5 ) is present in the erythrocytes of the adult and is thought to be the major factor responsible for the relatively high oxygen affinity of the whole blood. The ostrich (Struthio camelus) is a large flightless bird which contains inositol tetrakisphosphate (inositol-P 4 ) in its erythrocytes and its whole blood oxygen affinity is higher. Efforts have been made to explore the structure–function relationship of ostrich haemoglobin. Ostrich haemoglobin was purified using ion-exchange chromatography. Haemoglobin crystals were grown by the hanging-drop vapour-diffusion method using PEG 3350 as the precipitant in 50 mM phosphate buffer pH 7.2. Data were collected using a MAR345 image-plate detector system. The crystals of ostrich haemoglobin diffracted to 2.2 Å resolution. They belonged to the orthorhombic space group P2 1 2 1 2 1 with one whole biological molecule in the asymmetric unit; the unit-cell parameters were a = 80.93, b = 81.68, c = 102.05 Å
Predicting postoperative haemoglobin changes after burn surgery ...

African Journals Online (AJOL)

Background. Burn surgery is associated with significant blood loss and fluid shifts that cause rapid haemoglobin (Hb) changes during and after surgery. Understanding the relationship between intraoperative and postoperative (day 1) Hb changes may assist in avoiding postoperative anaemia and unnecessary ...
Purification, crystallization and preliminary X-ray diffraction studies on avian haemoglobin from pigeon (Columba livia)

International Nuclear Information System (INIS)

Sathya Moorthy, Pon.; Neelagandan, K.; Balasubramanian, M.; Ponnuswamy, M. N.

2009-01-01

Crystallization of pigeon haemoglobin at low pH (5.5) and high ionic concentration (1 M) using the hanging-drop vapour-diffusion method is reported. Haemoglobin is a physiologically significant metalloprotein that is involved in the exchange of gases for sustaining life. The respiratory system of birds is unique and complex compared with that of mammals. Many investigations of avian haemoglobins have revealed the presence of inositol pentaphosphate (IP5), a principal allosteric effector that is involved in regulation of their function. Structural investigations of avian haemoglobins are presently not adequate to explain their function. Efforts have been made in this direction in order to understand the oxygen-binding affinity involved in adapting to hypoxia in avian haemoglobins. Fresh whole blood was collected from pigeon (Columba livia) and purified using a DEAE cellulose anion-exchange chromatographic column. Crystallization of pigeon haemoglobin was accomplished using the hanging-drop vapour-diffusion method using PEG 3350 as a precipitant in 50 mM sodium acetate buffer pH 5.5 with 1 M NaCl. Data collection was carried out using a MAR345 image-plate detector system. The crystals diffracted to 2 Å resolution. Pigeon haemoglobin crystallizes in a triclinic space group, with two whole biological molecules in the asymmetric unit and with unit-cell parameters a = 55.005, b = 65.528, c = 104.370 Å, α = 78.742, β = 89.819, γ = 65.320°
Net haemoglobin increase from reinfusion of refrigerated vs. frozen red blood cells after autologous blood transfusions

DEFF Research Database (Denmark)

Ashenden, M; Mørkeberg, Jakob Sehested

2011-01-01

BACKGROUND AND OBJECTIVES Two main blood storage procedures can be used for storing red blood cells: refrigeration and freezing. Nevertheless, the efficiency of these procedures measured as the increase in haemoglobin after reinfusion compared with baseline has never been examined. The main...... objective was to examine which storage procedure yielded the largest increase in circulating haemoglobin after reinfusion compared to baseline. MATERIALS AND METHODS Equal volumes of blood from 15 men were withdrawn and stored either frozen or refrigerated as packed red blood cells. Serial measures...... of circulating haemoglobin by carbon monoxide rebreathing provided an opportunity to monitor recovery from anaemia, as well as the net increase in circulating haemoglobin after transfusion. RESULTS The post-thaw yield of haemoglobin in the bags was 72% after refrigerated storage compared with only 52% after...
Dietary pattern, haemoglobin and haematocrit status of pregnant ...

African Journals Online (AJOL)

Dietary pattern, haemoglobin and haematocrit status of pregnant women in Ogbaru ... Nigerian Journal of Nutritional Sciences ... 220 out of 733 pregnant women attending antenatal clinics in the health centres within the three communities.
SERUM MAGNESIUM, LIPID PROFILE AND GLYCATED HAEMOGLOBIN IN DIABETIC RETINOPATHY

Directory of Open Access Journals (Sweden)

Sunanda Vusikala

2016-07-01

Full Text Available BACKGROUND Diabetic retinopathy is one of the important microvascular complications of diabetes mellitus of long duration. Alterations in trace metals like magnesium and lipid profile was observed in diabetic retinopathy with hyperglycaemic status. AIM The study was taken up to assess the role of magnesium, lipid profile and glycated haemoglobin in diabetic retinopathy. MATERIALS AND METHODS A total of 80 subjects between 40-65 years were included in the study. Group 1 includes 20 age and sex matched healthy controls. Group 2 includes 30 cases of Diabetes mellitus without retinopathy. Group 3 includes 30 cases of Diabetes mellitus with retinopathy. RESULTS Magnesium was found to be significantly low in the diabetic group with retinopathy. Serum cholesterol and triglycerides were significantly elevated in the diabetic group with retinopathy. Fasting and Postprandial plasma glucose and glycated haemoglobin (HbA1c levels confirmed the glycaemic status of each of the groups. CONCLUSIONS Hypomagnesemia, hypercholesterolaemia, hypertriglyceridemia was observed in diabetic retinopathy along with increased levels of glycated haemoglobin in our study.
Is glycosylated haemoglobin a marker of fertility?

DEFF Research Database (Denmark)

Hjollund, N H; Jensen, Tina Kold; Bonde, Jens Peter

1999-01-01

We performed a follow-up study of time to pregnancy in a population of first-time pregnancy planners without previous reproductive experience. The objective of this paper is to report and discuss a finding of a strong relationship between glycosylated haemoglobin (HbA1C) and fertility. A total...
Purification, crystallization and preliminary X-ray diffraction studies on avian haemoglobin from pigeon (Columba livia)

Science.gov (United States)

Sathya Moorthy, Pon.; Neelagandan, K.; Balasubramanian, M.; Ponnuswamy, M. N.

2009-01-01

Haemoglobin is a physiologically significant metalloprotein that is involved in the exchange of gases for sustaining life. The respiratory system of birds is unique and complex compared with that of mammals. Many investigations of avian haemoglobins have revealed the presence of inositol pentaphosphate (IP5), a principal allosteric effector that is involved in regulation of their function. Structural investigations of avian haemoglobins are presently not adequate to explain their function. Efforts have been made in this direction in order to understand the oxygen-binding affinity involved in adapting to hypoxia in avian haemoglobins. Fresh whole blood was collected from pigeon (Columba livia) and purified using a DEAE cellulose anion-exchange chromatographic column. Crystallization of pigeon haemoglobin was accomplished using the hanging-drop vapour-diffusion method using PEG 3350 as a precipitant in 50 mM sodium acetate buffer pH 5.5 with 1 M NaCl. Data collection was carried out using a MAR345 image-plate detector system. The crystals diffracted to 2 Å resolution. Pigeon haemoglobin crystallizes in a triclinic space group, with two whole biological molecules in the asymmetric unit and with unit-cell parameters a = 55.005, b = 65.528, c = 104.370 Å, α = 78.742, β = 89.819, γ = 65.320°. PMID:19194000

Risk factors and consequences of maternal anaemia and elevated haemoglobin levels during pregnancy: a population-based prospective cohort study.

Science.gov (United States)

Gaillard, Romy; Eilers, Paul H C; Yassine, Siham; Hofman, Albert; Steegers, Eric A P; Jaddoe, Vincent W V

2014-05-01

To determine sociodemographic and life style-related risk factors and trimester specific maternal, placental, and fetal consequences of maternal anaemia and elevated haemoglobin levels in pregnancy. In a population-based prospective cohort study of 7317 mothers, we measured haemoglobin levels in early pregnancy [gestational age median 14.4 weeks (inter-quartile-range 12.5-17.5)]. Anaemia (haemoglobin ≤11 g/dl) and elevated haemoglobin levels (haemoglobin ≥13.2 g/dl) were defined according to the WHO criteria. Maternal blood pressure, placental function and fetal growth were measured in each trimester. Data on gestational hypertensive disorders and birth outcomes was collected from hospitals. Older maternal age, higher body mass index, primiparity and European descent were associated with higher haemoglobin levels (P pregnancy (mean differences 5.1 mmHg, 95% confidence interval [CI] 3.8, 6.5 and 4.1 mmHg, 95% CI 3.0, 5.2, respectively) and with a higher risk of third trimester uterine artery notching (RR 1.3, 95% CI 1.0, 1.7). As compared with maternal normal haemoglobin levels, not anaemia, but elevated haemoglobin levels were associated with fetal head circumference, length, and weight growth restriction from third trimester onwards (P pregnancy. Elevated haemoglobin levels are associated with increased risks of maternal, placental, and fetal complications. © 2014 John Wiley & Sons Ltd.
Changing reference intervals for haemoglobin in Denmark

DEFF Research Database (Denmark)

Ryberg-Nørholt, Judith; Frederiksen, Henrik; Nybo, Mads

2017-01-01

INTRODUCTION: Based on international experiences and altering demography the reference intervals (RI) for haemoglobin (Hb) concentrations in blood were changed in Denmark in 2013 from 113 - 161 g/L to 117 - 153 g/L for women and from 129 - 177 g/L to 134 - 170 g/L for men. The aim of this study w...
Distribution of abo, rhesus blood groups and haemoglobin ...

African Journals Online (AJOL)

Summary: The distribution of ABO, Rhesus blood groups and haemoglobin electrophoresis among 200 undergraduate students of Niger Delta University, Bayelsa State, Nigeria randomly selected were studied. Blood samples were collected by venepuncture from the antecubital vein. The blood sample were transferred into ...
Knowledge insufficient: the management of haemoglobin SC disease.

Science.gov (United States)

Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

2017-02-01

Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.
Study of helminthiasis in pregnancy and its correlation with haemoglobin level.

Science.gov (United States)

K, Shrinivas; Radhika; R, Sreelatha; K, Kavitha

2014-10-01

To study types of worm infestation in pregnancy and to correlate helminthiasis with haemoglobin level in antenatal women presenting in 2nd and 3rd trimester. This prospective cross sectional hospital based study conducted at Vanivilas hospital attached to Bangalore medical college, over a period of sixmonths. Study included 500 pregnant women attending antenatal opd in 2nd and 3rd trimester, selected by systematic random sampling method. Parasitic examination and haemoglobin estimation done respectively with Stool and blood samples collected from study group. Presence of parasites was correlated with haemoglobin percentage. Helminthiasis was found in 62 women (12.4%). All infected women had single type helminth infection. Ascariasis was more commonly found than hookworm (10% Vs 2.4%). Anaemia of various degrees was found in 88.7% of women with helminthiasis as compared to 56.4% women without worm infestation (p-value Helminthiasis is a significant burden in pregnancy and it is associated with anaemia. Hence, the policy of universal administration of anthelminthic drug in pregnancy after first trimester, as recommended by WHO should be practically enforced besides health education.
Awareness and distribution of ABO, Rhesus blood groups and haemoglobin phenotypes among medical undergraduates in a Nigerian university.

Science.gov (United States)

Akingbola, T S; Yuguda, S; Akinyemi, O O; Olomu, S

2016-09-01

In the past two decades the Nigerian government and religious organisations have put more emphasis on knowing the haemoglobin electrophoresis of school children and intending couples respectively. Knowledge of the distribution of blood groups and haemoglobin electrophoretic patterns among young people is vital for the prevention of haemoglobinopathies in the population and for providing effective blood banking services. Therefore, this study was designed to assess the frequency and awareness of blood group and haemoglobinphenotypes among a new set of fourth year clinical medical and dental students of the University of Ibadan, Nigeria. Data, including socio-demographics, self- reported blood group and haemoglobin phenotypes, were obtained from 155 students using a self-administered questionnaire. The ABO, Rhesus (Rh) blood groups and haemoglobin electrophoresis were determined by the tile (slide) technique and cellulose acetate at alkaline phrespectively. Only 43.9% of the participants knew their blood groups while less than a third (29.7%) knew their haemoglobin phenotypes. knowledge of both their blood groups and haemoglobin phenotypes was documented in as low as 20.6% of the respondents. The frequency of haemoglobin AA, AS, AC and. CC were 78.0%, 16.8%, 3.9% and 1.3% respectively. Similarly, the distribution of blood groups were: 0 RhD positive - 47.8%;0 RhD negative- 1.9%;ARhD positive- 21.9%; A RhD negative - 1.3%; B RhD positive - 23.2%; B RhD negative -1.3% and AB RhD positive - 2.6%. No participant was AB RhD negative. Participants who bad previously donated blood and those who were females were more likely to know their blood groups and haemoglobin phenotypes respectively (pblood groups and haemoglobin phenotypes among the medical and dental students was poor. Documentation and routine screening for haemoglobinphenotypes as well as blood grouping, accompanied by appropriate counseling should be institutionalised in Nigeriantertiary institutions.
Racial variations in booking haemoglobin of primigravidae in Malaysia: a prospective study.

Science.gov (United States)

Tan, Albert Chao Chiet; Leong, Eugene Weng Kong; Chua, Ai Chen; Moy, Foong Ming

2013-05-01

Variations in racial haemoglobin had been previously described in multiple studies locally and abroad. This study was conducted to quantify the differences in haemoglobin of booking primigravidae amongst the three major races in Malaysia at the antenatal clinic of University Malaya Medical Centre, Kuala Lumpur. One year prospective study of booking full blood count sample of primigravidae taken in one centre was conducted. Multiple comparative analyses of the booking haemoglobin were performed using the One-way ANOVA comparative mean test in each trimester. 622 primigravidae without any known history of haematological disorders were recruited into the study. The mean haemoglobin for the Indian race was the lowest compared to the two other races in the second and the third trimesters, and it was found to be statistically significant lower (p- value 0.001) than the Malay race in the second trimester. It was also found that the Indian race had a significantly higher incidence of moderate to severe anaemia (p- value: 0.029). The prevalence of anaemia in our study population is also significantly higher in the Indian population (p- value: 0.01). The findings from this study have established that there is racial preponderance to anaemia in pregnancy. The Indian race is at a higher risk of having anaemia in pregnancy particularly in the second trimester.
Characterization of blood donors with high haemoglobin concentration

DEFF Research Database (Denmark)

Magnussen, K; Hasselbalch, H C; Ullum, H

2013-01-01

Background and Objectives The literature contains little on the prevalence and causes of high predonation haemoglobin levels among blood donors. This study aimed to characterize and develop an algorithm to manage would-be donors with polycythaemia. Materials and Methods Between November 2009...... and November 2011, we offered haematology consultations to blood donors with repeated haemoglobin concentration (Hb) above the WHO limit for polycythaemia vera (PV) (10·2 and 11·5 mm/16·5 and 18·5 g/dl for women and men, respectively). Investigation of such donors included Hb, haematocrit, mean cell volume......, erythropoietin, ferritin, platelet count and leucocyte count, JAK2 V617 and JAK2 exon12 analysis, as well as other routine measurements. Results Among 46 such donors, 39 had a history of smoking, which contributes to erythrocytosis. Two had PV, five had severe hypertension, one of them because of renal artery...
Characterization of haemoglobin from Actinorhizal plants – An in ...

Indian Academy of Sciences (India)

2013-10-01

Oct 1, 2013 ... Actinorhizal plant; haemoglobin (Hb); homology modelling; vesicle ..... specifies the overall quality of the models and determines the extent to which .... service for the recognition of errors in three-dimensional struc- tures of ...
Relationship Between Glycated Haemoglobin and Body Mass Index ...

African Journals Online (AJOL)

Blood pressure, Height, Weight were all measured and body mass index (BMI) calculated as weight (in kilograms) divided by height (in meters squared). Glycated haemoglobin was estimated using the ion exchange chromatography method. Result: A total of 100 healthy subjects, 50 males and 50 females, ages ranging ...
Changes in haemoglobin levels according to changes in body mass index and smoking habits, a 20-year follow-up of a male cohort

International Nuclear Information System (INIS)

Skjelbakken, Tove; Dahl, Inger Marie S.; Wilsgaard, Tom; Langbakk, Bodil; Lochen, Maja-Lisa

2006-01-01

Haemoglobin level declines with increasing age in cross sectional studies. Little is known about the longitudinal changes of haemoglobin. Because both high or low haemoglobin levels increase mortality and morbidity we examined how changes in lifestyle factors like body mass index (BMI) and smoking habits influence cohort changes in haemoglobin level. In all, 4159 men aged 20-49 years at baseline were examined in 1974 and 1994-1995 in a longitudinal, population-based study from the municipality of Tromso, Northern Norway. Mean haemoglobin was 148 g/l. There was no difference in mean haemoglobin after 20 years in any strata of age. Mean BMI increased 2.1 kg/m 2 . The prevalence of smokers decreased 20.1 percentage points. In a multiple regression analysis increase in BMI was associated with increased haemoglobin change. Smoking cessation lowered mean haemoglobin 1.6 g/l compared to never smokers. Haemoglobin increased 0.8 g/l in smoking quitters whose BMI increased >2.5 kg/m 2 compared to a decrease of 6.7 g/l in weight reducers. There was a positive dose-response relationship between changes in cigarettes smoked per day and change in haemoglobin among consistent smokers. In conclusion, in contrast to cross sectional studies, mean haemoglobin did not change during 20 years ageing of relatively young men. This could be explained by higher BMI and less smoking. The increase in BMI affected haemoglobin change to such an extent that the reduction in haemoglobin due to smoking cessation was counteracted. Prospective studies are needed to address the health implications
Relationship of white blood cell counts, haemoglobin and ESR with IHD

International Nuclear Information System (INIS)

Shahzad, F.; Shahzad Tawwab, S.; Abbas, A.

2009-01-01

To find any association of white blood cells, haemoglobin and ESR with ischemic heart disease in high risk native population. Methodology: The study included 93 male patients with Ischemic heart disease, between 40 and 60 years of age; 96 age and gender matched subjects. All study participants were non-diabetics. Complete blood cells count, haemoglobin and ESR levels were compared between the patient and control groups. Results: Total leukocyte counts along with neutrophils were significantly higher in the test group compared to the control population (p<0.001) and lymphocytes were significantly lower (p<0.001) in the patient group as compared to the control group. Haemoglobin levels were significantly lower (p<0.001) and ESR was higher (p=0.030) in the patient group as compared to the control group. Conclusion: Although, our findings of the study variables extend previous reports, the prevalence and prognostic importance of theses variables in IHD should be assessed in future experimental studies. These parameters could be important in public health because they are routinely measured by clinicians and may be helpful to predict the risk of future and secondary ischemic events in a high risk population. (author)
Validation of the haemoglobin colour scale for screening blood ...

African Journals Online (AJOL)

blood donors for anaemia, using the WHO Haemoglobin Colour. Scale (HCS) for ... simple alternative for assessing anaemia.3,4 It does not aim to compete with a .... staff to see if similar levels of sensitivity and specificity are obtained. A more ...
Point-of-care estimation of haemoglobin concentration in all age ...

African Journals Online (AJOL)

Point-of-care estimation of haemoglobin concentration in all age groups in clinical ... and the results were compared using standard scatter and difference plots. ... Hb measurements with a smaller sample volume, improved turnaround time, ...
How Noninvasive Haemoglobin Measurement with Pulse CO-Oximetry Can Change Your Practice: An Expert Review

Directory of Open Access Journals (Sweden)

Gregor Lindner

2013-01-01

Full Text Available Trauma related haemorrhagic anaemia is rarely diagnosed by physical examination alone but typically includes measurement of blood haemoglobin, one of the most frequently ordered laboratory tests. Recently, noninvasive technologies have been developed that allow haemoglobin to be measured immediately without the need for intravenous access or having to take venous, arterial, or capillary blood. Moreover, with these technologies haemoglobin can be continuously measured in patients with active bleeding, to guide the start and stop of blood transfusions and to detect occult bleeding. Recent studies on the accuracy of the devices showed promising results in terms of accuracy of hemoglobin measurement compared to laboratory determination. The present review gives an overview on the technology itself and reviews the current literature on the subject.
Comparative genome-wide analysis and evolutionary history of haemoglobin-processing and haem detoxification enzymes in malarial parasites.

Science.gov (United States)

Ponsuwanna, Patrath; Kochakarn, Theerarat; Bunditvorapoom, Duangkamon; Kümpornsin, Krittikorn; Otto, Thomas D; Ridenour, Chase; Chotivanich, Kesinee; Wilairat, Prapon; White, Nicholas J; Miotto, Olivo; Chookajorn, Thanat

2016-01-29

Malaria parasites have evolved a series of intricate mechanisms to survive and propagate within host red blood cells. Intra-erythrocytic parasitism requires these organisms to digest haemoglobin and detoxify iron-bound haem. These tasks are executed by haemoglobin-specific proteases and haem biocrystallization factors that are components of a large multi-subunit complex. Since haemoglobin processing machineries are functionally and genetically linked to the modes of action and resistance mechanisms of several anti-malarial drugs, an understanding of their evolutionary history is important for drug development and drug resistance prevention. Maximum likelihood trees of genetic repertoires encoding haemoglobin processing machineries within Plasmodium species, and with the representatives of Apicomplexan species with various host tropisms, were created. Genetic variants were mapped onto existing three-dimensional structures. Genome-wide single nucleotide polymorphism data were used to analyse the selective pressure and the effect of these mutations at the structural level. Recent expansions in the falcipain and plasmepsin repertoires are unique to human malaria parasites especially in the Plasmodium falciparum and P. reichenowi lineage. Expansion of haemoglobin-specific plasmepsins occurred after the separation event of Plasmodium species, but the other members of the plasmepsin family were evolutionarily conserved with one copy for each sub-group in every Apicomplexan species. Haemoglobin-specific falcipains are separated from invasion-related falcipain, and their expansions within one specific locus arose independently in both P. falciparum and P. vivax lineages. Gene conversion between P. falciparum falcipain 2A and 2B was observed in artemisinin-resistant strains. Comparison between the numbers of non-synonymous and synonymous mutations suggests a strong selective pressure at falcipain and plasmepsin genes. The locations of amino acid changes from non
Evaluation of haemoglobin (erythrogen): for improved somatic embryogenesis and plant regeneration in cotton (Gossypium hirsutum L. cv. SVPR 2).

Science.gov (United States)

Ganesan, M; Jayabalan, N

2004-10-01

Somatic embryogenesis in cotton (Gossypium hirsutum L.) is accelerated when the plant regeneration medium is supplemented with haemoglobin (erythrogen). In cotton SVPR 2 lines, a higher frequency of embryoid formation was observed when the medium contained 400 mg/l haemoglobin. Fresh weight of the callus, rate of embryoid induction, number of embryoids formed and the percentage of plant regeneration from somatic embryos were increased. Among the two different cultivars tested, MCU 11 showed no response to the presence of haemoglobin when compared to SVPR 2, and embryogenic callus formation was completely absent in the former. Medium containing MS salts, 100 mg/l myo-inositol , 0.3 mg/l thiamine-HCL, 0.3 mg/l Picloram (PIC), 0.1 mg/l kinetin and 400 mg/l haemoglobin effected a better response with respect to embryogenic callus induction. After 8 weeks of culture, a high frequency of embryoid induction was observed on medium containing MS basal salts, 100 mg/l myo-inositol, 0.3 mg/l PIC , 0.1 mg/l isopentenyl adenine, 1.0 g/l NH4NO3 and 400 mg/l haemoglobin. Plant regeneration was observed in 75.8% of the mature somatic embryos, and whole plant regeneration was achieved within 6-7 months of culture. The regenerated plantlets were fertile and similar to in vivo-grown, seed-derived plants except that they were phenotypically smaller. A positive influence of haemoglobin was observed at concentrations up to 400 mg/l at all stages of somatic embryogenesis. The increase in the levels of antioxidant enzyme activities, for example superoxide dismutase and peroxidase, indicated the presence of excess oxygen uptake and the stressed condition of the plant tissues that arose from haemoglobin supplementation. This increased oxygen uptake and haemoglobin-mediated stress appeared to accelerate somatic embryogenesis in cotton.
Abnormal haemoglobin variants, ABO and Rh blood groups among ...

African Journals Online (AJOL)

Background: Abnormal haemoglobin variants ( HbSS,AS,AC,SC,etc) have been known to be common among blacks. Patients with sickle cell disease are often faced with the risk of alloimmunization from allogeneic blood transfusion. Objectives: The study was designed to sample students population of African descents for ...
Point-of-care estimation of haemoglobin concentration in neonates ...

African Journals Online (AJOL)

Objective. The HemoCue is a point-of-care analytical system for haemoglobin concentration (Hb) measurement. Point-of-care testing has been validated in hospitals and outpatient departments to assist with urgent patient management by providing rapid laboratory test results. Method. In this prospective study we compared ...
Haemoglobins with multiple reactive sulfhydryl groups: reactions of ...

African Journals Online (AJOL)

The pH dependence profile of kapp for the slow phase resembles the titration curve of a monoprotic acid. Quantitative analysis indicates that the sulfhydryl group to which this phase may be attributed is linked to a single ionizable group with a pKa of 6.1 0.2. Examination of the structure of guinea pig haemoglobin near the ...

Crystallization and diffraction patterns of the oxy and cyano forms of the Lucina pectinata haemoglobins complex

International Nuclear Information System (INIS)

Ruiz-Martínez, Carlos R.; Nieves-Marrero, Carlos A.; Estremera-Andújar, Rafael A.; Gavira, José A.; González-Ramírez, Luis A.; López-Garriga, Juan; García-Ruiz, Juan M.

2008-01-01

The native oxygen-carrier haemoglobins complex (HbII–III) is composed of haemoglobin II (HbII) and haemoglobin III (HbIII), which are found in the ctenidia tissue of the bivalve mollusc Lucina pectinata. This protein complex was isolated and purified from its natural source and crystallized using the vapour-diffusion and capillary counter-diffusion methods. The native oxygen-carrier haemoglobins complex (HbII–III) is composed of haemoglobin II (HbII) and haemoglobin III (HbIII), which are found in the ctenidia tissue of the bivalve mollusc Lucina pectinata. This protein complex was isolated and purified from its natural source and crystallized using the vapour-diffusion and capillary counter-diffusion methods. Oxy and cyano derivatives of the complex crystallized using several conditions, but the best crystals in terms of quality and size were obtained from sodium formate pH 5 using the counter-diffusion method in a single capillary. Crystals of the oxy and cyano complexes, which showed a ruby-red colour and nonsingular prismatic shapes, scattered X-rays to resolution limits of 2.15 and 2.20 Å, respectively, using a 0.886 Å synchrotron-radiation source. The crystals belonged to the tetragonal system, space group P4 2 2 1 2, with unit-cell parameters a = b = 74.07, c = 152.07 and a = b = 73.83, c = 152.49 Å for the oxy and cyano complexes, respectively. The asymmetric unit of both crystals is composed of a single copy of the heterodimer, with Matthew coefficients (V M ) of 3.08 and 3.06 Å 3 Da −1 for the oxy and cyano complexes, respectively, which correspond to a solvent content of approximately 60.0% by volume
Non-invasive technology to determine the haemoglobin level of ...

African Journals Online (AJOL)

Background: Predonation haemoglobin (Hb) check has been done traditionally by the copper sulphate (CuSO4), or the haemocue haemoglobinometer methods. Both of these require a fingerprick of the donor to obtain capillary blood samples. It is thought that a non-invasive, but accurate method of Hb check will reduce ...
Prevalence of haemoglobin variants among the Ika ethnic nationality ...

African Journals Online (AJOL)

McRoy

2014-07-26

Jul 26, 2014 ... mandatory genetic counseling and screening of all intending couples in order to avert the sickling gene pool in our population. REFERENCES. 1. Esan A.J, Omisakin C.T and Okkhuakhua. O. Frequency Distribution of Haemoglobin. Variants, ABO and Rhesus Blood Groups among Children in Ido/Osi Local.
Purification, crystallization and preliminary X-ray diffraction studies of parakeet (Psittacula krameri) haemoglobin

International Nuclear Information System (INIS)

Jaimohan, S. M.; Naresh, M. D.; Arumugam, V.; Mandal, A. B.

2009-01-01

Parakeet (Psittacula krameri) haemoglobin has been purified and crystallized under low salt buffered conditions. Preliminary analysis of the crystal that belonged to monoclinic system (C2) is reported. Birds often show efficient oxygen management in order to meet the special demands of their metabolism. However, the structural studies of avian haemoglobins (Hbs) are inadequate for complete understanding of the mechanism involved. Towards this end, purification, crystallization and preliminary X-ray diffraction studies have been carried out for parakeet Hb. Parakeet Hb was crystallized as the met form in low-salt buffered conditions after extracting haemoglobin from crude blood by microcentrifugation and purifying the sample by column chromatography. Good-quality crystals were grown from 10% PEG 3350 and a crystal diffracted to about 2.8 Å resolution. Preliminary diffraction data showed that the Hb crystal belonged to the monoclinic system (space group C2), with unit-cell parameters a = 110.68, b = 64.27, c = 56.40 Å, β = 109.35°. Matthews volume analysis indicated that the crystals contained a half-tetramer in the asymmetric unit
The effect of golimumab on haemoglobin levels in patients with rheumatoid arthritis, psoriatic arthritis or ankylosing spondylitis.

Science.gov (United States)

Furst, Daniel E; Kay, Jonathan; Wasko, Mary Chester; Keystone, Edward; Kavanaugh, Arthur; Deodhar, Atul; Murphy, Frederick T; Magnus, Jeanette H; Hsia, Elizabeth C; Hsu, Benjamin; Xu, Stephen; Rahman, Mahboob U; Doyle, Mittie K

2013-10-01

To evaluate the effect of golimumab on haemoglobin levels in patients with RA, PsA or AS. Secondary analysis was performed on integrated data from five randomized controlled studies: three RA, one PsA and one AS (2303 patients total). Golimumab 50 or 100 mg was injected s.c. every 4 weeks with or without MTX. Control groups received placebo injections plus MTX or background therapy. Patients with haemoglobin levels below the age- and sex-specific normal ranges were considered to have anaemia. Ferritin levels were used to distinguish anaemia of mixed aetiology (≥ 15 and <60 ng/ml) and anaemia of inflammation (≥ 60 ng/ml). Changes from baseline to weeks 14 and 24 in haemoglobin level were compared between treatment groups using an analysis of variance on the van der Waerden normal scores. At baseline, 21% of RA patients, 9% of PsA patients and 15% of AS patients had anaemia. Of these, 24%, 57% and 25%, respectively, had anaemia of inflammation. The median increase from baseline to week 14 in the haemoglobin level of anaemic patients was 0.3 g/dl in the control group and 0.9 g/dl in the golimumab group (P < 0.001). Haemoglobin levels improved within the subgroups of patients with anaemia of mixed aetiology (control, 0.4 g/dl vs golimumab, 0.7 g/dl) (P = 0.305) and with anaemia of inflammation (0.2 vs 1.4 g/dl, respectively) (P < 0.001). Compared with the control group, patients receiving golimumab treatment had significantly improved haemoglobin levels, particularly among patients with anaemia of inflammation.
Hepcidin plasma levels are not associated with changes in haemoglobin in early rheumatoid arthritis patients

DEFF Research Database (Denmark)

Østgård, R D; Glerup, H; Jurik, A G

2017-01-01

Objective: A reduction in haemoglobin level is a frequent complication among rheumatoid arthritis (RA) patients. Hepcidin has been linked to disturbed erythropoiesis. The objective of this study was to investigate the longitudinal changes in hepcidin in patients with early RA. Method: Hepcidin...... with disease-modifying anti-rheumatic drugs (DMARDs) and with additional adalimumab (ADA, n = 42) or placebo (PLA, n = 38) during 52 weeks, using a treat-to-target strategy, aiming for a 28-joint Disease Activity Score (DAS28) levels [median (interquartile range)] were 9...... = 0.48, p levels of haemoglobin and hepcidin at baseline or during the 52 week follow-up. No change in haemoglobin levels was seen as a function of hepcidin changes. In a mixed statistical model, no single factor was connected with the regulation...
Association of foetal haemoglobin with pancreatic enzymes in sickle ...

African Journals Online (AJOL)

Background/Aim: There are conflicting reports on the potential protective effects of foetal haemoglobin (HbF) in the elimination of symptoms of Sickle cell disease in the patients and reports which correlate the levels of HbF with pancreatic enzymes in SCD are scarce in the literature.This study correlates the levels of HbF on ...
Role of the duplicated CCAAT box region in γ-globin gene regulation and hereditary persistence of fetal haemoglobin.

NARCIS (Netherlands)

A. Ronchi (Antonella); M. Berry (Meera); S. Raguz (Selina); A.M.A. Imam (Ali); N. Yannoutsos (Nikos); S. Ottolenghi (Sergio); F.G. Grosveld (Frank); N.O. Dillon (Niall)

1996-01-01

textabstractHereditary persistence of fetal haemoglobin (HPFH) is a clinically important condition in which a change in the developmental specificity of the gamma-globin genes results in varying levels of expression of fetal haemoglobin in the adult. The condition is benign and can significantly
Blood haemoglobin concentrations are higher in smokers and heavy alcohol consumers than in non-smokers and abstainers-should we adjust the reference range?

DEFF Research Database (Denmark)

Milman, N.; Pedersen, Agnes N.

2009-01-01

The blood haemoglobin concentration is one of the most frequently used laboratory parameters in clinical practice. There is evidence that haemoglobin levels are influenced by tobacco smoking. The objective of this study was to evaluate the impact of smoking and alcohol consumption on haemoglobin.......001) and women (r = 0.08, p = 0.05). In non-smokers, alcohol consumption > 14 drinks/week and more than seven drinks/week for men and women, respectively, increased mean haemoglobin by 1.3% in men and by average 1.9% in women compared with those consuming a parts per thousand currency sign14 and less than...... small changes in haemoglobin do not justify the use of separate reference ranges in smokers and alcohol consumers....
Anaemia during pregnancy: impact on birth outcome and infant haemoglobin level during the first 18 months of life.

Science.gov (United States)

Koura, Ghislain K; Ouedraogo, Smaïla; Le Port, Agnès; Watier, Laurence; Cottrell, Gilles; Guerra, José; Choudat, Isabelle; Rachas, Antoine; Bouscaillou, Julie; Massougbodji, Achille; Garcia, André

2012-03-01

To determine the effect of maternal anaemia on pregnancy outcome and describe its impact on infant haemoglobin level in the first 18 months of life, we conducted a prospective study of 617 pregnant women and their children in Benin. Prevalence of maternal anaemia at delivery was 39.5%, and 61.1% of newborns were anaemic at birth. Maternal anaemia was not associated with low birth weight [OR = 1.2 (0.6-2.2)] or preterm birth [OR = 1.3 (0.7-2.4)], whereas the newborn's anaemia was related to maternal anaemia [OR = 1.8 (1.2-2.5)]. There was no association between an infant's haemoglobin level until 18 months and maternal anaemia. However, malaria attacks during follow-up, male gender and sickle cell trait were all associated with a lower infant haemoglobin level until 18 months, whereas good infant feeding practices and a polygamous family were positively associated with a higher haemoglobin level during the first 18 months of life. © 2011 Blackwell Publishing Ltd.
Is glycosylated haemoglobin a marker of fertility?

DEFF Research Database (Denmark)

Hjollund, N H; Jensen, T K; Bonde, J P

1999-01-01

We performed a follow-up study of time to pregnancy in a population of first-time pregnancy planners without previous reproductive experience. The objective of this paper is to report and discuss a finding of a strong relationship between glycosylated haemoglobin (HbA1C) and fertility. A total...... concentration of inhibin A. No association was found between HbA1C and psychosocial distress. The reduced fertility among women with high HbA1C may be due to an association with subclinical polycystic ovaries as indicated by the hormonal profile....
Capillary crystallization and molecular-replacement solution of haemoglobin II from the clam Lucina pectinata

International Nuclear Information System (INIS)

Gavira, José A.; Jesus, Walleska de; Camara-Artigas, Ana; López-Garriga, Juan; García-Ruiz, Juan M.

2006-01-01

The haemoglobin II from the clam L. pectinata has been crystallized using counter-diffusion in single capillary in the presence of agarose to improve crystal quality. Initial phases have been obtained by molecular replacement. Haemoglobin II is one of three haemoglobins present in the cytoplasm of the Lucina pectinata mollusc that inhabits the Caribbean coast. Using HBII purified from its natural source, crystallization screening was performed using the counter-diffusion method with capillaries of 0.2 mm inner diameter. Crystals of HbII suitable for data collection and structure determination were grown in the presence of agarose at 0.1%(w/v) in order to improve their quality. The crystals belong to the tetragonal space group P4 2 2 1 2, with unit-cell parameters a = b = 73.92, c = 152.35 Å, and diffracted X-rays to a resolution of better than 2.0 Å. The asymmetric unit is a homodimer with a corresponding Matthews coefficient (V M ) of 3.15 Å 3 Da −1 and a solvent content of 61% by volume
Serum Iron and Haemoglobin Estimation in Oral Submucous Fibrosis and Iron Deficiency Anaemia: A Diagnostic Approach.

Science.gov (United States)

Bhardwaj, Divya; Dinkar, Ajit D; Satoskar, Sujata K; Desai, Sapna Raut

2016-12-01

Oral Submucous Fibrosis (OSMF) is a premalignant condition with potential malignant behaviour characterized by juxta-epithelial fibrosis of the oral cavity. In the process of collagen synthesis, iron gets utilized, by the hydroxylation of proline and lysine, leading to decreased serum iron levels. The trace element like iron is receiving much attention in the detection of oral cancer and precancerous condition like OSMF as it was found to be significantly altered in these conditions. The aim of this study was to compare the haemoglobin and serum iron values of OSMF subjects with that of iron deficiency anaemia subjects. Total of 120 subjects were included, 40 subjects with the OSMF, 40 with the iron deficiency anemia without tobacco chewing habit, 40 healthy control subjects without OSMF and iron deficiency anaemia. A total of 5ml of venous blood was withdrawn from all the subjects and serum iron and haemoglobin levels were estimated for all the subjects. Estimation of iron was done using Ferrozine method and haemoglobin by Sahli's method. The statistical method applied were Kruskal Wallis, Mann Whitney and Pearson correlation coefficient test. There was a statistically significant difference in serum iron and haemoglobin level in all three groups (pauxillary test in assessment of prognosis of the disease.
Inositol-P6 induced structural changes in duck major haemoglobin

African Journals Online (AJOL)

Bamiji Babalola

2011-11-02

Nov 2, 2011 ... of duck (Anas platyrhinchos) have been carried out in the presence of ... dependence profile of the apparent second-order rate constant of both oxy- and ... Key words: 5,5‟-Dithiobis (2-nitrobenzoate), duck, haemoglobin, inositol-P6, sulphydryl group. ... Saigo, 1999), thereby making it possible to detect the.
Haemoglobin genotype of children with severe malaria seen at the ...

African Journals Online (AJOL)

Abstract: Introduction: Types of haemoglobin (Hb) genotype have been found to be crucial to the rate of red blood cell parasite invasion, multiplication, and destruction as well as outcome of malaria disease. In a bid to provide more information on the relationship between Hb genotype and level of protection conferred by ...
Maternal anaemia at delivery and haemoglobin evolution in children during their first 18 months of life using latent class analysis.

Directory of Open Access Journals (Sweden)

Kobto G Koura

Full Text Available BACKGROUND: Anaemia during pregnancy and at delivery is an important public health problem in low- and middle-income countries. Its association with the children's haemoglobin level over time remains unclear. Our goals were to identify distinct haemoglobin level trajectories using latent class analysis and to assess the association between these trajectories and maternal anaemia and other risk factors. METHOD: A prospective study of children from birth to 18 months of life was conducted in a rural setting in Tori-Bossito, Benin. The main outcome measure was the haemoglobin levels repeatedly measured at 3, 6, 9, 12, 15 and 18 months. Variables were collected from the mothers at delivery and from their children at birth and during the follow-up. The analyses were performed by means of Latent Class Analysis which has never been used for this kind of data. All the analyses were performed with Stata software, version 11.0, using the generalized linear latent and mixed model (GLLAMM framework. RESULTS: We showed that 33.7% of children followed a low haemoglobin trajectory and 66.3% a high trajectory during the first 18 months of life. Newborn anaemia, placental malaria, malaria attack, sickle cell trait and male gender were significantly associated with a lower children's haemoglobin level over time, whereas maternal age, children living in a polygamous family and with good feeding practices had a higher Hb level in the first18 months. We also showed that maternal anaemia was a predictor for 'low haemoglobin level trajectory' group membership but have no significant effect on children haemoglobin level over time. CONCLUSION: Latent Class Analyses framework seems well suited to analyse longitudinal data under the hypothesis that different subpopulations of subjects are present in the data, each with its own set of parameters, with distinctive evolutions that themselves may reflect distinctive aetiologies.
Establishing traceability of photometric absorbance values for accurate measurements of the haemoglobin concentration in blood

Science.gov (United States)

Witt, K.; Wolf, H. U.; Heuck, C.; Kammel, M.; Kummrow, A.; Neukammer, J.

2013-10-01

Haemoglobin concentration in blood is one of the most frequently measured analytes in laboratory medicine. Reference and routine methods for the determination of the haemoglobin concentration in blood are based on the conversion of haeme, haemoglobin and haemiglobin species into uniform end products. The total haemoglobin concentration in blood is measured using the absorbance of the reaction products. Traceable absorbance measurement values on the highest metrological level are a prerequisite for the calibration and evaluation of procedures with respect to their suitability for routine measurements and their potential as reference measurement procedures. For this purpose, we describe a procedure to establish traceability of spectral absorbance measurements for the haemiglobincyanide (HiCN) method and for the alkaline haematin detergent (AHD) method. The latter is characterized by a higher stability of the reaction product. In addition, the toxic hazard of cyanide, which binds to the iron ion of the haem group and thus inhibits the oxygen transport, is avoided. Traceability is established at different wavelengths by applying total least-squares analysis to derive the conventional quantity values for the absorbance from the measured values. Extrapolation and interpolation are applied to get access to the spectral regions required to characterize the Q-absorption bands of the HiCN and AHD methods, respectively. For absorbance values between 0.3 and 1.8, the contributions of absorbance measurements to the total expanded uncertainties (95% level of confidence) of absorbance measurements range from 1% to 0.4%.
The relationship between helminth infections and low haemoglobin levels in Ethiopian children with blood type A.

Science.gov (United States)

Degarege, A; Yimam, Y; Madhivanan, P; Erko, B

2017-05-01

The current study was conducted to evaluate the nature of association of ABO blood type with helminth infection and related reduction in haemoglobin concentration. Stool samples were collected from 403 school-age children attending Tikur Wuha Elementary School from February to April 2011. Helminth infection was examined using formol-ether concentration and thick Kato-Katz (two slides per stool specimen) techniques. Haemoglobin level was determined using a HemoCue machine and ABO blood type was determined using the antisera haemagglutination test. Nutritional status was assessed using height and weight measurements. Out of 403 children examined, 169, 120, 96 and 18 had blood type O, A, B and AB, respectively. The prevalences of helminth infections were 46.9% for hookworm, 24.6% for Schistosoma mansoni, 4.2% for Ascaris lumbricoides, 1.7% for Trichuris trichiura and 58.3% for any helminth species. The relative odds of infection with at least one helminth species was significantly higher among children with blood type A (adjusted odds ratio (AOR), 2.10; 95% confidence interval (CI), 1.28-3.45) or blood type B (AOR, 2.08; 95% CI, 1.22-3.56) as compared to children with blood type O. Among children infected with helminths, mean haemoglobin concentration was lower in those with blood type A than those with blood type O (β, -0.36; 95% CI, -0.72 to -0.01). The relative odds of hookworm infection (AOR, 1.78; 95% CI, 1.08-2.92) and related reduction in haemogobin levels (β, -0.45; 95% CI, -0.84 to -0.04) was higher among children with blood type A as compared to those with blood type O. Although the difference was not significant, the relative odds of S. mansoni or A. lumbricoides infections and related reduction in haemoglobin levels was also higher in children with blood type A or B as compared to children with blood type O. In conclusion, children with blood type A are associated with an increased risk of helminth, particularly hookworm, infection and related reduction
Purification, crystallization and preliminary X-ray diffraction studies of parakeet (Psittacula krameri) haemoglobin

OpenAIRE

Jaimohan, S. M.; Naresh, M. D.; Arumugam, V.; Mandal, A. B.

2009-01-01

Parakeet (Psittacula krameri) haemoglobin has been purified and crystallized under low salt buffered conditions. Preliminary analysis of the crystal that belonged to monoclinic system (C2) is reported.
Impact of corpulence parameters and haemoglobin A1c on ...

African Journals Online (AJOL)

We assessed the utility of body mass index (BMI), waist circumference (WC), and glycosylated haemoglobin (HbA1c) levels in metabolic control for type 2 diabetic patients. ... The apoB/apoA-I ratio was more correlated with postprandial TC/HDL and LDL-c/HDL-c ratios in men and with postprandial TG/HDL-c in women.

Pseudomonas fluorescens ATCC 13525 Containing an Artificial Oxalate Operon and Vitreoscilla Hemoglobin Secretes Oxalic Acid and Solubilizes Rock Phosphate in Acidic Alfisols

Science.gov (United States)

Archana, G.; Naresh Kumar, G.

2014-01-01

Oxalate secretion was achieved in Pseudomonas fluorescens ATCC 13525 by incorporation of genes encoding Aspergillus niger oxaloacetate acetyl hydrolase (oah), Fomitopsis plaustris oxalate transporter (FpOAR) and Vitreoscilla hemoglobin (vgb) in various combinations. Pf (pKCN2) transformant containing oah alone accumulated 19 mM oxalic acid intracellularly but secreted 1.2 mM. However, in the presence of an artificial oxalate operon containing oah and FpOAR genes in plasmid pKCN4, Pf (pKCN4) secreted 13.6 mM oxalate in the medium while 3.6 mM remained inside. This transformant solubilized 509 μM of phosphorus from rock phosphate in alfisol which is 4.5 fold higher than the Pf (pKCN2) transformant. Genomic integrants of P. fluorescens (Pf int1 and Pf int2) containing artificial oxalate operon (plac-FpOAR-oah) and artificial oxalate gene cluster (plac-FpOAR-oah, vgb, egfp) secreted 4.8 mM and 5.4 mM oxalic acid, released 329 μM and 351 μM P, respectively, in alfisol. The integrants showed enhanced root colonization, improved growth and increased P content of Vigna radiata plants. This study demonstrates oxalic acid secretion in P. fluorescens by incorporation of an artificial operon constituted of genes for oxalate synthesis and transport, which imparts mineral phosphate solubilizing ability to the organism leading to enhanced growth and P content of V. radiata in alfisol soil. PMID:24705024
Pseudomonas fluorescens ATCC 13525 containing an artificial oxalate operon and Vitreoscilla hemoglobin secretes oxalic acid and solubilizes rock phosphate in acidic alfisols.

Directory of Open Access Journals (Sweden)

Kavita Yadav

Full Text Available Oxalate secretion was achieved in Pseudomonas fluorescens ATCC 13525 by incorporation of genes encoding Aspergillus niger oxaloacetate acetyl hydrolase (oah, Fomitopsis plaustris oxalate transporter (FpOAR and Vitreoscilla hemoglobin (vgb in various combinations. Pf (pKCN2 transformant containing oah alone accumulated 19 mM oxalic acid intracellularly but secreted 1.2 mM. However, in the presence of an artificial oxalate operon containing oah and FpOAR genes in plasmid pKCN4, Pf (pKCN4 secreted 13.6 mM oxalate in the medium while 3.6 mM remained inside. This transformant solubilized 509 μM of phosphorus from rock phosphate in alfisol which is 4.5 fold higher than the Pf (pKCN2 transformant. Genomic integrants of P. fluorescens (Pf int1 and Pf int2 containing artificial oxalate operon (plac-FpOAR-oah and artificial oxalate gene cluster (plac-FpOAR-oah, vgb, egfp secreted 4.8 mM and 5.4 mM oxalic acid, released 329 μM and 351 μM P, respectively, in alfisol. The integrants showed enhanced root colonization, improved growth and increased P content of Vigna radiata plants. This study demonstrates oxalic acid secretion in P. fluorescens by incorporation of an artificial operon constituted of genes for oxalate synthesis and transport, which imparts mineral phosphate solubilizing ability to the organism leading to enhanced growth and P content of V. radiata in alfisol soil.
Haemoglobin modulates salicylate and jasmonate/ethylene-mediated resistance mechanisms against pathogens

DEFF Research Database (Denmark)

Mur, Luis A J; Sivakumaran, Anushen; Mandon, Julien

2012-01-01

Nitric oxide (NO) plays a role in defence against hemibiotrophic pathogens mediated by salicylate (SA) and also necrotrophic pathogens influenced by jasmonate/ethylene (JA/Et). This study examined how NO-oxidizing haemoglobins (Hb) encoded by GLB1, GLB2, and GLB3 in Arabidopsis could influence both...
Haemoglobin, anaemia, dementia and cognitive decline in the elderly, a systematic review

Directory of Open Access Journals (Sweden)

Poulter Ruth

2008-08-01

Full Text Available Abstract Background Anaemia may increase risk of dementia or cognitive decline. There is also evidence that high haemoglobin levels increase risk of stroke, and consequently possible cognitive impairment. The elderly are more at risk of developing dementia and are also more likely to suffer from anaemia, although there is relatively little longitudinal literature addressing this association. Methods To evaluate the evidence for any relationship between incident cognitive decline or dementia in the elderly and anaemia or haemoglobin level, we conducted a systematic review and meta-analyses of peer reviewed publications. Medline, Embase and PsychInfo were searched for English language publications between 1996 and 2006. Criteria for inclusion were longitudinal studies of subjects aged ≥65, with primary outcomes of incident dementia or cognitive decline. Other designs were excluded. Results Three papers were identified and only two were able to be combined into a meta-analysis. The pooled hazard ratio for these two studies was 1.94 (95 percent confidence intervals of 1.32–2.87 showing a significantly increased risk of incident dementia with anaemia. It was not possible to investigate the effect of higher levels of haemoglobin. Conclusion Anaemia is one factor to bear in mind when evaluating risk of incident dementia. However, there are few data available and the studies were methodologically varied so a cautionary note needs to be sounded and our primary recommendation is that further robust research be carried out.
Purification, crystallization, preliminary X-ray diffraction and molecular-replacement studies of great cormorant (Phalacrocorax carbo) haemoglobin

International Nuclear Information System (INIS)

Jagadeesan, G.; Malathy, P.; Gunasekaran, K.; Harikrishna Etti, S.; Aravindhan, S.

2014-01-01

The great cormorant hemoglobin has been isolated, purified and crystallized and the three dimensional structure is solved using molecular replacement technique. Haemoglobin is the iron-containing oxygen-transport metalloprotein that is present in the red blood cells of all vertebrates. In recent decades, there has been substantial interest in attempting to understand the structural basis and functional diversity of avian haemoglobins. Towards this end, purification, crystallization, preliminary X-ray diffraction and molecular-replacement studies have been carried out on cormorant (Phalacrocorax carbo) haemoglobin. Crystals were grown by the hanging-drop vapour-diffusion method using PEG 3350, NaCl and glycerol as precipitants. The crystals belonged to the trigonal system P3 1 21, with unit-cell parameters a = b = 55.64, c = 153.38 Å, β = 120.00°; a complete data set was collected to a resolution of 3.5 Å. Matthews coefficient analysis indicated that the crystals contained a half-tetramer in the asymmetric unit
Purification, crystallization, preliminary X-ray diffraction and molecular-replacement studies of great cormorant (Phalacrocorax carbo) haemoglobin

Energy Technology Data Exchange (ETDEWEB)

Jagadeesan, G. [Presidency College, Chennai 600 005 (India); Malathy, P.; Gunasekaran, K. [University of Madras, Chennai 600 025 (India); Harikrishna Etti, S. [GKM College of Engineering and Technology, Kamaraj Salai, Chennai 600 063 (India); Aravindhan, S., E-mail: aravindhanpresidency@gmail.com [Presidency College, Chennai 600 005 (India)

2014-10-25

The great cormorant hemoglobin has been isolated, purified and crystallized and the three dimensional structure is solved using molecular replacement technique. Haemoglobin is the iron-containing oxygen-transport metalloprotein that is present in the red blood cells of all vertebrates. In recent decades, there has been substantial interest in attempting to understand the structural basis and functional diversity of avian haemoglobins. Towards this end, purification, crystallization, preliminary X-ray diffraction and molecular-replacement studies have been carried out on cormorant (Phalacrocorax carbo) haemoglobin. Crystals were grown by the hanging-drop vapour-diffusion method using PEG 3350, NaCl and glycerol as precipitants. The crystals belonged to the trigonal system P3{sub 1}21, with unit-cell parameters a = b = 55.64, c = 153.38 Å, β = 120.00°; a complete data set was collected to a resolution of 3.5 Å. Matthews coefficient analysis indicated that the crystals contained a half-tetramer in the asymmetric unit.
Detection of haemoglobins with abnormal oxygen affinity by single blood gas analysis and 2,3-diphosphoglycerate measurement.

Science.gov (United States)

Guerrini, G; Morabito, A; Samaja, M

2000-10-01

The aim is to determine if a single measurement of blood 2,3-diphosphoglycerate combined with gas analysis (pH, PCO2, PO2 and saturation) can identify the cause of an altered blood-oxygen affinity: the presence of an abnormal haemoglobin or a red cell disorder. The population (n=94) was divided into healthy controls (A, n=14), carriers of red cell disorders (B, n=72) and carriers of high oxygen affinity haemoglobins (C, n=8). Those variables were measured both in samples equilibrated at selected PCO2 and PO2 and in venous blood. In the univariable approach applied to equilibrated samples, we correctly identified C subjects in 93.6% or 96.8% of the cases depending on the selected variable, the standard P50 (PO2 at which 50% of haemoglobin is oxygenated) or a composite variable calculated from the above measurements. After introducing the haemoglobin concentration as a further discriminating variable, the A and B subjects were correctly identified in 91.9% or 94.2% of the cases, respectively. These figures become 93.0% or 86.1%, and 93.7% or 94.9% of the cases when using direct readings from venous blood, thereby avoiding the blood equilibration step. This test is feasible also in blood samples stored at 4 degrees C for 48 h, or at room temperature for 8 h.
Cross-sectional relationship between haemoglobin concentration and measures of physical and cognitive function in an older rural South African population.

Science.gov (United States)

Payne, Collin F; Davies, Justine I; Gomez-Olive, F Xavier; Hands, Katherine J; Kahn, Kathleen; Kobayashi, Lindsay C; Tipping, Brent; Tollman, Stephen M; Wade, Alisha; Witham, Miles D

2018-04-21

Age cohort differences in haemoglobin concentrations and associations with physical and cognitive performance among populations of lower income and middle-income countries have not previously been described. We examined the association between these factors among older men and women in rural South Africa. We analysed cross-sectional data from a population-based study of rural South African men and women aged 40 and over (n=4499), with data drawn from questionnaire responses, a cognitive battery, objective physical function tests and blood tests. Anaemia was defined as a haemoglobin concentration age, grip strength, walk speed and a latent cognitive function z-score for men and women separately. We used unadjusted correlations and linear models to adjust for comorbidities and inflammation. In total, 1042 (43.0%) women and 833 (40.1%) men were anaemic. Haemoglobin concentrations were inversely correlated with age for men but not for women; in adjusted analyses, haemoglobin was 0.3 g/dL lower per decade older for men (95% CI 0.2 to 0.4 g/dL). In adjusted analyses, haemoglobin concentration was independently associated with grip strength in women (B=0.391, 95% CI 0.177 to 0.605), but this did not reach significance in men (B=0.266, 95% CI -0.019 to 0.552); no associations were observed between haemoglobin levels and walk speed or cognitive score. Anaemia was prevalent in this study population of middle-aged and older, rural South African adults, but in contrast to high-income countries, it was not associated with poor physical or cognitive function. Our findings need to be replicated in other populations. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Effect of Vitamin C and Tablets Fe on Haemoglobin Levels Against Pregnant Women

Directory of Open Access Journals (Sweden)

Susilo Wirawan

2016-01-01

Full Text Available Background: Iron deficiency anaemia is the most common nutritional problem of pregnant women in Indonesia. The existing program/intervention has been implemented namely supplementation of iron pills for mothers at the third semester of pregnancy. This study aims to compare the effect of single and multiple micronutrients supplementation of iron and iron plus vitamin C. Methods: Type of the study is study experimental with the design of community intervention, implementing pre and post trials. Subjects were pregnant women at the second semester of pregnancy. Haemoglobin level was examinedby Cyanmet hemoglobin. Data analysis was done through independent and paired t-test. Results: showed that there were statistically signifi cant difference between the intervention and control group (p = 0.001. The haemoglobin level of the intervention group increased by 0.91 grm%, while the control group was 0.43 grm%. The proportion of anaemia amongpregnant mothers declined after intervention from 80.95 to 42.86 at the intervention group. Similarly, the proportion of anaemia of the control group reduced from 80.95% to 71.43% after the intervention. Conclusion: intervention with multiple micronutrients of Fe combined with vitamin C has more effect in changing the haemoglobin levels of pregnant mothers.Recommendation: Fe tablet administration should still be accompanied by vitamin C to help boost hemoglobin levels. Required for controlled administration of iron tablet, along with vitamin C so that the effect can be seen.
The effect of 2,3-diphosphoglycerate on the oxygen dissociation curve of human haemoglobin.

Science.gov (United States)

Goodford, P J; Norrington, F E; Paterson, R A; Wootton, R

1977-01-01

1. Oxygen dissociation curves for concentrated human haemoglobin solutions (1.6 mmol dm-3 in haem) have been measured by mixing known quantities of oxy- and deoxyhaemoglobin solutions and measuring the resulting partial pressure of oxygen with an oxygen electrode. 2. Observations in the presence of 2,3-diphosphoglycerate support previous conclusions derived from experiments at low haemoglobin concentrations, the validity of which has been questioned. 3. The two affinity state model of Monod, Wyman & Changeux (1965) does not fully describe the actions of 2,3-diphosphoglycerate and a model in which this allosteric effector not only binds preferentially to the T state but also lowers the oxygen affinity of this state gives an improved fit to the data. PMID:604451
Aspirin-mediated acetylation of haemoglobin increases in presence of high glucose concentration and decreases protein glycation

Directory of Open Access Journals (Sweden)

Francesco Finamore

2015-09-01

Full Text Available Glycation represents the first stage in the development of diabetic complications. Aspirin was shown to prevent sugars reacting with proteins, but the exact mechanism of this interaction was not well defined. We performed a quantitative analysis to calculate the levels of acetylation and glycation of haemoglobin, among others red blood cell (RBC proteins, using a label free approach. After glucose incubation, increases in the acetylation levels were seen for several haemoglobin subunits, while a parallel decrease of their glycation levels was observed after aspirin incubation. These results suggest that, a mutual influence between these two modifications, occur at protein level.
Reliability and validity of non-invasive determined haemoglobin mass and blood volumes

DEFF Research Database (Denmark)

Fagoni, Nazzareno; Andersen, Andreas Breenfeldt; Oberholzer, Laura

2018-01-01

INTRODUCTION: The carbon monoxide (CO) rebreathing method used for the determination of haemoglobin mass (Hbmass ) is associated with blood sample analysis (in this study: Radiometer ABL800). As an alternative hereto the aim of the present study was to evaluate the use of a portable and non-invas...
Purification, crystallization and preliminary crystallographic studies of haemoglobin from mongoose (Helogale parvula) in two different crystal forms induced by pH variation.

Science.gov (United States)

Mohamed Abubakkar, M; Saraboji, K; Ponnuswamy, M N

2013-02-01

Haemoglobin (Hb) is a respiratory pigment; it is a tetrameric protein that ferries oxygen from the lungs to tissues and transports carbon dioxide on the return journey. The oxygen affinity of haemoglobin is regulated by the concentration of oxygen surrounding it and several efforts have revealed the shapes of Hb in different states and with different functions. However, study of the molecular basis of Hbs from low-oxygen-affinity species is critically needed in order to increase the understanding of the mechanism behind oxygen adaptation. The present study reports the preliminary crystallographic study of low-oxygen-affinity haemoglobin from mongoose, a burrowing mammal. Haemoglobin from mongoose was purified by anion-exchange chromatography, crystallized using the hanging-drop vapour-diffusion method and diffraction data sets were collected from monoclinic (2.3 Å resolution) and orthorhombic (2.9 Å resolution) crystal forms obtained by pH variation. The monoclinic and orthorhombic asymmetric units contained half and a whole biological molecule, respectively.
Purification, crystallization and preliminary X-ray diffraction studies of parakeet (Psittacula krameri) haemoglobin.

Science.gov (United States)

Jaimohan, S M; Naresh, M D; Arumugam, V; Mandal, A B

2009-10-01

Birds often show efficient oxygen management in order to meet the special demands of their metabolism. However, the structural studies of avian haemoglobins (Hbs) are inadequate for complete understanding of the mechanism involved. Towards this end, purification, crystallization and preliminary X-ray diffraction studies have been carried out for parakeet Hb. Parakeet Hb was crystallized as the met form in low-salt buffered conditions after extracting haemoglobin from crude blood by microcentrifugation and purifying the sample by column chromatography. Good-quality crystals were grown from 10% PEG 3350 and a crystal diffracted to about 2.8 A resolution. Preliminary diffraction data showed that the Hb crystal belonged to the monoclinic system (space group C2), with unit-cell parameters a = 110.68, b = 64.27, c = 56.40 A, beta = 109.35 degrees . Matthews volume analysis indicated that the crystals contained a half-tetramer in the asymmetric unit.
The impact of prematurity on fetal haemoglobin and how it can bias measurement of glycated haemoglobin

DEFF Research Database (Denmark)

Zachariassen, Gitte; Esberg, Gitte; Grytter, Carl

Background: The extent to which fetal hemoglobin (HbF) concentrations are increased in premature infants at the age of six to eight months is only sporadically described. The influence of HbF on measurement of glycated haemoglobin (HbA1c) has not been investigated in this population. Methods......: As part of a nutritional study on premature children, HbF and HbA1c were measured in 46 premature infants at the age of six to eight months. Results: Median HbF percentage was 10.3% (range 2.0 to 39.2%). In a multiple regression model only birth weight (P = 0.002) and post-conceptional age (P ... significantly from unadjusted values (4.4±0.4%), (P premature infants at six to eight months of age. The clinical implication of this work is a renewed attention on the prolonged Hb...
Different functional modulation by heterotropic ligands (2,3-diphosphoglycerate and chlorides) of the two haemoglobins from fallow-deer (Dama dama).

Science.gov (United States)

Angeletti, M; Pucciarelli, S; Priori, A M; Canofeni, S; Barra, D; Fioretti, E; Coletta, M

2001-02-01

Two haemoglobin components have been identified and purified from fallow-deer (Dama dama) erythrocytes. They are present in similar amounts and the two tetrameric molecules share the same alpha chain, while two different beta chains are detected in the two components. The beta chains differ by 14 residues, even though they both have 145 amino-acid residues, which account for a molecular mass of 16,023 and 16,064 Da, respectively, while alpha chain has 141 residues, yielding a molecular mass of 15,142 Da. Compared with human Hb, the N-terminal region of both beta chains shows deletion of Val beta 1 and the replacement of His beta 2 by a methionyl residue, a modification which is common to most ruminant haemoglobins. Although both isolated components show a low intrinsic affinity for oxygen, meaningful differences between the two haemoglobins have been found with respect to the effect of heterotropic effectors, such as 2,3-diphosphoglycerate and chloride ions. In view of the high sequence homology between the two components, the different effect of heterotropic ligands has been tentatively correlated to possible localized structural variations between beta chains of the two haemoglobin components.
Effects of a diphenyl-ether herbicide, oxyfluorfen, on human BFU-E/CFU-E development and haemoglobin synthesis.

Science.gov (United States)

Rio, B; Parent-Massin, D; Lautraite, S; Hoellinger, H

1997-02-01

The diphenyl-ether herbicides exert their phytotoxic activity by preventing chlorophyll formation in plants as a result of inhibition of protoporphyrinogen oxidase. This enzyme is the last step of the common pathway for chlorophyll and haem biosynthesis. The aim of this work is to determine whether herbicide inhibitors of plant protoporphyrinogen oxidase could act on the human protoporphyrinogen oxidase involved in haemoglobin synthesis and cause heamatologic diseases. Human erythroblastic progenitors (BFU-E/CFU-E: Burst Forming Unit-Erythroid and Colony Forming Unit-Erythroid) were exposed to oxyfluorfen, a diphenyl-ether herbicide in the presence of erythropoietin, and the haematoxicity evaluated in vitro by scoring the development of BFU-E/CFU-E colonies after 7 and 14 days of culture. The toxic effect on differentiation has been evaluated using four criteria: morphology, total protein, total porphyrin, and haemoglobin content. The study of BFU-E/CFU-E proliferation and differentiation showed a cytotoxic effect of oxyfluorfen only at very high concentrations. In contrast, haemoglobin synthesis can be inhibited by concentration of oxyfluorfen (10(-4) M) that have no adverse effect on cellular proliferation.
Expresión y purificación del preS1/2 del virus de la hepatitis B (VHB y su utilidad en el diagnóstico de la infección

Directory of Open Access Journals (Sweden)

Yismelvy Marquez

2013-12-01

Full Text Available La hepatitis B es una enfermedad inflamatoria del tejido hepático causada por la infección crónica del virus de la hepatitis B (VHB. Su diagnostico se basa en la detección de anticuerpos y antígenos contra dos de sus principales proteínas inmunogenicas, el antígeno de superficie (HBsAg y el del core (HBcAg. Existen otros dos componentes de la envoltura altamente inmunogenicos el preS1/2, sin embargo su papel en la evaluación de la respuesta serológica aún no ha sido evaluado. Es por ello que en este trabajo se propone expresar y purificar el preS1/2 usando a la Escherichia coli como sistema de expresión por ser el menos costoso a fin de obtener una proteína con propiedades antigénicas adecuadas para su utilización en el diagnostico serológico y evaluación de la respuesta inmune. El preS1/2 previamente clonado en el vector pET3d-preS1/2 se utilizó para transformar a la cepa de Escherichia coli (HMS174 y después de inducir la síntesis proteica mediante el uso de IPTG, se purifico mediante columna de afinidad al níquel, posteriormente analizadas en gel de electroforesis poliacrilamida, para seleccionar las fracciones de preS1/2. Después de dializarlas y liofilizarlas se logró obtener 5,4 mg/ml de la proteína pura, confirmado mediante la realización del western blott con un anticuerpo monoclonal específico. Estos resultados indican que este método es fácil, poco costoso y rápido para obtener una proteína pura con potencial uso en el diagnostico serológico de la infección por VHB.
Structural studies of haemoglobin from pisces species shortfin mako shark (Isurus oxyrinchus) at 1.9 Å resolution

Energy Technology Data Exchange (ETDEWEB)

Ramesh, Pandian, E-mail: prms23@gmail.com [Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, Suwon 440-746 (Korea, Republic of); University of Madras, Maraimalai Campus (Guindy), Chennai 600 025 (India); Sundaresan, S. S.; Sathya Moorthy, Pon.; Balasubramanian, M.; Ponnuswamy, M. N. [University of Madras, Maraimalai Campus (Guindy), Chennai 600 025 (India)

2013-11-01

Shortfin mako shark haemoglobin adopts an unliganded deoxy T state conformation, which is shown from the quaternary structural features, interface interactions and heme binding sites of different subunits of haemoglobin with high-resolution X-ray data. Haemoglobin (Hb) is a tetrameric iron-containing protein that carries oxygen from the lungs to tissues and carbon dioxide from tissues back to the lungs. Pisces are the advanced aquatic vertebrates capable of surviving at wide depth ranges. The shortfin mako shark (SMS) is the pelagic, largest, fastest and most sophisticated species of the shark kingdom with well developed eyes. Mostly the pisces species are cold blooded in nature. Distinctly, the SMSs are warm-blooded animals with an advanced circulatory system. SMSs are capable of maintaining elevated muscle temperatures up to 33 K above the ambient water temperatures at a depth of 150–500 m. SMSs have a diverged air-breathing mechanism compared with other vertebrates. The haemoglobin molecule consists of four polypeptide chains, namely two α chains, each with 140 amino acids and two β chains each having 136 amino acids. The SMS Hb was found to crystallize in monoclinic space group P2{sub 1} using the hanging-drop vapour-diffusion method at room temperature. The crystal packing parameters for the SMS Hb structure contain one whole biological molecule in the asymmetric unit with a solvent content of 47%. The SMS Hb quaternary structural features interface–interface interactions and heme binding sites are discussed with different state Hbs and the results reveal that SMS Hb adopts an unliganded deoxy T state conformation.
Structural studies of haemoglobin from pisces species shortfin mako shark (Isurus oxyrinchus) at 1.9 Å resolution

International Nuclear Information System (INIS)

Ramesh, Pandian; Sundaresan, S. S.; Sathya Moorthy, Pon.; Balasubramanian, M.; Ponnuswamy, M. N.

2013-01-01

Shortfin mako shark haemoglobin adopts an unliganded deoxy T state conformation, which is shown from the quaternary structural features, interface interactions and heme binding sites of different subunits of haemoglobin with high-resolution X-ray data. Haemoglobin (Hb) is a tetrameric iron-containing protein that carries oxygen from the lungs to tissues and carbon dioxide from tissues back to the lungs. Pisces are the advanced aquatic vertebrates capable of surviving at wide depth ranges. The shortfin mako shark (SMS) is the pelagic, largest, fastest and most sophisticated species of the shark kingdom with well developed eyes. Mostly the pisces species are cold blooded in nature. Distinctly, the SMSs are warm-blooded animals with an advanced circulatory system. SMSs are capable of maintaining elevated muscle temperatures up to 33 K above the ambient water temperatures at a depth of 150–500 m. SMSs have a diverged air-breathing mechanism compared with other vertebrates. The haemoglobin molecule consists of four polypeptide chains, namely two α chains, each with 140 amino acids and two β chains each having 136 amino acids. The SMS Hb was found to crystallize in monoclinic space group P2 1 using the hanging-drop vapour-diffusion method at room temperature. The crystal packing parameters for the SMS Hb structure contain one whole biological molecule in the asymmetric unit with a solvent content of 47%. The SMS Hb quaternary structural features interface–interface interactions and heme binding sites are discussed with different state Hbs and the results reveal that SMS Hb adopts an unliganded deoxy T state conformation

IMPACT OF HAEMOGLOBIN LEVELS ON OUTCOMES IN ACUTE CORONARY SYNDROME

Directory of Open Access Journals (Sweden)

Shrirang Kishor Bhurchandi

2017-07-01

Full Text Available BACKGROUND It is observed that anaemia is a common problem in patients hospitalised for acute coronary syndromes. There have been reports in worldwide studies of an association between anaemia and poor prognosis in patients with Acute Coronary Syndromes (ACS. MATERIALS AND METHODS All consecutive patients having ST-elevation myocardial infarction, non-ST elevation myocardial infarction and unstable angina who were admitted in medicine ward, Medicine Intensive Care Unit (MICU, Cardiology Department (CRD, Cardiovascular and Thoracic Surgery (CVTS Department and incidentally found in other departments of Acharya Vinoba Bhave Rural Hospital admitted from 1st November 2014 to 31st December 2015 at AVBRH. Total 200 patients were included in the study. RESULTS Our study showed an association between haemoglobin levels and mean age (p=0.0001, gender (p=0.0001, risk factors like smoking (p=0.035, tobacco (p=0.001 and Killip’s class I (p=0.0001, III (p=0.0001 and IV (p=0.0001. On distribution of the MACE’s during hospital stay stratified with Hb levels, the results of analysis by Chi-square test showed that there were statistically significant differences at various haemoglobin levels in MACE’s as post-infarction angina, heart failure, VT/VF and death (p<0.05 for all. On distribution of the MACE’s during follow up on 30th day and on 180th day stratified with Hb levels, the results of analysis by Chi-square test showed that there were statistically significant differences at various haemoglobin levels in MACE’s as post-infarction angina, re-infarction, heart failure, VT/VF and death (p<0.05 for all. CONCLUSION To conclude our study results, it was found during the study that anaemia as an important risk factor was strongly associated with major adverse outcomes in patients with ACS. Our study suggested that there was a statistically significant correlation between the low Hb levels and MACE’s (post-infarction angina, re-infarction, heart
Effects of Rambutan Peel Extract to The Number of Erythrocytes and Haemoglobin in Rats Exposed to Cigarette Smoke

Science.gov (United States)

Lisdiana; Dewi, F. K.

2017-04-01

Cigarette smoke is one of the exogenous free radicals sources. When it is inhaled, its activity may damage the structure of erythrocyte membrane function. The impacts of free radicals can be reduced through the provision of antioxidants. Rambutan fruit peel contains the phenolic compound in the form of polyphenols that are antioxidants. The purpose of this study is to determine the effect of rambutan fruit peel extracts to the number of erythrocytes and haemoglobin in rats exposed to cigarette smoke. This design used Post Test Control Group Design. A sample of 25 rats was divided into five groups, each group consisting of 5 rats. The positive control group (K+) were given a standard food and drinking water. The negative control group (K) by three cigarettes, the treatment group (KP1, KP2, KP3) by three cigarettes and skin extract of rambutan each treatment group with a dose 15 mg/kg, 30 mg/kg and 45 mg/kg for 30 days. Data on the number of erythrocytes and haemoglobin in rat blood was analysed with LSD and to determine the optimum dosage was analysed by using regression test. Research results shown that the content of rambutan fruit peel extract may increase the number of erythrocytes and haemoglobin of blood. Conclusions from this research are the rambutan fruit peel extract at a dose of 45 mg/kg body weight can increase and maintain the number of erythrocytes and haemoglobin in the blood of rat exposed to cigarette smoke.
Behaviour of perioperative values of haemoglobin, haematocrit and red blood cells in elderly patients undergoing lower limb arthroplasty: a retrospective cohort study on non-transfused patients.

Science.gov (United States)

Drago, L; De Vecchi, E; Romano', C L; Vassena, C; Banfi, G

2013-01-01

Little is known on how elderly patients recover pre-operative haemoglobin, haematocrit and red blood cell levels after total hip and knee arthroplasties. In this study we aimed to evaluate blood loss and recovery blood levels in relation to gender, type of surgery and preoperative haemoglobin values. We conducted a retrospective cohort study on 187 patients over 65 years of age who underwent total knee or total hip arthroplasty between January 2008 and December 2009. Preoperative blood analysis was carried out within 40 days prior to intervention followed by a 15-day postoperative follow-up. Haemoglobin recovery values in anaemic patients versus healthy patients was also estimated. All tested values decreased significantly during the first 3-5 postoperative days. Haemoglobin levels decreased statistically significantly more in males than in females, while no significant differences were observed for haematocrit and erythrocytes. Recovery of haemoglobin values did not differ significantly between healthy patients and patients with preoperative haemoglobin below 120 g/L. Furthermore, our data showed a higher blood loss in total hip arthroplasty, whilst recovery rates showed to be higher after a total knee arthroplasty procedure. In conclusion, the type of intervention and gender played an important role in blood loss and recovery rates in total joint arthroplasty.
Low resolution solution structure of the Apo form of Escherichia coli haemoglobin protease Hbp.

NARCIS (Netherlands)

scott, D.J.; Grossman, J.G.; Tame, J.R.H.; Byron, O.; Wilson, K.S.; Otto, B.R.

2002-01-01

We have studied the solution properties of the apo form of the haemoglobin protease or "haemoglobinase", Hbp, a principal component of an important iron acquisition system in pathogenic Escherichia coli. Experimental determination of secondary structure content from circular dichroism (CD)
Common antigenic determinants of haemoglobin as basis of immunological cross-reactivity between chironomid species (Diptera, Chironomidae): studies with human and animal sera.

Science.gov (United States)

Baur, X; Dewair, M; Haegele, K; Prelicz, H; Scholl, A; Tichy, H

1983-01-01

Chironomids, of which approximately 10,000 species exist, are reported to cause severe immediate type allergic diseases in man. In the present study, immunological cross-reactivity between 14 chironomid species from different continents was proven by RAST inhibition, double immunodiffusion and a new allergoprint technique, based upon PAGE separation of insect crude extracts. Using isolated chironomid haemoglobins and sera of sensitized persons, as well as rabbit antibodies against larval crude extract or against the haemoglobin fraction of Chironomus thummi, it could be proven that cross-reactivity derives at least predominantly from haemoglobin components with common antigenic determinants in the different species. Images Fig. 2 Fig. 7 Fig. 8 Fig. 9 PMID:6197219
Prevalencia de hepatitis B y C en donadores de sangre en un hospital de tercer nivel de la ciudad de México

Directory of Open Access Journals (Sweden)

Méndez-Sánchez Nahum

1999-01-01

Full Text Available OBJETIVO: Determinar la prevalencia del virus de la hepatitis C (VHC y de la B (VHB en donadores que acudieron al Banco de Sangre del hospital Médica Sur. MATERIAL Y MÉTODOS: Se incluyeron en el estudio 9 099 donadores, registrados entre 1994 y 1998. Se les aplicó un cuestionario y se determinó VHC y VHB. Se obtuvieron porcentajes y se analizaron los resultados por medio de la prueba ji². RESULTADOS: La prevalencia de portadores de VHC y VHB fue de 0.47 y 0.11%, respectivamente. Los factores de riesgo más importantes para VHC y VHB fueron los procedimientos dentales (11.6% y (20%; respectivamente; y 20% por prácticas sexuales riesgosas como factor de riesgo para VHB. CONCLUSIONES: Los resultados sugieren una baja prevalencia de la infección por VHC y VHB en la población estudiada.
Randomised feasibility study of a more liberal haemoglobin trigger for red blood cell transfusion compared to standard practice in anaemic cancer patients treated with chemotherapy

DEFF Research Database (Denmark)

Yakymenko, D.; Frandsen, K. B.; Christensen, I. J.

2017-01-01

Objectives: The primary objective of this feasibility study was to identify quality of life (QoL) scores and symptom scales as tools for measuring patient-reported outcomes (PRO) associated with haemoglobin level in chemotherapy-treated cancer patients. Secondary objectives included comparing QoL......-An, FACT-An TOI, fatigue and dyspnoea. Conclusions: QoL scores of physical and functional domains as well as self-reported anaemia-related symptoms correlated well with haemoglobin level in chemotherapy-treated cancer patients.......Objectives: The primary objective of this feasibility study was to identify quality of life (QoL) scores and symptom scales as tools for measuring patient-reported outcomes (PRO) associated with haemoglobin level in chemotherapy-treated cancer patients. Secondary objectives included comparing Qo......L and symptoms between randomisation arms. Background: Anaemia in cancer patients undergoing chemotherapy is associated with decreased QoL. One treatment option is red blood cell transfusion (RBCT). However, the optimal haemoglobin trigger for transfusion is unknown. Methods: Patients were randomised...
Pathophysiological effects and changes in potassium, ionised calcium, glucose and haemoglobin early after severe blunt chest trauma.

Science.gov (United States)

Rocksén, David; Gryth, Dan; Druid, Henrik; Gustavsson, Jenny; Arborelius, Ulf P

2012-05-01

Severe lung contusion is often observed after blunt chest trauma due to traffic accidents or fall from heights, but may also occur after a non-penetrating ballistic impact against body armour. Such trauma has been designated behind armour blunt trauma (BABT). Our aim in the present study has been to evaluate pathophysiological changes and compensatory mechanisms that occur early after such severe lung contusion. Twelve pigs wearing body armour were shot with a 7.62mm assault rifle to produce a standardised pulmonary contusion. Exposed animals were compared with five control animals shot with blank ammunition. Physiological parameters and levels of potassium, glucose, haemoglobin, calcium, lactate and pH were monitored for two hours after the shot. The impact induced severe pulmonary contusion with apnoea, desaturation and hypotension in all exposed animals. Increased haemoglobin, glucose and severe hyperkalaemia were seen shortly after impact. Seven of twelve animals died due to the trauma. Dense cardiac tissue was observed during post mortem examination in six of the animals that died during the experimental course. In conclusion, this study has shown that life-threatening hyperkalaemia occurs early after severe lung contusion. Moreover, dense cardiac tissue and early increase of haemoglobin and glucose are intriguing findings that should be investigated in future studies. Copyright © 2010 Elsevier Ltd. All rights reserved.
High activity antioxidant enzymes protect flying-fox haemoglobin against damage: an evolutionary adaptation for flight?

Science.gov (United States)

Reinke, N B; O'Brien, G M

2006-11-01

Flying-foxes are better able to defend haemoglobin against autoxidation than non-volant mammals such as sheep. When challenged with the common physiological oxidant, hydrogen peroxide, haemolysates of flying-fox red blood cells (RBC) were far less susceptible to methaemoglobin formation than sheep. Challenge with 1-acetyl-2-phenylhydrazine (APH) caused only half as much methaemoglobin formation in flying-fox as in ovine haemolysates. When intact cells were challenged with phenazine methosulfate (PMS), flying-fox RBC partially reversed the oxidant damage, and reduced methaemoglobin from 40 to 20% over 2 h incubation, while ovine methaemoglobin remained at 40%. This reflected flying-fox cells' capacity to replenish GSH fast enough that it did not deplete beyond 50%, while ovine RBC GSH was depleted to around 20%. The greater capacity of flying-foxes to defend haemoglobin against oxidant damage may be explained in part by antioxidant enzymes catalase, superoxide dismutase and cytochrome-b ( 5 ) reductase having two- to four-fold higher activity than in sheep (P foxes.
Self-care activities and glycated haemoglobin in Iranian patients with type 2 diabetes: can coping styles and social support have a buffering role?

Science.gov (United States)

Shayeghian, Zeinab; Aguilar-Vafaie, Maria E; Besharat, Mohammad Ali; Amiri, Parisa; Parvin, Mahmoud; Gillani, Kobra Roohi; Hassanabadi, Hamidreza

2015-01-01

Diabetes self-care is a key element in the overall management of diabetes. However, the importance of psychosocial factors for successful disease management is under investigated. This study aimed at exploring the role of coping styles and social support in the relationship between self-care activities and glycated haemoglobin in patients with type 2 diabetes. One hundred adults (60% female, aged 40-70 years) with type 2 diabetes completed questionnaires assessing self-care activities, coping styles and social support. In addition, a blood test was performed to obtain glycated haemoglobin levels. Result showed significant relationships of glycated haemoglobin with self-care activities, coping styles and social support. Regression analysis indicated that social support had a moderating role on the relationship between self-care activities and glycated haemoglobin, such that, at very high levels of social support the association, between Self-Care and HbA1c disappears. Findings indicate that health care providers, within the context of the Iranian social and cultural situation, should pay more attention to psychosocial factors when addressing self-care activities. Delineation of the role of coping styles and social support might be useful for identifying patients in need of particular counselling and support for improving self-care activities and HbA1c levels.
The Effect of Date (Phoenix dactylifera Juice on Haemoglobin Level An Experimental Study in Iron Supplemented Rats

Directory of Open Access Journals (Sweden)

Ady Try Himawan Zen

2013-06-01

Full Text Available There has been more research on the iron supplementation. Date juice has been shown to be rich in iron. It has been reported to increase the hemoglobin level in rats. Few studies has been conducted on the effect of date juice on the hemoglobin level in male white Wistar rats fed low iron diet.This research was conducted to evaluate the effect of (Phoenix dactylifera juice on haemoglobin level in iron supplemented rats. In this experimental study using post test control group design, 24 male white Wistar rats were divided into 4 groups. G-I served as the control group (standard diet and aquadest. G II was given the low Fe diet and aquadest for 21 d. G-III,IV were given the low fe diet and aquadest plus date juice at the concentration of 50%, 100% respectively. The treatment was given for 14 days. Spectrophotometer was used to assess the haemoglobin level of rats. One way anova followed by Post Hoc LSD was applied for the data analysis. Mean of hemoglobin (g/dl level for the four groups were 12,03, 7.72, 9.25, 10.35 respectively. Test resulted in p<0.05. Post Hoc LSD test resulted in a significant different between K-I and G-II, G-III, G-IV ;G-II and G-III, G-IV ;G-III and G-IV. In conclusion, date juice increases the haemoglobin level in male white rats fed on the low fe diet.
Impact of nutrition education on knowledge and haemoglobin status of hill women in Uttarakhand State of India.

Science.gov (United States)

Upadhyay, S; Kumar, A R; Raghuvanshi, R S; Singh, B B

2011-12-01

This study aimed to examine the impact of the use of single vs. combination of media on nutritional knowledge and haemoglobin status of women in a rural hill area in Uttarakhand State, India. Women from three villages were selected randomly and divided into three groups namely, print media group (n = 59), multimedia group (n = 53) and control group (n = 111). The print media group was exposed to nutrition education through the use of calendars on anaemia for 60 days; the multimedia group was given nutrition education through a combination of media including calendars, video films, and group discussions for 60 days. At pre-exposure stage, 62.7% of the women in the print media group, 67.9% of the multimedia group, and 66.7% of the control group had a low nutrition knowledge level. After exposure, the print media group and the multimedia group showed a significant rise in nutrition knowledge, with the multimedia group scoring significantly higher than the print media group. Overall, 69.1% of the women were anaemic with mean haemoglobin concentration of 10.74 +/- 0.86 g/dl. A non-significant rise in mean haemoglobin concentrations in the experimental groups was found at post-exposure stage. Calendars and video films are effective in increasing nutrition knowledge of illiterate hill women. Use of mass media programmes of longer duration should be encouraged to combat the nutritional problems of rural communities.
The effect on haemoglobin of the use of iron cooking pots in rural Malawian households in an area with high malaria prevalence: a randomized trial.

Science.gov (United States)

Geerligs, Paul Prinsen; Brabin, Bernard; Mkumbwa, Albert; Broadhead, Robin; Cuevas, Luis E

2003-04-01

Innovative low-cost sustainable strategies are required to reduce the high prevalence of iron-deficiency anaemia in developing countries. We undertook a community-based randomized controlled intervention trial to assess the effects of cooking in iron or aluminium cooking pots in Malawian households in an area with high malaria prevalence. Analysis was by intention to treat and consistency of use. The primary outcomes were change in haemoglobin and iron status. The study population comprised 164 participants eating from aluminium cooking pots and 158 from iron cooking pots. The mean haemoglobin change was significantly increased after 6 weeks in adults who consistently ate from an iron cooking pot (+3.6 g/l compared to -3.2 g/l, mean difference between groups 6.8 g/l, 95% CI +0.86, +12.74). In children, no significant haemoglobin change was observed in consistent pot users, although they showed a significant reduction in iron deficiency (iron 8.6 ZP/g and aluminium 10.8 ZP/g, mean difference 2.2 ZP/g, 95% CI +1.08, +3.32). Rural Malawian adults in a high malaria transmission area who consistently consume food prepared in iron cooking pots show a significant rise in haemoglobin after 6 weeks use. Children showed a reduction in iron deficiency, but no significant improvement in haemoglobin, possibly because of their high malaria parasite prevalence. Using iron cooking pots in developing countries could provide an innovative way to prevent iron deficiency and anaemia in malarious areas where regular iron supplementation is problematic.
Glycated haemoglobin may in future be reported as estimated mean blood glucose concentration--secondary publication

DEFF Research Database (Denmark)

Borg, R.; Nerup, J.; Nathan, D.M.

2009-01-01

Glycated haemoglobin (HbA 1c ) is widely used to determine levels of chronic glycaemia, to judge the adequacy of diabetes treatment and to adjust therapy. HbA 1c results are expressed as the percentage of HbA that is glycated. Day-to-day management is guided by self-monitoring of capillary glucose...
Soluble haemoglobin is a marker of recent Plasmodium falciparum infections

DEFF Research Database (Denmark)

Jakobsen, P H; Bygbjerg, I C; Theander, T G

1997-01-01

Monoclonal antibodies (Mab) were raised against haemoglobin (Hb) associated with Plasmodium falciparum protein and used to develop an ELISA, measuring circulating levels of released Hb. This assay was evaluated in different malaria patients in parallel with ELISA assays for C-reactive protein (CR...... after treatment. Soluble Hb levels were associated with malariometric parameters in a similar fashion to haptoglobin. The new Mab-based assay for measuring soluble Hb in the peripheral blood of malaria patients may be useful for future epidemiological studies of malaria....
Nutrient Patterns Associated with Fasting Glucose and Glycated Haemoglobin Levels in a Black South African Population

NARCIS (Netherlands)

Chikowore, T.; Pisa, P.T.; Zyl, van Tertia; Feskens, E.J.M.; Wentzel-Viljoen, E.; Conradie, K.R.

2017-01-01

Type 2 diabetes (T2D) burden is increasing globally. However, evidence regarding nutrient patterns associated with the biomarkers of T2D is limited. This study set out to determine the nutrient patterns associated with fasting glucose and glycated haemoglobin the biomarkers of T2D. Factor analysis
Limited influence of haemoglobin variants on Plasmodium falciparum msp1 and msp2 alleles in symptomatic malaria

NARCIS (Netherlands)

Mockenhaupt, Frank P.; Ehrhardt, Stephan; Otchwemah, Rowland; Eggelte, Teunis A.; Anemana, Sylvester D.; Stark, Klaus; Bienzle, Ulrich; Kohne, Elisabeth

2004-01-01

Haemoglobin (Hb) S, HbC, and alpha(+)-thalassaemia confer protection from malaria. Accordingly, these traits may influence the multiplicity of infection (MOI) of Plasmodium falciparum and the presence of distinct parasite genotypes. In 840 febrile children in northern Ghana, we typed the P.
Ethylene, nitric oxide and haemoglobins in plant tolerance to flooding

DEFF Research Database (Denmark)

Mur, Luis A J; Gupta, Kapuganti J; Chakraborty, U

2015-01-01

-tolerant species Rumex palustris and the model plant Arabidopsis thaliana have been extensively exploited to reveal some key molecular events. Our groups have recently demonstrated that nitric oxide (NO) triggers the biosynthesis of ethylene during stress and that NO plays key roles in PCD and the hyponastic......As much as 12% of the world's soils may suffer excess water so that flooding is a major limiting factor on crop production in many areas. Plants attempt to deal with submergence by forming root aerenchyma to facilitate oxygen diffusion from the shoot to the root, initiating a hyponastic response....... This chapter will detail our understanding of the roles of ethylene, NO and haemoglobin in flooding stress....
Effects of prolonged compression on the variations of haemoglobin oxygenation-assessment by spectral analysis of reflectance spectrophotometry signals

International Nuclear Information System (INIS)

Li, Zengyong; Tam, Eric W C; Mak, Arthur F T; Lau, Roy Y C

2006-01-01

The consequences of rhythmical flow motion for nutrition and the oxygen supply to tissue are largely unknown. In this study, the periodic variations of haemoglobin oxygenation in compressed and uncompressed skin were evaluated with a reflection spectrometer using an in vivo Sprague-Dawley rat model. Skin compression was induced over the trochanter area by a locally applied external pressure of 13.3 kPa (100 mmHg) via a specifically designed pneumatic indentor. A total of 19 rats were used in this study. The loading duration is 6 h per day for four consecutive days. Haemoglobin oxygenation variations were quantified using spectral analysis based on wavelets' transformation. The results found that in both compressed and uncompressed skin, periodic variations of the haemoglobin oxygenation were characterized by two frequencies in the range of 0.01-0.05 Hz and 0.15-0.4 Hz. These frequency ranges coincide with those of the frequency range of the endothelial-related metabolic and myogenic activities found in the flow motion respectively. Tissue compression following the above loading schedule induced a significant decrease in the spectral amplitudes of frequency interval 0.01-0.05 Hz during the pre-occlusion period on day 3 and day 4 as compared to that on day 1 (p 2 consumption rates of arteriolar walls. The modification of vessel wall oxygen consumption might substantially affect the available oxygen supply to the compressed tissue. This mechanism might be involved in the process leading to pressure ulcer formation
Malaria and gravidity interact to modify maternal haemoglobin concentrations during pregnancy

Directory of Open Access Journals (Sweden)

Ouédraogo Smaïla

2012-10-01

Full Text Available Abstract Background Primigravidity is one of the main risk factors for both malaria and anaemia. Since the implementation of intermittent preventive treatment (IPTp in sub-Saharan Africa, the relationship between anaemia and gravidity and its evolution during pregnancy has been little explored. This study aimed to evaluate the impact of gravidity on the variation of haemoglobin during pregnancy according to the timing of gestation. Methods Data from three studies carried out in nearby areas in south Benin (Ouidah, Comé, Allada between 2005 and 2012 were analysed. At inclusion (first antenatal visit, ANV1 women’s age, area of residence, schooling, gravidity, gestational age, weight and height were recorded. Thick blood smears were performed on ANV1, second visit (ANV2 and at delivery. In Allada, women’s serum ferritin and CRP concentrations were also assessed. The impact of gravidity on maternal haemoglobin (Hb was analysed using a logistic or linear regression depending on the outcome. The statistical significance was set to P Results In total, data from 3,591 pregnant women were analysed. Both univariate and multivariate analyses showed a constant association between Hb concentrations and gravidity in the three periods of Hb assessment (ANV1, ANV2 and delivery. Mean Hb concentration was significantly lower in primigravidae than in multigravidae at ANV1 (mean difference = -2.4 g/L, CI 95%: [-3.4, -1.4], P Conclusion In a context of IPTp, Hb levels improved progressively throughout pregnancy in primigravidae, likely as a result of reduction in malaria infection. In multigravidae, the improvement was less perceptible and anaemia was mainly due to iron deficiency.

Novel haemoglobin-derived antimicrobial peptides from chicken (Gallus gallus) blood: purification, structural aspects and biological activity.

Science.gov (United States)

Vasilchenko, A S; Rogozhin, E A; Vasilchenko, A V; Kartashova, O L; Sycheva, M V

2016-12-01

To purify and characterize antimicrobial peptides derived from the acid extract of Gallus gallus blood cells. Two polypeptides (i.e. CHb-1 and CHb-2) with antibacterial activity were detected in the acidic extract of blood cells from chicken (G. gallus). The isolated peptides that possessed a potent antibacterial activity were purified using a two-step chromatography procedure that involved solid-phase extraction of a total protein/peptide extract followed by thin fractionation by reversed-phase high performance liquid chromatography (RP-HPLC). The molecular masses of the purified peptides were similar and were 4824·4 and 4825·2 Da, which have been measured by matrix-assisted laser desorption/ionization mass spectrometry (MALDI TOF MS). Their amino acid sequences were determined by Edman degradation and showed that the peptides were fully identical to the two fragments of G. gallus α-haemoglobin localized into different subunits (A and D respectively). The peptides were active in micromolar concentrations against Gram-negative Escherichia coli K12 TG1. Using the 1-N-phenylnaphthylamine, the FITC-dextran labelled probes and the live/dead staining allowed to show the hemocidin mode of action and estimate the pore size. In this study, for the first time, α-haemoglobin from chicken (G. gallus) has been investigated as a donor of the two high homologous native peptide fragments that possess potent antibacterial activity in vitro. These are membrane-active peptides and their mechanism of action against E. coli involves a toroidal pore formation. The obtained results expand the perception of the role of haemoglobin in a living system, describing it as a source of multifunction substances. Additionally, the data presented in this paper may contribute to the development of new, cost-effective, antimicrobial agents. © 2016 The Society for Applied Microbiology.
Effects of prolonged compression on the variations of haemoglobin oxygenation-assessment by spectral analysis of reflectance spectrophotometry signals

Energy Technology Data Exchange (ETDEWEB)

Li, Zengyong; Tam, Eric W C; Mak, Arthur F T; Lau, Roy Y C [Department of Health Technology and Informatics, The Hong Kong Polytechnic University, Kowloon, Hong Kong (China)

2006-11-07

The consequences of rhythmical flow motion for nutrition and the oxygen supply to tissue are largely unknown. In this study, the periodic variations of haemoglobin oxygenation in compressed and uncompressed skin were evaluated with a reflection spectrometer using an in vivo Sprague-Dawley rat model. Skin compression was induced over the trochanter area by a locally applied external pressure of 13.3 kPa (100 mmHg) via a specifically designed pneumatic indentor. A total of 19 rats were used in this study. The loading duration is 6 h per day for four consecutive days. Haemoglobin oxygenation variations were quantified using spectral analysis based on wavelets' transformation. The results found that in both compressed and uncompressed skin, periodic variations of the haemoglobin oxygenation were characterized by two frequencies in the range of 0.01-0.05 Hz and 0.15-0.4 Hz. These frequency ranges coincide with those of the frequency range of the endothelial-related metabolic and myogenic activities found in the flow motion respectively. Tissue compression following the above loading schedule induced a significant decrease in the spectral amplitudes of frequency interval 0.01-0.05 Hz during the pre-occlusion period on day 3 and day 4 as compared to that on day 1 (p < 0.05). In contrast, at a frequency range of 0.15-0.4 Hz, prolonged compression caused a significant increase in spectral amplitude during the pre-occlusion period in the compressed tissue on day 3 (p = 0.041) and day 4 (p = 0.024) compared to that in the uncompressed tissue on day 1. These suggested that the variations of the haemoglobin oxygenation were closely related to the endothelial-related metabolic and myogenic activities. Increased amplitude in the frequency interval 0.15-0.4 Hz indicated an increased workload of the vascular smooth muscle and could be attributed to the increase of O{sub 2} consumption rates of arteriolar walls. The modification of vessel wall oxygen consumption might
New technology increases perioperative haemoglobin levels for paediatric cardiopulmonary bypass: what is the benefit?

Science.gov (United States)

Thuys, Clarke; Horton, Stephen; Bennett, Martin; Augustin, Simon

2006-01-01

Increasing perioperative haemoglobin level by reducing priming volume and maintaining a safe cardiopulmonary bypass (CPB) system is the aim of every perfusionist. In this study, we have compared the two membrane oxygenators and pump systems used for paediatric bypass at the Royal Children's Hospital on a regular basis since 1988. We looked at all patients who had the Cobe VPCML (Cobe Laboratories, Denver, CO, USA) and Terumo RX-05 (Terumo Corporation, Tokyo, Japan) oxygenators used for flows from 800 mL/min up to the maximum rated flow for the respective oxygenator from January 2002 until March 2004. The VPCML refers to using only the 0.4-m2 section of the oxygenator. The pump systems used were the Stöckert CAPS (Stöckert Instrumente GmbH, Munich, Germany) and Jostra HL 30 (Jostra AB, Lund, Sweden). Changing from the VPCML to the RX-05 resulted in a 37% reduction in priming volume. The introduction of the Jostra HL 30 with a custom-designed mast system reduced the priming volume by another 15%. This change in priming volume allowed a significant increase, from 6 to 34%, in the percentage of patients who received bloodless primes, and for those patients who received blood primes, an increase in haemoglobin (Hb) on bypass from 8.2 to 9.6 g/dL, on average.
Relationship between haemoglobin concentration and packed cell volume in cattle blood samples

Directory of Open Access Journals (Sweden)

Paa-Kobina Turkson

2015-02-01

Full Text Available A convention that has been adopted in medicine is to estimate haemoglobin (HB concentration as a third of packed cell volume (PCV or vice versa. The present research set out to determine whether a proportional relationship exists between PCV and Hb concentration in cattle blood samples, and to assess the validity of the convention of estimating Hb concentration as a third of PCV. A total of 440 cattle in Ghana from four breeds (Ndama, 110; West African Short Horn, 110; Zebu, 110 and Sanga, 110 were bled for haematological analysis, specifically packed cell volume, using the microhaematocrit technique and haemoglobin concentration using the cyanmethaemoglobin method. Means, standard deviations, standard errors of mean and 95% confidence intervals were calculated. Trendline analyses generated linear regression equations from scatterplots. For all the cattle, a significant and consistent relationship (r = 0.74 was found between Hb concentration and PCV (%. This was expressed as Hb concentration (g/dL = 0.28 PCV + 3.11. When the Hb concentration was estimated by calculating it as a third of PCV, the relationship was expressed in linear regression as Hb concentration (g/dL = 0.83 calculated Hb + 3.11. The difference in the means of determined (12.2 g/dL and calculated (10.9 g/dL Hb concentrations for all cattle was significant (p < 0.001, whereas the difference in the means of determined Hb and corrected calculated Hb was not significant. In conclusion, a simplified relationship of Hb (g/dL = (0.3 PCV + 3 may provide a better estimate of Hb concentration from the PCV of cattle.
Association between glycated haemoglobin and the risk of congestive heart failure in diabetes mellitus : systematic review and meta-analysis

NARCIS (Netherlands)

Erqou, Sebhat; Lee, Chee-Tin Christine; Suffoletto, Matthew; Echouffo-Tcheugui, Justin B.; de Boer, Rudolf A.; van Melle, Joost P.; Adler, Amanda I.

Clinical trials to date have not provided definitive evidence regarding the effects of glucose lowering on the incidence of congestive heart failure (CHF). We synthesized available prospective epidemiological data on the association between glycaemia measured by haemoglobin A(1c) (HbA(1c)) and
Haemoglobin Pierre-Benite--a high affinity variant associated with relative polycythaemia.

Science.gov (United States)

Beard, M E; Potter, H C; Spearing, R L; Brennan, S O

2001-12-01

This is the second reported example of Hb Pierre--Benite (beta90 Glu-->Asp). This mutation is associated with increased oxygen affinity and polycythaemia. No instability was found and there was no charge shift detected by cellulose acetate electrophoresis at pH 8.3. The mutation was however, clearly indicated by electrospray ionization mass spectrometry (ESI MS), which showed an abnormal beta chain with a 14 Da decrease in mass. Blood volume studies documented a relative rather than a true polycythaemia and this finding has been reported in at least two other high affinity haemoglobin variants--Hb Heathrow and Hb Rahere. This finding led to delay in diagnosis because high oxygen affinity variants are conventionally considered to cause a true polycythaemia.
Epidemiological evidence for the role of the haemoglobin receptor, HmbR, in meningococcal virulence

OpenAIRE

Harrison, Odile B.; Evans, Nicholas J.; Blair, Jessica M.; Grimes, Holly S.; Tinsley, Colin R.; Nassif, Xavier; Kriz, Paula; Ure, Roisin; Gray, Steve J.; Derrick, Jeremy P.; Maiden, Martin C.J.; Feavers, Ian M.

2009-01-01

The distribution of the haemoglobin receptor gene (hmbR) was investigated in disease and carried Neisseria meningitidis isolates revealing that the gene occurred at a significantly higher frequency in disease isolates compared to those obtained from carriage. Where hmbR was absent, the locus was occupied by the cassettes exl2 or exl3, or with a “pseudo hmbR” gene designated exl4. The hmbR locus in published N. meningitidis genomes, as well as N. gonorrhoeae and N. lactamica ST-640, exhibited ...
Relating oxygen partial pressure, saturation and content: the haemoglobin-oxygen dissociation curve.

Science.gov (United States)

Collins, Julie-Ann; Rudenski, Aram; Gibson, John; Howard, Luke; O'Driscoll, Ronan

2015-09-01

The delivery of oxygen by arterial blood to the tissues of the body has a number of critical determinants including blood oxygen concentration (content), saturation (S O2 ) and partial pressure, haemoglobin concentration and cardiac output, including its distribution. The haemoglobin-oxygen dissociation curve, a graphical representation of the relationship between oxygen satur-ation and oxygen partial pressure helps us to understand some of the principles underpinning this process. Historically this curve was derived from very limited data based on blood samples from small numbers of healthy subjects which were manipulated in vitro and ultimately determined by equations such as those described by Severinghaus in 1979. In a study of 3524 clinical specimens, we found that this equation estimated the S O2 in blood from patients with normal pH and S O2 >70% with remarkable accuracy and, to our knowledge, this is the first large-scale validation of this equation using clinical samples. Oxygen saturation by pulse oximetry (S pO2 ) is nowadays the standard clinical method for assessing arterial oxygen saturation, providing a convenient, pain-free means of continuously assessing oxygenation, provided the interpreting clinician is aware of important limitations. The use of pulse oximetry reduces the need for arterial blood gas analysis (S aO2 ) as many patients who are not at risk of hypercapnic respiratory failure or metabolic acidosis and have acceptable S pO2 do not necessarily require blood gas analysis. While arterial sampling remains the gold-standard method of assessing ventilation and oxygenation, in those patients in whom blood gas analysis is indicated, arterialised capillary samples also have a valuable role in patient care. The clinical role of venous blood gases however remains less well defined.
Haemoglobin C and S role in acquired immunity against Plasmodium falciparum malaria.

Directory of Open Access Journals (Sweden)

Federica Verra

2007-10-01

Full Text Available A recently proposed mechanism of protection for haemoglobin C (HbC; beta6Glu-->Lys links an abnormal display of PfEMP1, an antigen involved in malaria pathogenesis, on the surface of HbC infected erythrocytes together with the observation of reduced cytoadhesion of parasitized erythrocytes and impaired rosetting in vitro. We investigated the impact of this hypothesis on the development of acquired immunity against Plasmodium falciparum variant surface antigens (VSA encoding PfEMP1 in HbC in comparison with HbA and HbS carriers of Burkina Faso. We measured: i total IgG against a single VSA, A4U, and against a panel of VSA from severe malaria cases in human sera from urban and rural areas of Burkina Faso of different haemoglobin genotypes (CC, AC, AS, SC, SS; ii total IgG against recombinant proteins of P. falciparum asexual sporozoite, blood stage antigens, and parasite schizont extract; iii total IgG against tetanus toxoid. Results showed that the reported abnormal cell-surface display of PfEMP1 on HbC infected erythrocytes observed in vitro is not associated to lower anti- PfEMP1 response in vivo. Higher immune response against the VSA panel and malaria antigens were observed in all adaptive genotypes containing at least one allelic variant HbC or HbS in the low transmission urban area whereas no differences were detected in the high transmission rural area. In both contexts the response against tetanus toxoid was not influenced by the beta-globin genotype. These findings suggest that both HbC and HbS affect the early development of naturally acquired immunity against malaria. The enhanced immune reactivity in both HbC and HbS carriers supports the hypothesis that the protection against malaria of these adaptive genotypes might be at least partially mediated by acquired immunity against malaria.
Socioeconomic determinants of haemoglobin levels of African women are less important in areas with more health facilities: a multilevel analysis

NARCIS (Netherlands)

Haverkate, M; Smits, J.P.J.M.; Meijerink, H.; Ven, André van der

2014-01-01

BACKGROUND : The prevalence of anaemia in Africa is the highest in the world. Especially women are at risk because of blood loss during menstruation and increased iron requirements during pregnancy. This study examined determinants of the haemoglobin (Hb) level of African women at
Factores de riesgo asociados a infección aguda por hepatitis B en población militar destacada al departamento de Amazonas, Perú

OpenAIRE

César Cabezas; J. Jaime Miranda; Giovana Romero; Magna Suáre; Frine Samalvides; Juan Echevarría; Juan D. Valdivia; Walter A. Valdivia

2007-01-01

El Perú es considerado un país de endemicidad intermedia-alta para el virus de hepatitis B (VHB), con variaciones entre diferentes regiones. Existen pocos reportes del problema de infección por el VHB en personal militar. Objetivos. Determinar los factores de riesgo asociados con el desarrollo de infección por el VHB en un brote epidémico en personal militar destacado en Ampama, Amazonas, Perú. Material y métodos. Estudio caso-control en personal militar destacado al puesto de Ampama y a la b...
Prevalence of positive urinary dipstick analysis (leucocyte esterase, nitrite, haemoglobin, or glucose) in a population of 3645 adult subjects--consequence for measurement of urinary albumin excretion rate

DEFF Research Database (Denmark)

Clausen, P; Jensen, J S; Borch-Johnsen, K

1998-01-01

OBJECTIVES: To assess prevalence of positive urinary dipstick analysis for leucocyte esterase, nitrite, haemoglobin, or glucose in the general population and measure the urinary albumin excretion rate (UAER) in subjects with or without a positive dipstick analysis. DESIGN: A cross-sectional study...... of 3645 subjects. SETTING: An unselected urban population study. MAIN OUTCOME MEASURES: Prevalence data of positive dipstick analyses and UAER values. RESULTS: Prevalence data of a positive dipstick analysis were 12%, 4%, 3% and 6%, respectively, for leucocyte esterase, nitrite, haemoglobin, and glucose...
Glucose-6-Phosphate Dehydrogenase Deficiency and Haemoglobin Drop after Sulphadoxine-Pyrimethamine Use for Intermittent Preventive Treatment of Malaria during Pregnancy in Ghana - A Cohort Study.

Directory of Open Access Journals (Sweden)

Ruth Owusu

Full Text Available Sulphadoxine-Pyrimethamine (SP is still the only recommended antimalarial for use in intermittent preventive treatment of malaria during pregnancy (IPTp in some malaria endemic countries including Ghana. SP has the potential to cause acute haemolysis in G6PD deficient people resulting in significant haemoglobin (Hb drop but there is limited data on post SP-IPTp Hb drop. This study determined the difference, if any in proportions of women with significant acute haemoglobin drop between G6PD normal, partial deficient and full deficient women after SP-IPTp.Prospectively, 1518 pregnant women who received SP for IPTp as part of their normal antenatal care were enrolled. Their G6PD status were determined at enrollment followed by assessments on days 3, 7,14 and 28 to document any adverse effects and changes in post-IPTp haemoglobin (Hb levels. The three groups were comparable at baseline except for their mean Hb (10.3 g/dL for G6PD normal, 10.8 g/dL for G6PD partial deficient and 10.8 g/dL for G6PD full defect women.The prevalence of G6PD full defect was 2.3% and 17.0% for G6PD partial defect. There was no difference in the proportions with fractional Hb drop ≥ 20% as compared to their baseline value post SP-IPTp among the 3 groups on days 3, 7, 14. The G6PD full defect group had the highest median fractional drop at day 7. There was a weak negative correlation between G6PD activity and fractional Hb drop. There was no statistical difference between the three groups in the proportions of those who started the study with Hb ≥ 8g/dl whose Hb level subsequently fell below 8g/dl post-SP IPTp. No study participant required transfusion or hospitalization for severe anaemia.There was no significant difference between G6PD normal and deficient women in proportions with significant acute haemoglobin drop post SP-IPTp and lower G6PD enzyme activity was not strongly associated with significant acute drug-induced haemoglobin drop post SP-IPTp but a larger
Meat and cancer: haemoglobin and haemin in a low-calcium diet promote colorectal carcinogenesis at the aberrant crypt stage in rats

Science.gov (United States)

Pierre, Fabrice; Taché, Sylviane; Petit, Claude R; Van Der Meer, Roelof; Corpet, Denis E

2003-01-01

High intake of red meat, but not of white meat, is associated with an increased risk of colon cancer. However, red meat does not promote cancer in rodents. Haemin, added to low-calcium diets, increases colonic proliferation, and haemoglobin, added to high-fat diets, increases the colon tumour incidence in rats, an effect possibly due to peroxyl radicals. We thus speculated that haem might be the promoting agent in meat, and that prevention strategies could use calcium and antioxidants. These hypotheses were tested in rats at the aberrant crypt foci (ACF) stage at 100 days. F344 rats (n=124) were given an injection of azoxymethane and were then randomised to 11 groups fed with low-calcium (20μmol/g) AIN76-based diets, containing 5% safflower oil. Haemin (0.25, 0.5 and 1.5μmol/g) or haemoglobin (1.5 and 3 μmol haem/g) was added to five experimental diets, compared to a control diet without haem. Three other high-haemin diets (1.5μmol/g) were supplemented with calcium (250μmol/g), antioxidant butylated hydroxyanisole and rutin (0.05% each), and olive oil, which replaced safflower oil. Faecal water was assayed for lipid peroxidation by thiobarbituric acid reactive substances (TBARs) test, and for cytolytic activity. Haemin strikingly increased the ACF size, dose-dependently, from 2.6 to 11.4 crypts/ACF (all p<0.001). The high-haemin diet also increased the number of ACF per colon (p<0.001). Promotion was associated with increased faecal water TBARs and cytotoxicity. Calcium, olive oil, and antioxidants each inhibited the haemin-induced ACF promotion, and normalised the faecal TBARs and cytotoxicity. The haemoglobin diets increased the number of ACF and faecal TBARs, but not the ACF size or the faecal cytotoxicity. In conclusion, dietary haemin is the most potent known ACF promoter. Haemoglobin is also a potent promoter of colorectal carcinogenesis. The results suggest that myoglobin in red meat could promote colon cancer. Diets high in calcium, or in oxidation
Insect-resistance and high-yield transgenic tobacco obtained by ...

African Journals Online (AJOL)

The modified synthesized VHb gene and insectidal gene (GFMcryIA) were transferred to tobacco plants by Agrobacterium-mediated transformation. The bivalent genes were inserted successfully into the tobacco genome and detected by PCR amplification. Southern blot and Western blot analyses showed that VHb gene ...
Soluble CD163, a product of monocyte/macrophage activation, is inversely associated with haemoglobin levels in placental malaria.

Directory of Open Access Journals (Sweden)

Caroline Lin Lin Chua

Full Text Available In Plasmodium falciparum malaria, activation of monocytes and macrophages (monocytes/macrophages can result in the production of various inflammatory mediators that contribute to immunopathology. Soluble CD163 (sCD163 is a specific marker of monocyte/macrophage activation typically found at increased levels during various inflammatory conditions and can be associated with poor clinical outcomes. To better understand the relationships between levels of sCD163 and clinical parameters in women with placental malaria, we measured plasma sCD163 levels in maternal peripheral and placental blood compartments at delivery and determined their correlations with birth weight and maternal haemoglobin concentrations. sCD163 levels were negatively correlated with birth weight only in the placental compartment (r = -0.145, p = 0.03 and were inversely correlated with maternal haemoglobin concentrations, both in peripheral blood (r = -0.238, p = 0.0004 and in placental blood (r = -0.259, p = 0.0001. These inverse relationships suggest a potential role for monocyte/macrophage activation in the pathogenesis of malaria in pregnancy, particularly in relation to malaria-associated anaemia.
Structural and Functional Characterization of a New Double Variant Haemoglobin (HbG-Philadelphia/Duarte α(2)β(2)).

Science.gov (United States)

Fais, Antonella; Casu, Mariano; Ruggerone, Paolo; Ceccarelli, Matteo; Porcu, Simona; Era, Benedetta; Anedda, Roberto; Sollaino, Maria Carla; Galanello, Renzo; Corda, Marcella

2011-01-01

WE REPORT THE FIRST CASE OF COSEGREGATION OF TWO HAEMOGLOBINS (HBS): HbG-Philadelphia [α68(E17)Asn → Lys] and HbDuarte [β62(E6)Ala → Pro]. The proband is a young patient heterozygous also for β°-thalassaemia. We detected exclusively two haemoglobin variants: HbDuarte and HbG-Philadelphia/Duarte. Functional study of the new double variant HbG-Philadelphia/Duarte exhibited an increase in oxygen affinity, with a slight decrease of cooperativity and Bohr effect. This functional behaviour is attributed to β62Ala → Pro instead of α68Asn → Lys substitution. Indeed, HbG-Philadelphia isolated in our laboratory from blood cells donor carrier for this variant is not affected by any functional modification, whereas purified Hb Duarte showed functional properties very similar to the double variant. NMR and MD simulation studies confirmed that the presence of Pro instead of Ala at the β62 position produces displacement of the E helix and modifications of the tertiary structure. The substitution α68(E17)Asn → Lys does not cause significant structural and dynamical modifications of the protein. A possible structure-based rational of substitution effects is suggested.
Trend overtime of total haemoglobin, iron metabolism and trace minerals in veal calves fed high amounts of two different solid feeds

Directory of Open Access Journals (Sweden)

Anna-Lisa Stefani

2010-01-01

Full Text Available Fifty Polish Friesian veal calves were administrated high amounts of two different solid feeds (maize grain and a mix diet containing 10% of straw and 8% of soy in addition to the traditional milk replacer diet. Compared to the mix diet, maize grain had a lower content of iron, copper and zinc and a minor fibre level. Effects of the two diets on calves’ blood haemoglobin, iron, iron metabolism parameters, copper and zinc concentrations were studied. Haemoglobin concentration resulted higher at the end of the fattening for calves fed the mix diet, as expected. Values remained, however, within ranges that allowed acceptable carcass paleness. Haematic iron, unsaturated iron binding capacity (UIBC and total iron binding capacity (TIBC levels were not significantly different between the two solid feeds. Lower copper and zinc blood concentrations resulted for calves fed the mix diet were likely due to the feed fibre interfering with the bioavailability of the two minerals, according to what happens for iron.
Rapid screening for glucose-6-phosphate dehydrogenase deficiency and haemoglobin polymorphisms in Africa by a simple high-throughput SSOP-ELISA method

DEFF Research Database (Denmark)

Enevold, Anders; Vestergaard, Lasse S; Lusingu, John

2005-01-01

was available. METHODS: A simple and rapid technique was developed to detect the most prominent single nucleotide polymorphisms (SNPs) in the HbB and G6PD genes. The method is able to detect the different haemoglobin polymorphisms A, S, C and E, as well as G6PD polymorphisms B, A and A- based on PCR......-amplification followed by a hybridization step using sequence-specific oligonucleotide probes (SSOPs) specific for the SNP variants and quantified by ELISA. RESULTS: The SSOP-ELISA method was found to be specific, and compared well to the commonly used PCR-RFLP technique. Identical results were obtained in 98......% (haemoglobin) and 95% (G6PD) of the tested 90 field samples from a high-transmission area in Tanzania, which were used to validate the new technique. CONCLUSION: The simplicity and accuracy of the new methodology makes it suitable for application in settings where resources are limited. It would serve...
Validity and reliability of haemoglobin colour scale and its comparison with clinical signs in diagnosing anaemia in pregnancy in Ahmedabad, India.

Science.gov (United States)

Bala, D V; Vyas, S; Shukla, A; Tiwari, H; Bhatt, G; Gupta, K

2012-07-01

This study compared the validity of the haemoglobin colour scale (HCS) and clinical signs in diagnosing anaemia against Sahli's haemoglobinometer method as the gold standard, and assessed the reliability of HCS. The sample comprised 129 pregnant women recruited from 6 urban health centres in Ahmedabad. The prevalence of anaemia was 69.8% by Sahli's method, 78.3% by HCS and 89.9% by clinical signs; there was no statistically significant difference between Sahli's method and HCS whereas there was between Sahlis method and clinical signs. The mean haemoglobin level by Sahli's method and HCS differed significantly. The sensitivity, specificity, positive predictive value and negative predictive value of HCS was 83.3%, 33.3%, 74.3% and 46.4% respectively and that of clinical signs was 91.1%, 12.8%, 70.7% and 38.5% respectively. Interobserver agreement for HCS was moderate (K = 0.43). Clinical signs are better than HCS for diagnosing anaemia. HCS can be used in the field provided assessors are adequately trained.

Factores de riesgo asociados a infección aguda por hepatitis B en población militar destacada al departamento de Amazonas, Perú

Directory of Open Access Journals (Sweden)

César Cabezas

2007-10-01

Full Text Available El Perú es considerado un país de endemicidad intermedia-alta para el virus de hepatitis B (VHB, con variaciones entre diferentes regiones. Existen pocos reportes del problema de infección por el VHB en personal militar. Objetivos. Determinar los factores de riesgo asociados con el desarrollo de infección por el VHB en un brote epidémico en personal militar destacado en Ampama, Amazonas, Perú. Material y métodos. Estudio caso-control en personal militar destacado al puesto de Ampama y a la base El Milagro, departamento de Amazonas. Fueron evaluados HBsAg y posibles factores de riesgo asociados a un incremento de riesgo de adquirir el VHB. Resultados. Se estudió a 123 personas, repartidos en 41 sujetos en cada uno de los grupos (casos, control 1 y control 2. 73,2% de los casos tuvo confirmación de infección aguda por el VHB (IgM anti HBc positivo y anti Delta fue positivo en 1/37 (2,7% caso. Ninguno de los factores de riesgo evaluados mostró una asociación significativa con hepatitis B. Algunos factores de riesgo con posible asociación fueron contacto con personal con hepatitis B (OR 2,3; IC95% 0,9 - 5,7 y mordedura de murciélago (OR 1,6; IC95% 0,6 - 4,4. Conclusiones. Los factores de riesgo clásicos asociados con la transmisión del virus de la hepatitis B no fueron significativos. El personal militar es un grupo en riesgo para infectarse con el VHB.
Influence of altitude training modality on performance and total haemoglobin mass in elite swimmers.

Science.gov (United States)

Gough, Clare E; Saunders, Philo U; Fowlie, John; Savage, Bernard; Pyne, David B; Anson, Judith M; Wachsmuth, Nadine; Prommer, Nicole; Gore, Christopher J

2012-09-01

We compared changes in performance and total haemoglobin mass (tHb) of elite swimmers in the weeks following either Classic or Live High:Train Low (LHTL) altitude training. Twenty-six elite swimmers (15 male, 11 female, 21.4 ± 2.7 years; mean ± SD) were divided into two groups for 3 weeks of either Classic or LHTL altitude training. Swimming performances over 100 or 200 m were assessed before altitude, then 1, 7, 14 and 28 days after returning to sea-level. Total haemoglobin mass was measured twice before altitude, then 1 and 14 days after return to sea-level. Changes in swimming performance in the first week after Classic and LHTL were compared against those of Race Control (n = 11), a group of elite swimmers who did not complete altitude training. In addition, a season-long comparison of swimming performance between altitude and non-altitude groups was undertaken to compare the progression of performances over the course of a competitive season. Regardless of altitude training modality, swimming performances were substantially slower 1 day (Classic 1.4 ± 1.3% and LHTL 1.6 ± 1.6%; mean ± 90% confidence limits) and 7 days (0.9 ± 1.0% and 1.9 ± 1.1%) after altitude compared to Race Control. In both groups, performances 14 and 28 days after altitude were not different from pre-altitude. The season-long comparison indicated that no clear advantage was obtained by swimmers who completed altitude training. Both Classic and LHTL elicited ~4% increases in tHb. Although altitude training induced erythropoeisis, this physiological adaptation did not transfer directly into improved competitive performance in elite swimmers.
A comparison of post-op haemoglobin levels and allogeneic blood transfusion rates following total knee arthroplasty without drainage or with reinfusion drains.

Science.gov (United States)

Hazarika, Shariff; Bhattacharya, Rajarshi; Bhavikatti, Mainudden; Dawson, Matthew

2010-02-01

The effects of re-infusion drains on the rate of allogeneic blood transfusion and post-op haemoglobin levels in Total Knee Arthroplasty were examined. A group of 22 patients undergoing primary Total Knee Arthroplasty using a CBCII Constavac Stryker re-infusion drainage system were compared with a group of 30 patients, matched for age, sex and type of prosthesis but without any drain usage. The re-infusion drain.group had a significantly lower day 1 and day 3 post-operative haemoglobin compared to the non-drainage group. The re-infusion drain group had a higher allogenic transfusion rate compared to the non-drainage group. There were no significant differences between the two groups regarding the rate of wound and transfusion related complications and mean length of post-operative stay. We found that reinfusion drains were ineffective in reducing allogeneic transfusion requirements as compared with non-drainage in total knee arthroplasty.
Diagnostic applications of newborn screening for α-thalassaemias, haemoglobins E and H disorders using isoelectric focusing on dry blood spots.

Science.gov (United States)

Jindatanmanusan, Punyanuch; Riolueang, Suchada; Glomglao, Waraporn; Sukontharangsri, Yaowapa; Chamnanvanakij, Sangkae; Torcharus, Kitti; Viprakasit, Vip

2014-03-01

Neonatal screening for haemoglobin (Hb) disorders is a standard of care in several developed countries with the main objective to detect Hb S. Such practice has not been established in Thailand where α-thalassaemia and haemoglobin E (Hb E) are highly prevalent. Early identification of thalassaemias could be helpful and strengthen the programme for prevention and control for severe thalassaemias. Data from isoelectric focusing (IEF) and Isoscan® for detecting types and amount (%) of each haemoglobin in 350 newborn's dried blood spots were analysed and compared with the comprehensive genotype analysis by DNA studies as a gold standard. Based on genetic profiles, there were 10 different categories: (1) normal (n = 227), (2) α(+)-thalassaemia trait (n = 14), (3) α(0)-thalassaemia trait (n = 13), (4) β(0)-thalassaemia trait (n = 7), (5) Hb E trait (n = 72), (6) Hb E trait with α(0)-thalassaemia or homozygous α(+)-thalassaemia (n = 5), (7) Hb E trait with α(+)-thalassaemia trait (n = 5), (8) homozygous Hb E (n = 3), (9) homozygous Hb E with α(0)-thalassaemia trait (n = 1) and (10) Hb H disease (n = 3). The presence of Hb Bart's and Hb E were used to identify cases with α-thalassaemia and Hb E, respectively. We set 0.25% of Hb Bart's and 1.5% of Hb E as a cut-off level to detect α(+)-thalassaemia trait (sensitivity 92.86% and specificity 74.0%) and Hb E trait with 100% of both sensitivity and specificity for IEF diagnosis. Although molecular diagnosis seems to be better for definitive diagnosis of thalassaemia syndromes at birth, however, using our reference range described herein, IEF can be applied in a resource-limiting setting with acceptable reliability.
Deworming drugs for soil-transmitted intestinal worms in children: effects on nutritional indicators, haemoglobin, and school performance

Science.gov (United States)

Taylor-Robinson, David C; Maayan, Nicola; Soares-Weiser, Karla; Donegan, Sarah; Garner, Paul

2015-01-01

Background The World Health Organization (WHO) recommends treating all school children at regular intervals with deworming drugs in areas where helminth infection is common. As the intervention is often claimed to have important health, nutrition, and societal effects beyond the removal of worms, we critically evaluated the evidence on benefits. Objectives To summarize the effects of giving deworming drugs to children to treat soil-transmitted helminths on weight, haemoglobin, and cognition; and the evidence of impact on physical well-being, school attendance, school performance, and mortality. Search methods We searched the Cochrane Infectious Diseases Group Specialized Register (14 April 2015); Cochrane Central Register of Controlled Trials (CENTRAL), published in the Cochrane Library (2015, Issue 4); MEDLINE (2000 to 14 April 2015); EMBASE (2000 to 14 April 2015); LILACS (2000 to 14 April 2015); the metaRegister of Controlled Trials (mRCT); and reference lists, and registers of ongoing and completed trials up to 14 April 2015. Selection criteria We included randomized controlled trials (RCTs) and quasi-RCTs comparing deworming drugs for soil-transmitted helminths with placebo or no treatment in children aged 16 years or less, reporting on weight, haemoglobin, and formal tests of intellectual development. We also sought data on school attendance, school performance, and mortality. We included trials that combined health education with deworming programmes. Data collection and analysis At least two review authors independently assessed the trials, evaluated risk of bias, and extracted data. We analysed continuous data using the mean difference (MD) with 95% confidence intervals (CIs). Where data were missing, we contacted trial authors. We used outcomes at time of longest follow-up. The evidence quality was assessed using GRADE. This edition of the Cochrane Review adds the DEVTA trial from India, and draws on an independent analytical replication of a trial from
[Role of erythrocyte cytoplasmic structures in changes in the affinity of haemoglobin for oxygen].

Science.gov (United States)

Bryzgalova, N Iu; Brazhe, N A; Iusipovich, A U; Maksimov, G V; Rubin, A B

2009-01-01

Changes in the refractive index of the cytoplasm and the affinity of haemoporphyrin of erythrocyte haemoglobin to oxygen (pH, 2,3-diphosphoglycerate) have been investigated using laser interference microscopy and Raman spectroscopy. It has been established that a decrease in pH and an increase in the content of 2,3-diphosphoglycerate are accompanied by changes in both the form of the cell and the refractive index of the cytoplasm and the affinity of haemoporphyrin of hemoglobin to oxygen. It has been shown that as pH is reduced, the capacity of haemoporphyrin for binding oxygen decreases and as the concentration of 2,3-diphosphoglycerate is increased, the ability of haemoporphyrin for oxygen reabsorption increases.
Foetal haemoglobin and disease severity in sickle cell anaemia patients in Kampala, Uganda

Directory of Open Access Journals (Sweden)

Mpalampa Lena

2012-09-01

Full Text Available Abstract Background Sickle cell anaemia (SCA is a major chronic health problem in Uganda. In patients with SCA, the level of foetal haemoglobin (HbF has been found to be important in influencing the clinical course of the disease. Thus populations with high levels of HbF like those in Saudi Arabia have been described as having a milder clinical course with fewer complications as compared to populations with lower levels. Disease modifying drugs can increase the Hb F levels and modify the presentation of SCA. Methods This was a cross sectional study in which we determined foetal haemoglobin levels and examined the relationship between HbF levels and disease severity in SCA patients in Mulago Hospital, Kampala, Uganda. We consecutively enrolled 216 children aged 1 year to 18 years with SCA attending the Sickle Cell Clinic at Mulago Hospital whose guardians had given consent. The history included age at onset of initial symptoms and diagnosis, number of hospitalisations and blood transfusions and other complications of SCA (cardiovascular accidents, avascular hip necrosis and priapism. A detailed physical examination was performed to assess the current state and help describe the disease severity for each patient. Blood samples were drawn for HbF levels. HbF levels ≥10% was defined as high. Results Of the 216 children, (80 37% had HbF levels ≥10%. Significant correlations were observed between HbF level and several clinical parameters independent of age including age at diagnosis (p value 0.013, number of hospitalisations (p value 0.024 and transfusions (p value 0.018 since birth. Conclusion A third of the children with SCA attending the Sickle cell clinic in Mulago Hospital have high HbF levels. Higher HbF level is associated with later onset of symptoms and presentation, and less severe disease characterised by fewer hospitalisations and blood transfusions. We suggest HbF levels should be determined at initial contact for patients with SCA to
The predictive value of current haemoglobin levels for incident tuberculosis and/or mortality during long-term antiretroviral therapy in South Africa: a cohort study

NARCIS (Netherlands)

Kerkhoff, Andrew D.; Wood, Robin; Cobelens, Frank G.; Gupta-Wright, Ankur; Bekker, Linda-Gail; Lawn, Stephen D.

2015-01-01

Low haemoglobin concentrations may be predictive of incident tuberculosis (TB) and death in HIV-infected patients receiving antiretroviral therapy (ART), but data are limited and inconsistent. We examined these relationships retrospectively in a long-term South African ART cohort with multiple
Investigation of haemoglobin polymorphism in Ogaden cattle

Directory of Open Access Journals (Sweden)

Sanjoy Kumar Pal

2014-04-01

Full Text Available Background and Aim: The Ogaden cattle is one among the tropical cattle breeds (Bos indicus widely distributed in eastern and south eastern part of Ethiopia. The breed has been evolved in arid and semi arid agro-ecological setup, but later on distributed and adapted to the wide agro-ecological zones. Because of its multi-purpose role, the Ogaden cattle have been used for milk, beef, and income generation. Information on the inherent genetic diversity is important in the design of breeding improvement programmes, making rational decisions on sustainable utilization and conservation of Animal Genetic Resources. Limited information is available about genetic variation of Ogaden breed at molecular level. The present investigation was aimed to study the biochemical polymorphism at the Hemoglobin (Hb locus. Materials and Methods: Blood samples collected from 105 Ogaden cattle maintained at Haramaya beef farm by jugular vein puncture were subjected to agarose gel electrophoresis [pH range 8.4-8.5] to study the polymorphic activities of haemoglobin. Results: Three types of phenotypes were detected i.e. a slow moving (AA band, fast moving (BB band and a combination of slow + fast moving bands (AB. The frequency of the fast moving band was less [13 (12.3%] than the slow moving band [57 (54.2%]. Both slow & fast moving phenotype was observed in 35 (33.3% animals. The gene frequency of HBA allele was 0.709 and that of HBB allele 0.291. Conclusion: The distribution of phenotypes was in agreement with codominant single gene inheritance. The Chi-square (χ2 test revealed that the population is under Hardy-Weinberg equilibrium.
Restoration of Haemoglobin Level Using Hydrodynamic Gene Therapy with Erythropoietin Does Not Alleviate the Disease Progression in an Anaemic Mouse Model for TGFβ1-Induced Chronic Kidney Disease

DEFF Research Database (Denmark)

Pedersen, Lea Hougaard; Wogensen, Lise; Marcussen, N.

2015-01-01

. The experiment is conducted by hydrodynamic gene transfer of a plasmid encoding murine Epo in a transgenic mouse model that overexpresses TGF-β1 locally in the kidneys. This model develops anaemia due to chronic kidney disease characterised by thickening of the glomerular basement membrane, deposition...... of mesangial matrix and mild interstitial fibrosis. A group of age matched wildtype littermates are treated accordingly. After a single hydrodynamic administration of plasmid DNA containing murine EPO gene, sustained high haemoglobin levels are observed in both transgenic and wildtype mice from 7.5 ± 0.6 mmol...... treatment in this model of chronic kidney disease normalises haemoglobin levels but has no effect on kidney fibrosis or function....
Exercise and sports in haemoglobin disorders

Directory of Open Access Journals (Sweden)

D. Yazman

2011-12-01

Full Text Available Anaemia causes lower oxygen transport to tissues, interfering with normal physical development and may interfere with exercise and sports in thalassemia and Sickle-Cell-Disease (SCD l. Moreover, in SCD, the abnormal haemoglobin alters the erythrocyte shape and leads to pulmonary parenchymal damage, impaired vascular function and micro vascular complications. However, we now accept that, with regular blood transfusions and efficient oral or parenteral chelation modalities, many patients lead a normal development and life with little or no change from the lifestyle of their unaffected friends, although there are cognitive and emotional factors leading behaviour for participation in the social life and exercise, as studied by many scientists in Italy, United Kingdom, Greece and India. 贫血导致组织供氧不足，妨碍身体的正常发育，并可能干扰地中海贫血和镰状细胞病（SCD）患者的体育运动。更严重的是，在镰状细胞病患者体内，异常血红蛋白能改变红细胞形态，造成肺薄壁组织损害、血管功能损伤，并引起微血管并发症。然而，意大利、英国、希腊和印度的多位科学家的研究表明：尽管认知因子和情感因子是参加社会生活和运动的主导行为，但只要患者定期输血和采用高效的口服或非口服螯合疗法，很多人都可以正常发育和生活，与未受感染的人群并无大的区别。
Trimester-specific reference intervals for haemoglobin A(1c) (HbA(1c)) in pregnancy.

LENUS (Irish Health Repository)

O'Connor, Catherine

2011-11-26

Abstract Background: Diabetes in pregnancy imposes additional risks to both mother and infant. These increased risks are considered to be primarily related to glycaemic control which is monitored by means of glycated haemoglobin (HbA(1c)). The correlation of HbA(1c) with clinical outcomes emphasises the need to measure HbA(1c) accurately, precisely and for correct interpretation, comparison to appropriately defined reference intervals. Since July 2010, the HbA(1c) assay in Irish laboratories is fully metrologically traceable to the IFCC standard. The objective was to establish trimester-specific reference intervals in pregnancy for IFCC standardised HbA(1c) in non-diabetic Caucasian women. Methods: The authors recruited 311 non-diabetic Caucasian pregnant (n=246) and non-pregnant women (n=65). A selective screening based on risk factors for gestational diabetes was employed. All subjects had a random plasma glucose <7.7 mmol\\/L and normal haemoglobin level. Pregnancy trimester was defined as trimester 1 (T1, n=40) up to 12 weeks +6 days, trimester 2 (T2, n=106) 13-27 weeks +6 days, trimester 3 (T3, n=100) >28 weeks to term. Results: The normal HbA(1c) reference interval for Caucasian non-pregnant women was 29-37 mmol\\/mol (Diabetes Control and Complications Trial; DCCT: 4.8%-5.5%), T1: 24-36 mmol\\/mol (DCCT: 4.3%-5.4%), T2: 25-35 mmol\\/mol (DCCT: 4.4%-5.4%) and T3: 28-39 mmol\\/mol (DCCT: 4.7%-5.7%). HbA(1c) was significantly decreased in trimesters 1 and 2 compared to non-pregnant women. Conclusions: HbA(1c) trimester-specific reference intervals are required to better inform the management of pregnancies complicated by diabetes.
Iron from haemoglobin and haemin modulates nucleotide hydrolysis in Trichomonas vaginalis.

Science.gov (United States)

Vieira, Patrícia de Brum; Silva, Nícolas Luiz Feijó; Kist, Luiza Wilges; Oliveira, Giovanna Medeiros Tavares de; Bogo, Maurício Reis; Carli, Geraldo Atillio de; Macedo, Alexandre José; Tasca, Tiana

2015-04-01

Extracellular ATP may act as a danger signalling molecule, inducing inflammation and immune responses in infection sites. The ectonucleotidases NTPDase and ecto-5'-nucleotidase are enzymes that modulate extracellular nucleotide levels; these enzymes have been previously characterised in Trichomonas vaginalis. Iron plays an important role in the complex trichomonal pathogenesis. Herein, the effects of iron on growth, nucleotide hydrolysis and NTPDase gene expression in T. vaginalis isolates from female and male patients were evaluated. Iron from different sources sustained T. vaginalis growth. Importantly, iron from haemoglobin (HB) and haemin (HM) enhanced NTPDase activity in isolates from female patients and conversely reduced the enzyme activity in isolates from male patients. Iron treatments could not alter the NTPDase transcript levels in T. vaginalis. Furthermore, our results reveal a distinct ATP, ADP and AMP hydrolysis profile between isolates from female and male patients influenced by iron from HB and HM. Our data indicate the participation of NTPDase and ecto-5'-nucleotidase in the establishment of trichomonas infection through ATP degradation and adenosine production influenced by iron.
Iron from haemoglobin and haemin modulates nucleotide hydrolysis in Trichomonas vaginalis

Directory of Open Access Journals (Sweden)

Patrícia de Brum Vieira

2015-04-01

Full Text Available Extracellular ATP may act as a danger signalling molecule, inducing inflammation and immune responses in infection sites. The ectonucleotidases NTPDase and ecto-5’-nucleotidase are enzymes that modulate extracellular nucleotide levels; these enzymes have been previously characterised in Trichomonas vaginalis. Iron plays an important role in the complex trichomonal pathogenesis. Herein, the effects of iron on growth, nucleotide hydrolysis and NTPDase gene expression in T. vaginalis isolates from female and male patients were evaluated. Iron from different sources sustained T. vaginalis growth. Importantly, iron from haemoglobin (HB and haemin (HM enhanced NTPDase activity in isolates from female patients and conversely reduced the enzyme activity in isolates from male patients. Iron treatments could not alter the NTPDase transcript levels in T. vaginalis. Furthermore, our results reveal a distinct ATP, ADP and AMP hydrolysis profile between isolates from female and male patients influenced by iron from HB and HM. Our data indicate the participation of NTPDase and ecto-5’-nucleotidase in the establishment of trichomonas infection through ATP degradation and adenosine production influenced by iron.
C-reactive protein and serum creatinine, but not haemoglobin A1c, are independent predictors of coronary heart disease risk in non-diabetic Chinese.

Science.gov (United States)

Salim, Agus; Tai, E Shyong; Tan, Vincent Y; Welsh, Alan H; Liew, Reginald; Naidoo, Nasheen; Wu, Yi; Yuan, Jian-Min; Koh, Woon P; van Dam, Rob M

2016-08-01

In western populations, high-sensitivity C-reactive protein (hsCRP), and to a lesser degree serum creatinine and haemoglobin A1c, predict risk of coronary heart disease (CHD). However, data on Asian populations that are increasingly affected by CHD are sparse and it is not clear whether these biomarkers can be used to improve CHD risk classification. We conducted a nested case-control study within the Singapore Chinese Health Study cohort, with incident 'hard' CHD (myocardial infarction or CHD death) as an outcome. We used data from 965 men (298 cases, 667 controls) and 528 women (143 cases, 385 controls) to examine the utility of hsCRP, serum creatinine and haemoglobin A1c in improving the prediction of CHD risk over and above traditional risk factors for CHD included in the ATP III model. For each sex, the performance of models with only traditional risk factors used in the ATP III model was compared with models with the biomarkers added using weighted Cox proportional hazards analysis. The impact of adding these biomarkers was assessed using the net reclassification improvement index. For men, loge hsCRP (hazard ratio 1.25, 95% confidence interval: 1.05; 1.49) and loge serum creatinine (hazard ratio 4.82, 95% confidence interval: 2.10; 11.04) showed statistically significantly associations with CHD risk when added to the ATP III model. We did not observe a significant association between loge haemoglobin A1c and CHD risk (hazard ratio 1.83, 95% confidence interval: 0.21; 16.06). Adding hsCRP and serum creatinine to the ATP III model improved risk classification in men with a net gain of 6.3% of cases (p-value = 0.001) being reclassified to a higher risk category, while it did not significantly reduce the accuracy of classification for non-cases. For women, squared hsCRP was borderline significantly (hazard ratio 1.01, 95% confidence interval: 1.00; 1.03) and squared serum creatinine was significantly (hazard ratio 1.81, 95% confidence interval: 1.49; 2
Quantitative spatially resolved measurement of tissue chromophore concentrations using photoacoustic spectroscopy: application to the measurement of blood oxygenation and haemoglobin concentration

Science.gov (United States)

Laufer, Jan; Delpy, Dave; Elwell, Clare; Beard, Paul

2007-01-01

A new approach based on pulsed photoacoustic spectroscopy for non-invasively quantifying tissue chromophore concentrations with high spatial resolution has been developed. The technique is applicable to the quantification of tissue chromophores such as oxyhaemoglobin (HbO2) and deoxyhaemoglobin (HHb) for the measurement of physiological parameters such as blood oxygen saturation (SO2) and total haemoglobin concentration. It can also be used to quantify the local accumulation of targeted contrast agents used in photoacoustic molecular imaging. The technique employs a model-based inversion scheme to recover the chromophore concentrations from photoacoustic measurements. This comprises a numerical forward model of the detected time-dependent photoacoustic signal that incorporates a multiwavelength diffusion-based finite element light propagation model to describe the light transport and a time-domain acoustic model to describe the generation, propagation and detection of the photoacoustic wave. The forward model is then inverted by iteratively fitting it to measurements of photoacoustic signals acquired at different wavelengths to recover the chromophore concentrations. To validate this approach, photoacoustic signals were generated in a tissue phantom using nanosecond laser pulses between 740 nm and 1040 nm. The tissue phantom comprised a suspension of intralipid, blood and a near-infrared dye in which three tubes were immersed. Blood at physiological haemoglobin concentrations and oxygen saturation levels ranging from 2% to 100% was circulated through the tubes. The signal amplitude from different temporal sections of the detected photoacoustic waveforms was plotted as a function of wavelength and the forward model fitted to these data to recover the concentrations of HbO2 and HHb, total haemoglobin concentration and SO2. The performance was found to compare favourably to that of a laboratory CO-oximeter with measurement resolutions of ±3.8 g l-1 (±58 µM) and ±4
Quantitative spatially resolved measurement of tissue chromophore concentrations using photoacoustic spectroscopy: application to the measurement of blood oxygenation and haemoglobin concentration

Energy Technology Data Exchange (ETDEWEB)

Laufer, Jan; Delpy, Dave; Elwell, Clare; Beard, Paul [Department of Medical Physics and Bioengineering, University College London, Malet Place Engineering Building, London WC1E 6BT (United Kingdom)

2007-01-07

A new approach based on pulsed photoacoustic spectroscopy for non-invasively quantifying tissue chromophore concentrations with high spatial resolution has been developed. The technique is applicable to the quantification of tissue chromophores such as oxyhaemoglobin (HbO{sub 2}) and deoxyhaemoglobin (HHb) for the measurement of physiological parameters such as blood oxygen saturation (SO{sub 2}) and total haemoglobin concentration. It can also be used to quantify the local accumulation of targeted contrast agents used in photoacoustic molecular imaging. The technique employs a model-based inversion scheme to recover the chromophore concentrations from photoacoustic measurements. This comprises a numerical forward model of the detected time-dependent photoacoustic signal that incorporates a multiwavelength diffusion-based finite element light propagation model to describe the light transport and a time-domain acoustic model to describe the generation, propagation and detection of the photoacoustic wave. The forward model is then inverted by iteratively fitting it to measurements of photoacoustic signals acquired at different wavelengths to recover the chromophore concentrations. To validate this approach, photoacoustic signals were generated in a tissue phantom using nanosecond laser pulses between 740 nm and 1040 nm. The tissue phantom comprised a suspension of intralipid, blood and a near-infrared dye in which three tubes were immersed. Blood at physiological haemoglobin concentrations and oxygen saturation levels ranging from 2% to 100% was circulated through the tubes. The signal amplitude from different temporal sections of the detected photoacoustic waveforms was plotted as a function of wavelength and the forward model fitted to these data to recover the concentrations of HbO{sub 2} and HHb, total haemoglobin concentration and SO{sub 2}. The performance was found to compare favourably to that of a laboratory CO-oximeter with measurement resolutions of {+-}3
Quantitative spatially resolved measurement of tissue chromophore concentrations using photoacoustic spectroscopy: application to the measurement of blood oxygenation and haemoglobin concentration

International Nuclear Information System (INIS)

Laufer, Jan; Delpy, Dave; Elwell, Clare; Beard, Paul

2007-01-01

A new approach based on pulsed photoacoustic spectroscopy for non-invasively quantifying tissue chromophore concentrations with high spatial resolution has been developed. The technique is applicable to the quantification of tissue chromophores such as oxyhaemoglobin (HbO 2 ) and deoxyhaemoglobin (HHb) for the measurement of physiological parameters such as blood oxygen saturation (SO 2 ) and total haemoglobin concentration. It can also be used to quantify the local accumulation of targeted contrast agents used in photoacoustic molecular imaging. The technique employs a model-based inversion scheme to recover the chromophore concentrations from photoacoustic measurements. This comprises a numerical forward model of the detected time-dependent photoacoustic signal that incorporates a multiwavelength diffusion-based finite element light propagation model to describe the light transport and a time-domain acoustic model to describe the generation, propagation and detection of the photoacoustic wave. The forward model is then inverted by iteratively fitting it to measurements of photoacoustic signals acquired at different wavelengths to recover the chromophore concentrations. To validate this approach, photoacoustic signals were generated in a tissue phantom using nanosecond laser pulses between 740 nm and 1040 nm. The tissue phantom comprised a suspension of intralipid, blood and a near-infrared dye in which three tubes were immersed. Blood at physiological haemoglobin concentrations and oxygen saturation levels ranging from 2% to 100% was circulated through the tubes. The signal amplitude from different temporal sections of the detected photoacoustic waveforms was plotted as a function of wavelength and the forward model fitted to these data to recover the concentrations of HbO 2 and HHb, total haemoglobin concentration and SO 2 . The performance was found to compare favourably to that of a laboratory CO-oximeter with measurement resolutions of ±3.8 g l -1 (±58 �
Making reasonable decisions: a qualitative study of medical decision making in the care of patients with a clinically significant haemoglobin disorder.

Science.gov (United States)

Crowther, Helen J; Kerridge, Ian

2015-10-01

Therapies utilized in patients with clinically significant haemoglobin disorders appear to vary between clinicians and units. This study aimed to investigate the processes of evidence implementation and medical decision making in the care of such patients in NSW, Australia. Using semi-structured interviews, 11 haematologists discussed their medical decision-making processes with particular attention paid to the use of published evidence. Transcripts were thematically analysed by a single investigator on a line-by-line basis. Decision making surrounding the care of patients with significant haemoglobin disorders varied and was deeply contextual. Three main determinants of clinical decision making were identified - factors relating to the patient and to their illness, factors specific to the clinician and the institution in which they were practising and factors related to the notion of evidence and to utility and role of evidence-based medicine in clinical practice. Clinicians pay considerable attention to medical decision making and evidence incorporation and attempt to tailor these to particular patient contexts. However, the patient context is often inferred and when discordant with the clinician's own contexture can lead to discomfort with decision recommendations. Clinicians strive to improve comfort through the use of experience and trustworthy evidence. © 2015 John Wiley & Sons, Ltd.
Haemoglobin status and predictors of anaemia among pregnant women in Mpigi, Uganda.

Science.gov (United States)

Ononge, Sam; Campbell, Oona; Mirembe, Florence

2014-10-10

Anaemia in pregnancy is a major public health problem especially in the low-income countries where it is highly prevalent. There has been no recent study in Uganda about the factors associated with anaemia in pregnancy. We aimed to assess the current haemoglobin (Hb) status and factors associated with anaemia (Hb anaemia were estimated using linear and logistic regression analysis. The mean Hb was 11.5 (± 1.38) g/dl and prevalence of anaemia (Hb anaemia in pregnancy were malaria infection (OR: 1.32, 95% CI: 1.11, 1.58), Human Immuno-deficiency Virus infection (OR: 2.13, 95% CI: 1.36, 2.90) and lack of iron supplementation (OR: 1.66, 95% CI: 1.36, 2.03). Intermittent presumptive treatment of malaria, maternal age and parity showed a weak association with anaemia in pregnancy The high prevalence of anaemia in pregnancy in our setting highlights the need to put more effort in the fight against malaria and HIV, and also ensure that pregnant women access iron supplements early in pregnancy.

Haemoglobin modulates NO emission and hyponasty under hypoxia-related stress in Arabidopsis thaliana

DEFF Research Database (Denmark)

Hebelstrup, Kim; van Zanten, Martijn; Mandon, Julien

2012-01-01

Nitric oxide (NO) and ethylene are signalling molecules that are synthesized in response to oxygen depletion. Non-symbiotic plant haemoglobins (Hbs) have been demonstrated to act in roots under oxygen depletion to scavenge NO. Using Arabidopsis thaliana plants, the online emission of NO or ethylene...... was directly quantified under normoxia, hypoxia (0.1–1.0% O2), or full anoxia. The production of both gases was increased with reduced expression of either of the Hb genes GLB1 or GLB2, whereas NO emission decreased in plants overexpressing these genes. NO emission in plants with reduced Hb gene expression......-nitrosylated compounds, and it is demonstrated that hypoxia substantially increased the content of S-nitrosylated compounds. A parallel up-regulation of Hb gene expression in the normoxic shoots of the flooded plants may reflect signal transmission from root to shoot via ethylene and a role for Hb in the shoots. Hb gene...
HAEMOGLOBIN LEVEL AS A RISK FACTOR FOR LOWER RESPIRATORY TRACT INFECTIONS

Directory of Open Access Journals (Sweden)

Harishchandra Venkata Yanamandala

2017-06-01

Full Text Available BACKGROUND Lower Respiratory Tract Infection (LRTI is an inflammation of the airways, pulmonary tissue below the larynx level. Children who are below 5 years of age suffer about 5-6 episodes of LRTI per year on an average. 1,2 The largest cause of death in children worldwide is pneumonia. If the haemoglobin level is below 11 g/dL 3 , then the child is considered as anaemic. In children, LRTIs associated with anaemia occur more commonly than in adults. Pneumonia kills about an estimated 1.1 million children under the age of 5 years old worldwide. It is more prevalent in South East Asia and Africa. 3,4,5 Anaemia is a condition in which the number of RBCs is very low to meet the body’s physiologic needs. The most common cause of anaemia is deficiency of iron. In both developing and developed countries, anaemia is a common health problem. This study is a prospective study, which was conducted to assess the low haemoglobin level as a risk factor for developing LRTI in children. MATERIALS AND METHODS This is a prospective study, which was conducted in 75 children who attended the outpatient unit of Department of Paediatrics, Gitam Institute of Medical Sciences and Research. It was conducted during the period between December 2015 to December 2016. By the symptoms and signs, pneumonia was diagnosed. Exclusion Criteria- Children who had congenital malformations of chest wall, severe systemic illness and protein malfunction. All children’s height and weight were recorded to assess the nutritional status. RESULTS C-Reactive Protein Estimation (CRP was more than 6 mg/L in 34 (45.3% patients in the study group, 11 (14.7% in the control group. Mantoux test was positive for 17 (22.6% among study group and none in the control group. Pneumonia as per radiological evidence was present in 49 (65.3% and hyperinflation of lungs in 26 (34.7% among the study group. X-ray reports were normal in 8 cases (10.7%. Age was not found to be a significant factor, which
Maternal glycated haemoglobin, pre-gestational weight, pregnancy weight gain and risk of large-for-gestational-age babies: a Danish cohort study of 209 singleton Type 1 diabetic pregnancies

DEFF Research Database (Denmark)

Nielsen, Gunnar Lauge; Dethlefsen, Claus; Møller, Anna Margrethe

2007-01-01

between glycated haemoglobin (HbA1c) and relative risk of delivering an LGA baby was quantified based on logistic regression models and stratified analysis controlling for the five covariates. Results We included 209 singleton pregnancies with assessable HbA1c values of which 59% [95% confidence interval......Aims To examine the association between maternal glycated haemoglobin in the second half of diabetic pregnancies and the relative risk of delivering large-for-gestational-age (LGA) babies, controlling for maternal body mass index (BMI) before pregnancy, weight gain, age, White class and smoking...... (CI) 52-65%] terminated with an LGA baby. Increasing levels of HbA1c, BMI and weight gain were all associated with increasing risk of delivering an LGA baby. Analyses stratified according to maternal BMI showed that the association between HbA1c and risk of delivering an LGA baby was restricted...
Adaptation to extreme environments: structure-function relationships in Emperor penguin haemoglobin.

Science.gov (United States)

Tamburrini, M; Condò, S G; di Prisco, G; Giardina, B

1994-04-15

The functional properties of the single haemoglobin (Hb) of Emperor penguin (Aptenodytes forsteri) have been investigated at different temperatures as a function of proton and organic phosphate concentration. The complete amino acid sequence has been established. Comparison with that of human HbA shows 12 substitutions in the contact regions of alpha beta dimers. In addition to overall similarities shared with most of the avian Hbs previously described, this Hb shows significant differences, which could be related to the peculiar behaviour of this penguin. In particular we may consider that: (1) the shape of the Bohr effect curve seems well adapted for gas exchange during very prolonged dives, preserving penguin Hb from a sudden and not controlled stripping of oxygen; (2) the very minor enthalpy change observed at lower pH could be an example of molecular adaptation, through which oxygen delivery becomes essentially insensitive to exposure to the extremely low temperatures of the environment. Moreover, the small alkaline Bohr effect has been found to be only chloride-linked, since the pH dependence of the oxygen affinity is totally abolished in the absence of this ion. These functional characteristics are discussed on the basis of the primary structure of alpha and beta-chains.
Position statement of the Australian Diabetes Society: individualisation of glycated haemoglobin targets for adults with diabetes mellitus.

Science.gov (United States)

Cheung, N Wah; Conn, Jennifer J; d'Emden, Michael C; Gunton, Jenny E; Jenkins, Alicia J; Ross, Glynis P; Sinha, Ashim K; Andrikopoulos, Sofianos; Colagiuri, Stephen; Twigg, Stephen M

2009-09-21

Tight glycaemic control reduces the risk of development and progression of organ complications in people with type 1 or type 2 diabetes. In this position statement, the Australian Diabetes Society recommends a general target glycated haemoglobin (HbA(1c)) level of position statement also provides guidelines for the individualisation of glycaemic targets to a tighter or lesser degree, with a recommended target HbA(1c) level of diabetes and its duration, pregnancy, diabetes medication being taken, presence of cardiovascular disease, risk of and problems from hypoglycaemia, and comorbidities. Management of diabetes also includes: adequate control of other cardiovascular risk factors, including weight, blood pressure and lipid serum levels; antiplatelet therapy; and smoking cessation.
The effects of an overnight holding of whole blood at room temperature on haemoglobin modification and in vitro markers of red blood cell aging.

Science.gov (United States)

Eckstein, M; Zimmermann, R; Roth, T; Hauck-Dlimi, B; Strasser, E F; Xiang, W

2015-05-01

Some effects of the red blood cell (RBC) storage lesion are well documented whereas others are not. Whether a period of room temperature hold (RTH) during RBC production enhances the RBC storage lesion has remained controversial. In this study, we compared whole blood (WB)-derived RBCs produced after 24-h RTH with rapidly cooled (RC) RBCs and tested them for classical metabolic markers and signs of oxidative damage. SAGM-RBCs were prepared from mixed and split pairs (n = 12) of WB units. RBCs prepared after a 24-h period of RTH on day+1 after collection (RTH-RBCs) were compared with RC-RBCs. All RBCs were stored at 4°C for 42 days with assay of in vitro variables on days+1, +15, +22, +29 and +42. The study examined standard quality parameters, glutathione, catalase and superoxide dismutase (SOD) activities, and indicative markers of oxidative cell damage including post-translational haemoglobin modification, malondialdehyde (MDA), and phosphatidylserine expression. RTH-RBCs exhibited decreased levels of potassium (1·98 ± 0·26 vs. 5·23 ± 0·65 mmol/l) and of 2,3-diphosphoglycerate (2,3-DPG) on day+1 compared with RC-RBCs. Haemolysis rate on day+42 was higher in RTH-RBCs than in RC-RBCs (0·52 ± 0·13 vs. 0·37 ± 0·12%). The phosphatidylserine expression amounted to 0·25 ± 0·20% in RTH-RBCs and 0·07 ± 0·12% in RC-RBCs. Haemoglobin modification was not different between both RBC groups. RTH-RBCs showed slightly higher MDA concentration on days +29 and +42. RC-RBCs and RTH-RBCs show only small differences of classical in vitro parameters and no relevant differences in antioxidative metabolism and oxidative haemoglobin modification. These findings do not explain the loss observed in in vivo survival studies with RBCs. © 2015 International Society of Blood Transfusion.
Validation of the Hemo_Control instrument for determination of B-haemoglobin concentration in primary health care

DEFF Research Database (Denmark)

Aakre, Kristin; Bliksrud, Yngve; Frøyshov, Bess

2009-01-01

of the Hemo_Control instrument were calculated after measuring the concentration of venous samples under standardized conditions; by experienced laboratory technicians in a hospital laboratory, and venous and capillary samples under conditions similar to where the instrument is intended for use; by personnel...... was lower than the quality goal of +/- 5% considered acceptable for patient care. High within series imprecision (5.5%) was observed for measurements of capillary blood samples in one of the primary care centres, whereas adequate analytical performance was obtained at the other centre. The Hemo_Control......OBJECTIVE: The aim of this study was to evaluate the analytical performance of a new portable haemoglobinometer, Hemo_Control (EKF-diagnostic, GmbH, Germany), which measures haemoglobin concentration in venous and capillary samples. METHOD: The within series and between series imprecision...
Plasma dynamics near critical density inferred from direct measurements of laser hole boring

Science.gov (United States)

Gong, Chao; Tochitsky, Sergei Ya.; Fiuza, Frederico; Pigeon, Jeremy J.; Joshi, Chan

2016-06-01

We have used multiframe picosecond optical interferometry to make direct measurements of the hole boring velocity, vHB, of the density cavity pushed forward by a train of C O2 laser pulses in a near critical density helium plasma. As the pulse train intensity rises, the increasing radiation pressure of each pulse pushes the density cavity forward and the plasma electrons are strongly heated. After the peak laser intensity, the plasma pressure exerted by the heated electrons strongly impedes the hole boring process and the vHB falls rapidly as the laser pulse intensity falls at the back of the laser pulse train. A heuristic theory is presented that allows the estimation of the plasma electron temperature from the measurements of the hole boring velocity. The measured values of vHB, and the estimated values of the heated electron temperature as a function of laser intensity are in reasonable agreement with those obtained from two-dimensional numerical simulations.
Activating mitochondrial function and haemoglobin expression with EH-201, an inducer of erythropoietin in neuronal cells, reverses memory impairment.

Science.gov (United States)

Horng, Lin-Yea; Hsu, Pei-Lun; Chen, Li-Wen; Tseng, Wang-Zou; Hsu, Kai-Tin; Wu, Chia-Ling; Wu, Rong-Tsun

2015-10-01

Memory impairment can be progressive in neurodegenerative diseases, and physiological ageing or brain injury, mitochondrial dysfunction and oxidative stress are critical components of these issues. An early clinical study has demonstrated cognitive improvement during erythropoietin treatment in patients with chronic renal failure. As erythropoietin cannot freely cross the blood-brain barrier, we tested EH-201 (2,3,5,4'-tetrahydroxystilbene-2-O-β-d-glucoside, also known as TSG), a low MW inducer of erythropoietin, for its therapeutic effects on memory impairment in models of neurodegenerative diseases, physiological ageing or brain injury. The effects of EH-201 were investigated in astrocytes and PC12 neuronal-like cells. In vivo, we used sleep-deprived (SD) mice as a stress model, amyloid-β (Aβ)-injected mice as a physiological ageing model and kainic acid (KA)-injected mice as a brain damage model to assess the therapeutic effects of EH-201. EH-201 induced expression of erythropoietin, PPAR-γ coactivator 1α (PGC-1α) and haemoglobin in astrocytes and PC12 neuronal-like cells. In vivo, EH-201 treatment restored memory impairment, as assessed by the passive avoidance test, in SD, Aβ and KA mouse models. In the hippocampus of mice given EH-201 in their diet, levels of erythropoietin, PGC-1α and haemoglobin were increased The induction of endogenous erythropoietin in neuronal cells by inducers such as EH-201 might be a therapeutic strategy for memory impairment in neurodegenerative disease, physiological ageing or traumatic brain injury. © 2015 The Authors. British Journal of Pharmacology published by John Wiley & Sons Ltd on behalf of The British Pharmacological Society.
Recombinant bacterial hemoglobin alters metabolism of Aspergillus niger

DEFF Research Database (Denmark)

Hofmann, Gerald; Diano, Audrey; Nielsen, Jens

2009-01-01

, the fungus will produce various by-products like organic acids and polyols. In order to circumvent this problem we here study the effects of the expression of a bacterial hemoglobin protein on the metabolism of A. niger. We integrated the vgb gene from Vitreoscilla sp. into the genome at the pyrA locus...
Conference on Logistics Management : Contributions of the Section Logistics of the German Academic Association for Business Research

CERN Document Server

Spengler, Thomas; Brinkmann, Jan; Grunewald, Martin

2016-01-01

This contributed volume contains the selected and thoroughly reviewed research papers presented at the conference on logistics management LM2015 in Braunschweig, Germany. The conference of the special interest group in logistics of the German Academic Association for Business Research (VHB) was held in conjunction with the special interest group on production of the VHB. Thus, the papers reflect the current state-of-the-art in logistics and supply chain management while focusing especially on aspects of production logistics, i.e., facility layout, inventory management, line configuration, or flexible production.
Measuring glycated haemoglobin in women with gestational diabetes mellitus: How useful is it?

Science.gov (United States)

Wong, Vincent W; Chong, Shanley; Mediratta, Sahil; Jalaludin, Bin

2017-06-01

Glycated haemoglobin (HbA1c) is an important tool for assessing glycaemic status in patients with diabetes, but its usefulness in gestational diabetes mellitus (GDM), is unclear. The aim of this study is to evaluate whether HbA1c in women with GDM is valuable in predicting adverse pregnancy outcomes. A retrospective review of women with GDM who had HbA1c measured at diagnosis of GDM (GHb-diag) and at 36 weeks gestation (GHb-36 weeks) was conducted. The association between HbA1c and various pregnancy outcomes was assessed RESULTS: Among 1244 women with GDM in our cohort, both GHb-diag and GHb-36 weeks were independent predictors for large-for-gestation (LGA) babies (OR 1.06, P = 0.005 and OR 1.06, P = 0.002, respectively) and neonatal hypoglycaemia (OR 1.10, P 5.4% or 35 mmol/mol) at diagnosis of GDM should be monitored closely during pregnancy. However, there is not enough evidence to suggest that repeating HbA1c toward the end of pregnancy will provide additional information in predicting adverse pregnancy outcomes. © 2016 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.
Targeting, Monitoring and Effect of Oral Iron Therapy on Haemoglobin Levels in Older Patients Discharged to Primary Care from Inpatient Rehabilitation: A Cohort Study Using Routinely Collected Data.

Science.gov (United States)

Thomson, Zach; Hands, Katherine J; Witham, Miles D

2016-08-01

Oral iron is commonly prescribed to older patients with suspected or confirmed iron-deficiency anaemia; however, few studies have examined the effectiveness of oral iron therapy in the real world in this population. We therefore determined the prevalence of iron deficiency in older people prescribed oral iron, examined the response mounted to therapy and ascertained predictors of response to oral iron. We analysed a routinely collected, linked dataset from older patients who had undergone inpatient rehabilitation between 1999 and 2011. An initial analysis examined patients within this cohort who were prescribed iron after rehabilitation and derived three groups based upon their ferritin and transferrin indices: probably, possibly and not iron deficient. A second analysis compared pre- and post-treatment haemoglobin to determine the degree of response to iron therapy across each category of deficiency. Finally, patient demographics, linked biochemistry data and comorbid disease based on International Classification of Disease (ICD-10) codes from previous hospital admissions were used in regression modelling to evaluate factors affecting response to therapy. A total of 490 patients were prescribed oral iron within 90 days of rehabilitation discharge. Of these, 413 (84 %) had iron indices performed; 94 (23 %) were possibly deficient, 224 (54 %) were probably deficient, and 95 (23 %) were not deficient. Of the 490 patients, 360 had both pre- and post-treatment haemoglobin data and iron indices; probably deficient patients mounted a slightly greater response to oral iron (17 vs. 12 g/L for not deficient; p < 0.05). Only pre-treatment haemoglobin, mean cell volume and lower gastrointestinal pathology were significant predictors of a response to oral iron therapy. Notably, acid-suppressant use was not a predictor of response. We conclude that many older patients are exposed to oral iron without good evidence of either iron deficiency or a significant response to
[Peroxynitrite effect on the haemoglobin oxygen affinity in vitro in presence of different partial pressure of carbon dioxide].

Science.gov (United States)

Stepuro, T L; Zinchuk, V V

2011-08-01

Peroxynitrite (ONOO-) besides its toxic possesses regulatory action that includes the modulation of oxygen binding properties of blood. The aim of this work was to estimate ONOO- effect on the haemoglobin oxygen affinity (HOA) in vitro in presence of different partial pressure of carbon dioxide (CO2). The ONOO- presence in venous blood in conditions of hypercapnia induced oxyhaemoglobin dissociation curve shift leftward while in hypocapnic conditions the result of a different character was obtained. The revealed effect of ONOO- is realized, possibly, through various modifications ofhaemoglobin whose formation is dependent on the CO2 pressure. The ONOO- influences the HOA in different manner that can be important in regulation of blood oxygenation in lungs and maintenance of oxygen consumption in tissues.
Influencia sobre parámetros biológicos de Tagosodes orizicolus relacionados con el Virus Hoja Blanca y su permanencia en invernaderos.

Directory of Open Access Journals (Sweden)

Rafael Meneses

2007-03-01

Full Text Available Con el objetivo de determinar la influencia que ejerce el Virus Hoja Blanca (VHB sobre el insecto, se estudiaron tres colonias de T. orizicolus, procedentes de diferentes zonas arroceras de Colombia (Tolima, Costa y Jamundí En las colonias de Costa (3 años y Tolima, (9 meses, de multiplicación en condiciones semicontroladas de invernadero, no se encontró influencia negativa del virus en la longevidad de machos y hembras, y la fecundidad diaria, no ocurriendo de modo semejante en los insectos de Jamundí (4 meses que si se manifestaron efectos deletéreos en todos los parámetros antes señalados; aspecto éste muy importante en la interacción entre entomólogos, virólogos y mejoradores, en la calidad de las evaluaciones de resistencia a esta plaga y al VHB de las líneas de arroz, depende el grado de resistencia o susceptibilidad de la nuevas variedades comerciales y éste es el principal factor en el Manejo Integrado de T. orizicolus y del VHB.
Preferred temperature of juvenile Atlantic cod Gadus morhua with different haemoglobin genotypes at normoxia and moderate hypoxia

DEFF Research Database (Denmark)

Petersen, M.F.; Steffensen, J.F.

2003-01-01

.2+/-1.5 degrees C while HbI-1 cod preferred 15.4+/-1.1 degrees C, and this preference was significant. The effect of hypoxia (35% oxygen saturation) on the preferred temperature was also measured. Previous studies showed that the preferred temperature of fish decreases during hypoxia, and this was the case for Hb......I-1 cod, which preferred 9.8+/-1.8 degrees C during hypoxia, whereas HbI-2 cod did not show this effect. The results indicate that environmental temperature changes will lead to a distributional change in the different haemoglobin types of Atlantic cod, global warming providing an advantage for HbI-1...... cod. However, since HbI-1 cod prefer a low temperature under hypoxic conditions, a combination of increased water temperature and hypoxia could be unfavourable for Atlantic cod stocks....
Microeconomic loans and health education to families in impoverished communities: implications for the HIV pandemic.

Science.gov (United States)

Sherer, Renslow D; Bronson, John D; Teter, Caroline J; Wykoff, Randolph F

2004-01-01

Poverty is among the root causes of death and poor health worldwide. Project HOPE's Village Health Bank (VHB) program is a public health intervention that combines integrated microcredit lending and health education. Groups of 18 to 25 women receive small loans, and biweekly, one-hour health education sessions. Since 1993, about 50,000 women in 949 VHBs have participated in seven countries in the Americas, Africa, and Southeast Asia, receiving more than US$25 million in loans and 8,445 hours of health education. Members of VHBs are charged modest interest rates that enable them to become self-sufficient (eg, able to cover all operating charges, including the costs of the health education staff, and the necessary loan capital to continue without infusion of outside resources). The VHB program produces substantial economic improvements for individuals and groups, and benefits in health knowledge and behaviors, including increased utilization of healthcare services. Data from Guatemala, Malawi, and Thailand demonstrate that VHBs in countries with high HIV prevalence have been comparably successful in spite of the enormous added burdens of chronic illness, deaths, and orphans in need of support. For example, in 2004, 48 percent of 266 VHB members in Malawi experienced at least one death in their household in the preceding year, and 67 percent housed one or more orphans with an average of two orphans per household. Because of the unique combination of increased household economic stability and improved health knowledge, the VHB program is now being adapted to families of people affected by HIV/AIDS, including orphans.
Glycated haemoglobin (HbA1c ) and fasting plasma glucose relationships in sea-level and high-altitude settings.

Science.gov (United States)

Bazo-Alvarez, J C; Quispe, R; Pillay, T D; Bernabé-Ortiz, A; Smeeth, L; Checkley, W; Gilman, R H; Málaga, G; Miranda, J J

2017-06-01

Higher haemoglobin levels and differences in glucose metabolism have been reported among high-altitude residents, which may influence the diagnostic performance of HbA 1c . This study explores the relationship between HbA 1c and fasting plasma glucose (FPG) in populations living at sea level and at an altitude of > 3000 m. Data from 3613 Peruvian adults without a known diagnosis of diabetes from sea-level and high-altitude settings were evaluated. Linear, quadratic and cubic regression models were performed adjusting for potential confounders. Receiver operating characteristic (ROC) curves were constructed and concordance between HbA 1c and FPG was assessed using a Kappa index. At sea level and high altitude, means were 13.5 and 16.7 g/dl (P > 0.05) for haemoglobin level; 41 and 40 mmol/mol (5.9% and 5.8%; P < 0.01) for HbA 1c ; and 5.8 and 5.1 mmol/l (105 and 91.3 mg/dl; P < 0.001) for FPG, respectively. The adjusted relationship between HbA 1c and FPG was quadratic at sea level and linear at high altitude. Adjusted models showed that, to predict an HbA 1c value of 48 mmol/mol (6.5%), the corresponding mean FPG values at sea level and high altitude were 6.6 and 14.8 mmol/l (120 and 266 mg/dl), respectively. An HbA 1c cut-off of 48 mmol/mol (6.5%) had a sensitivity for high FPG of 87.3% (95% confidence interval (95% CI) 76.5 to 94.4) at sea level and 40.9% (95% CI 20.7 to 63.6) at high altitude. The relationship between HbA 1c and FPG is less clear at high altitude than at sea level. Caution is warranted when using HbA 1c to diagnose diabetes mellitus in this setting. © 2017 The Authors. Diabetic Medicine published by John Wiley & Sons Ltd on behalf of Diabetes UK.
Declinaisons militaires francaises des directives europeennes en matiere d’hemovigilance (French European Military Haemovigilance Guidelines)

Science.gov (United States)

2010-11-03

du groupe sanguin A B O D et d’un dépistage du VIH et du VHC. Sauf exception (donneur originaire de zones endémiques pour le VHB, non contrôlé avant...réalisées les sérologies VIH , VHC et VHB pré-transfusionnelles. Pour fiabiliser cette procédure assez complexe, le CTSA assure la formation...sont contrôlés pour le VIH avant le départ en mission. Enfin, sur le terrain, les aphé- rèses sont pratiquées sur des donneurs réguliers. A
Bilirubin concentration is positively associated with haemoglobin concentration and inversely associated with albumin to creatinine ratio among Indigenous Australians: eGFR Study.

Science.gov (United States)

Hughes, J T; Barzi, F; Hoy, W E; Jones, G R D; Rathnayake, G; Majoni, S W; Thomas, M A B; Sinha, A; Cass, A; MacIsaac, R J; O'Dea, K; Maple-Brown, L J

2017-12-01

Low serum bilirubin concentrations are reported to be strongly associated with cardio-metabolic disease, but this relationship has not been reported among Indigenous Australian people who are known to be at high risk for diabetes and chronic kidney disease (CKD). serum bilirubin will be negatively associated with markers of chronic disease, including CKD and anaemia among Indigenous Australians. A cross-sectional analysis of 594 adult Aboriginal and Torres Strait Islander (TSI) people in good health or with diabetes and markers of CKD. Measures included urine albumin: creatinine ratio (ACR), estimated glomerular filtration rate (eGFR), haemoglobin (Hb) and glycated haemoglobin (HbA1c). Diabetes was defined by medical history, medications or HbA1c≥6.5% or ≥48mmol/mol. Anaemia was defined as Hbbilirubin was performed. Participants mean (SD) age was 45.1 (14.5) years, and included 62.5% females, 71.7% Aboriginal, 41.1% with diabetes, 16.7% with anaemia, 41% with ACR>3mg/mmol and 18.2% with eGFRbilirubin concentration was lower in females than males (6 v 8μmol/L, pbilirubin; Hb and cholesterol (both positively related) and ACR, triglycerides, Aboriginal ethnicity and female gender (all inversely related). Serum bilirubin concentrations were positively associated with Hb and total cholesterol, and inversely associated with ACR. Further research to determine reasons explaining lower bilirubin concentrations among Aboriginal compared with TSI participants are needed. Copyright © 2017 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

Alpha- and beta-cell abnormalities in haemoglobin A1c-defined prediabetes and type 2 diabetes

DEFF Research Database (Denmark)

Calanna, Salvatore; Scicali, Roberto; Di Pino, Antonino

2014-01-01

New recommendations for the use of glycated haemoglobin A1c (HbA1c) to diagnose prediabetes and type 2 diabetes have changed the constitution of the two populations. We aimed to investigate the pathophysiological characteristics of individuals with HbA1c-defined prediabetes and type 2 diabetes......, respectively. Ten subjects with HbA1c-defined prediabetes, i.e. HbA1c from 5.7 to 6.4 % (39-46 mmol/mol), eight newly diagnosed patients with HbA1c-defined type 2 diabetes [HbA1c ≥6.5 % (≥48 mmol/mol)], and ten controls with HbA1c lower than 5.7 % (.... Subjects with HbA1c-defined prediabetes showed significantly lower insulinogenic index (P = 0.02), disposition index (P = 0.001), and glucagon suppression compared with controls; and similar (P = NS) insulinogenic index and glucagon suppression and higher disposition index (P = 0.02) compared to HbA1c...
Relationship between changes in haemoglobin mass and maximal oxygen uptake after hypoxic exposure.

Science.gov (United States)

Saunders, Philo U; Garvican-Lewis, Laura A; Schmidt, Walter F; Gore, Christopher J

2013-12-01

Endurance athletes have been using altitude training for decades to improve near sea-level performance. The predominant mechanism is thought to be accelerated erythropoiesis increasing haemoglobin mass (Hb(mass)) resulting in a greater maximal oxygen uptake (VO₂(max)). Not all studies have shown a proportionate increase in VO₂(max) as a result of increased Hb(mass). The aim of this study was to determine the relationship between the two parameters in a large group of endurance athletes after altitude training. 145 elite endurance athletes (94 male and 51 female) who participated in various altitude studies as altitude or control participants were used for the analysis. Participants performed Hb(mass) and VO₂(max) testing before and after intervention. For the pooled data, the correlation between per cent change in Hb(mass) and per cent change in VO₂(max) was significant (pstatistical power, we conclude that altitude training of endurance athletes will result in an increase in VO₂(max) of more than half the magnitude of the increase in Hb(mass), which supports the use of altitude training by athletes. But race performance is not perfectly related to relative VO₂(max), and other non-haematological factors altered from altitude training, such as running economy and lactate threshold, may also be beneficial to performance.
Reference Ranges of Reticulocyte Haemoglobin Content in Preterm and Term Infants: A Retrospective Analysis.

Science.gov (United States)

Lorenz, Laila; Peter, Andreas; Arand, Jörg; Springer, Fabian; Poets, Christian F; Franz, Axel R

2017-01-01

Despite iron supplementation, some preterm infants develop iron deficiency (ID). The optimal iron status parameter for early detection of ID has yet to be determined. To establish reference ranges for reticulocyte haemoglobin content (Ret-He) in preterm and term infants and to identify confounding factors. Retrospective analyses of Ret-He and complete blood count in infants with a clinically indicated blood sample obtained within 24 h after birth. Mean (SD) Ret-He was 30.7 (3.0) pg in very preterm infants with a gestational age (GA) of pH (r = -0.07). There was a slight variation in Ret-He with mode of delivery [normal vaginal delivery: 32.3 (3.2) pg, secondary caesarean section (CS): 31.4 (3.0) pg, instrumental delivery: 31.3 (2.7) pg and elective CS: 31.2 (2.8) pg]. GA at birth has a negligible impact on Ret-He, and the lower limit of the normal reference range in newborns within 24 h after birth can be set to 25 pg. Moreover, Ret-He seems to be a robust parameter which is not influenced by perinatal factors within the first 24 h after birth. © 2016 S. Karger AG, Basel.
The predictive value of current haemoglobin levels for incident tuberculosis and/or mortality during long-term antiretroviral therapy in South Africa: a cohort study.

Science.gov (United States)

Kerkhoff, Andrew D; Wood, Robin; Cobelens, Frank G; Gupta-Wright, Ankur; Bekker, Linda-Gail; Lawn, Stephen D

2015-04-02

Low haemoglobin concentrations may be predictive of incident tuberculosis (TB) and death in HIV-infected patients receiving antiretroviral therapy (ART), but data are limited and inconsistent. We examined these relationships retrospectively in a long-term South African ART cohort with multiple time-updated haemoglobin measurements. Prospectively collected clinical data on patients receiving ART for up to 8 years in a community-based cohort were analysed. Time-updated haemoglobin concentrations, CD4 counts and HIV viral loads were recorded, and TB diagnoses and deaths from all causes were ascertained. Anaemia severity was classified using World Health Organization criteria. TB incidence and mortality rates were calculated and Poisson regression models were used to identify independent predictors of incident TB and mortality, respectively. During a median follow-up of 5.0 years (IQR, 2.5-5.8) of 1,521 patients, 476 cases of incident TB and 192 deaths occurred during 6,459 person-years (PYs) of follow-up. TB incidence rates were strongly associated with time-updated anaemia severity; those without anaemia had a rate of 4.4 (95%CI, 3.8-5.1) cases/100 PYs compared to 10.0 (95%CI, 8.3-12.1), 26.6 (95%CI, 22.5-31.7) and 87.8 (95%CI, 57.0-138.2) cases/100 PYs in those with mild, moderate and severe anaemia, respectively. Similarly, mortality rates in those with no anaemia or mild, moderate and severe time-updated anaemia were 1.1 (95%CI, 0.8-1.5), 3.5 (95%CI, 2.7-4.8), 11.8 (95%CI, 9.5-14.8) and 28.2 (95%CI, 16.5-51.5) cases/100 PYs, respectively. Moderate and severe anaemia (time-updated) during ART were the strongest independent predictors for incident TB (adjusted IRR = 3.8 [95%CI, 3.0-4.8] and 8.2 [95%CI, 5.3-12.7], respectively) and for mortality (adjusted IRR = 6.0 [95%CI, 3.9-9.2] and adjusted IRR = 8.0 [95%CI, 3.9-16.4], respectively). Increasing severity of anaemia was associated with exceptionally high rates of both incident TB and mortality during
Séroprévalence des marqueurs viraux sur les dons du sang au Centre de Transfusion Sanguine, Hôpital Militaire d’Instruction Mohammed V de Rabat

Science.gov (United States)

Uwingabiye, Jean; Zahid, Hafidi; Unyendje, Loubet; Hadef, Rachid

2016-01-01

Le but de ce travail était de déterminer la prévalence du virus de l’immunodéficience humaine (VIH), du virus de l’hépatite B (VHB) et C (VHC) sur les dons du sang collectés au Centre de transfusion sanguine(CTS) de l’hôpital militaire d’instruction Mohammed V entre 2010 et 2012. Etude rétrospective menée auprès des donneurs de sang militaires âgés de 18 à 50 ans avec prédominance masculine (95%). L’entretien médical pré-don constitue la première barrière de sélection des sujets à risque. Le dépistage biologique était réalisé par technique immuno-enzymatique en milieu liquide utilisant des anticorps et/ou des antigènes. L’ELISA (enzyme linked immuno-sorbent assay) combiné de quatrième génération pour VHC et VIH a été utilisé. La confirmation a été faite en réalisant la même technique en double au CTS et au laboratoire de virologie. Dans notre série de 25661 échantillons testés, la prévalence du VHB était 3,97‰ (n=102), celle de VHC était 2,45 ‰ (n=63), celle de VIH était 0,15 ‰ (n=4). Un seul cas de coïnfection (0,039 ‰) par le VHB et VHC a été noté, aucune association entre VIH-VHB, VIH-VHC ou VHB, VHC et VIH n’a été enregistrée. Les taux faibles de séroprévalence des marqueurs viraux de notre étude montrent l’amélioration des mesures préventives en ce qui concerne la sélection des donneurs et des tests de dépistage. Cette prévalence constatée incite à maintenir l’utilisation du réactif combiné qui est la seule alternative à la biologie moléculaire pour les pays en voie de développement. PMID:28292147
Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

NARCIS (Netherlands)

Prins, M.; van Leeuwen, M.W.; Teske, E.

2009-01-01

Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.
Effects of nitrite exposure on functional haemoglobin levels, bimodal respiration, and swimming performance in the facultative air-breathing fish Pangasianodon hypophthalmus

Energy Technology Data Exchange (ETDEWEB)

Lefevre, Sjannie, E-mail: sjannie.lefevre@biology.au.dk [Zoophysiology, Department of Biological Sciences, Aarhus University, Aarhus (Denmark); Jensen, Frank B. [Department of Biology, University of Southern Denmark, Odense (Denmark); Huong, Do.T.T. [College of Aquaculture and Fisheries, Can Tho University, Can Tho City (Viet Nam); Wang, Tobias [Zoophysiology, Department of Biological Sciences, Aarhus University, Aarhus (Denmark); Phuong, Nguyen T. [College of Aquaculture and Fisheries, Can Tho University, Can Tho City (Viet Nam); Bayley, Mark [Zoophysiology, Department of Biological Sciences, Aarhus University, Aarhus (Denmark)

2011-07-15

In this study we investigated nitrite (NO{sub 2}{sup -}) effects in striped catfish, a facultative air-breather. Fish were exposed to 0, 0.4, and 0.9 mM nitrite for 0, 1, 2, 4, and 7 days, and levels of functional haemoglobin, methaemoglobin (metHb) and nitrosyl haemoglobin (HbNO) were assessed using spectral deconvolution. Plasma concentrations of nitrite, nitrate, chloride, potassium, and sodium were also measured. Partitioning of oxygen consumption was determined to reveal whether elevated metHb (causing functional hypoxia) induced air-breathing. The effects of nitrite on maximum oxygen uptake (MO{sub 2max}) and critical swimming speed (U{sub crit}) were also assessed. Striped catfish was highly tolerant to nitrite exposure, as reflected by a 96 h LC{sub 50} of 1.65 mM and a moderate nitrite uptake into the blood. Plasma levels of nitrite reached a maximum after 1 day of exposure, and then decreased, never exceeding ambient levels. MetHb, HbNO and nitrate (a nitrite detoxification product) also peaked after 1 day and then decreased. Only high levels of nitrite and metHb caused reductions in MO{sub 2max} and U{sub crit}. The response of striped catfish contrasts with that seen in most other fish species and discloses efficient mechanisms of combating nitrite threats. Furthermore, even though striped catfish is an efficient air-breather, this species has the ability to sustain aerobic scope and swimming performance without air-breathing, even when faced with nitrite-induced reductions in blood oxygen carrying capacity. Our study is the first to confirm that high levels of nitrite and metHb reduce MO{sub 2max} and thereby aerobic scope, while more moderate elevations fail to do so. Further studies are needed to elucidate the mechanisms underlying the low nitrite accumulation in striped catfish.
Effects of nitrite exposure on functional haemoglobin levels, bimodal respiration, and swimming performance in the facultative air-breathing fish Pangasianodon hypophthalmus.

Science.gov (United States)

Lefevre, Sjannie; Jensen, Frank B; Huong, Do T T; Wang, Tobias; Phuong, Nguyen T; Bayley, Mark

2011-07-01

In this study we investigated nitrite (NO₂⁻) effects in striped catfish, a facultative air-breather. Fish were exposed to 0, 0.4, and 0.9 mM nitrite for 0, 1, 2, 4, and 7 days, and levels of functional haemoglobin, methaemoglobin (metHb) and nitrosyl haemoglobin (HbNO) were assessed using spectral deconvolution. Plasma concentrations of nitrite, nitrate, chloride, potassium, and sodium were also measured. Partitioning of oxygen consumption was determined to reveal whether elevated metHb (causing functional hypoxia) induced air-breathing. The effects of nitrite on maximum oxygen uptake (MO(2max)) and critical swimming speed (U(crit)) were also assessed. Striped catfish was highly tolerant to nitrite exposure, as reflected by a 96 h LC₅₀ of 1.65 mM and a moderate nitrite uptake into the blood. Plasma levels of nitrite reached a maximum after 1 day of exposure, and then decreased, never exceeding ambient levels. MetHb, HbNO and nitrate (a nitrite detoxification product) also peaked after 1 day and then decreased. Only high levels of nitrite and metHb caused reductions in MO(2max) and U(crit). The response of striped catfish contrasts with that seen in most other fish species and discloses efficient mechanisms of combating nitrite threats. Furthermore, even though striped catfish is an efficient air-breather, this species has the ability to sustain aerobic scope and swimming performance without air-breathing, even when faced with nitrite-induced reductions in blood oxygen carrying capacity. Our study is the first to confirm that high levels of nitrite and metHb reduce MO(2max) and thereby aerobic scope, while more moderate elevations fail to do so. Further studies are needed to elucidate the mechanisms underlying the low nitrite accumulation in striped catfish. Copyright © 2011 Elsevier B.V. All rights reserved.
Effects of nitrite exposure on functional haemoglobin levels, bimodal respiration, and swimming performance in the facultative air-breathing fish Pangasianodon hypophthalmus

International Nuclear Information System (INIS)

Lefevre, Sjannie; Jensen, Frank B.; Huong, Do.T.T.; Wang, Tobias; Phuong, Nguyen T.; Bayley, Mark

2011-01-01

In this study we investigated nitrite (NO 2 - ) effects in striped catfish, a facultative air-breather. Fish were exposed to 0, 0.4, and 0.9 mM nitrite for 0, 1, 2, 4, and 7 days, and levels of functional haemoglobin, methaemoglobin (metHb) and nitrosyl haemoglobin (HbNO) were assessed using spectral deconvolution. Plasma concentrations of nitrite, nitrate, chloride, potassium, and sodium were also measured. Partitioning of oxygen consumption was determined to reveal whether elevated metHb (causing functional hypoxia) induced air-breathing. The effects of nitrite on maximum oxygen uptake (MO 2max ) and critical swimming speed (U crit ) were also assessed. Striped catfish was highly tolerant to nitrite exposure, as reflected by a 96 h LC 50 of 1.65 mM and a moderate nitrite uptake into the blood. Plasma levels of nitrite reached a maximum after 1 day of exposure, and then decreased, never exceeding ambient levels. MetHb, HbNO and nitrate (a nitrite detoxification product) also peaked after 1 day and then decreased. Only high levels of nitrite and metHb caused reductions in MO 2max and U crit . The response of striped catfish contrasts with that seen in most other fish species and discloses efficient mechanisms of combating nitrite threats. Furthermore, even though striped catfish is an efficient air-breather, this species has the ability to sustain aerobic scope and swimming performance without air-breathing, even when faced with nitrite-induced reductions in blood oxygen carrying capacity. Our study is the first to confirm that high levels of nitrite and metHb reduce MO 2max and thereby aerobic scope, while more moderate elevations fail to do so. Further studies are needed to elucidate the mechanisms underlying the low nitrite accumulation in striped catfish.
Benefits of combination of insulin degludec and liraglutide are independent of baseline glycated haemoglobin level and duration of type 2 diabetes

DEFF Research Database (Denmark)

Rodbard, Helena W; Buse, John B; Woo, Vincent C

2016-01-01

liraglutide, irrespective of baseline HbA1c. In DUAL II, insulin dose and hypoglycaemia rate were similar with IDegLira and IDeg (maximum dose limited to 50 U) independent of baseline HbA1c. The reduction in HbA1c with IDegLira was independent of disease duration and previous insulin dose but varied depending...... of disease progression stage including baseline glycated haemoglobin (HbA1c), disease duration and previous insulin dose. RESULTS: Across four categories of baseline HbA1c (≤7.5-9.0%), HbA1c reductions were significantly greater with IDegLira (1.1-2.5%) compared with IDeg or liraglutide alone in DUAL I...
Glycated haemoglobin: A marker of circulating lipids in patients with type 2 diabetes

Directory of Open Access Journals (Sweden)

Sheikh Ishaq

2017-01-01

Full Text Available Introduction: Type 2 diabetes mellitus (T2DM is a group of metabolic disorder and is an independent risk factor for cardiovascular disease and dyslipidaemia. Patients with T2DM have dyslipidaemia at wavering degrees, characterised by increased levels of triglyceride and low-density lipoprotein-cholesterol and decreased levels of high-density lipoprotein (HDL-cholesterol. In the present study, we evaluated glycated haemoglobin (HbA1c as a marker of circulating lipids in patients with T2DM. Methods: Two hundred and thirty-nine patients with T2DM were enrolled for the study. A detailed biochemical and lipid profile was done for all patients. Results: Of 239 cases, 96 (40% were male and 143 (60% were female. Of 239 patients, 53 (22% patients with T2DM had controlled glycaemia (HbA1c <6.5 and 186 (78% patients had uncontrolled glycaemia (HbA1c ≥6.5. Pearson's correlation of HbA1c with all lipid parameters was statistically significant. HbA1c, however, had an inverse correlation with HDL and had a significant direct correlation with fasting blood glucose. Conclusion: The study reveals that HbA1c is not only a reliable glycaemic index but can also be used as an important indicator of dyslipidaemia in patients with T2DM.
Effect of moderate hypoxia at three acclimation temperatures on stress responses in Atlantic cod with different haemoglobin types

DEFF Research Database (Denmark)

Methling, Caroline; Aluru, Neelakanteswar; Vijayan, Mathilakath M

2010-01-01

in a difference in stress response to hypoxia exposure. Two hsp70-isoforms (labelled a and b) were detected and they differed in expression in the gills but not in the liver of Atlantic cod. Acclimation temperature significantly affected the expression of hsp70 in the liver, and in an isoform-specific manner...... in the gills. Hypoxia exposure increased the expression of hsp70 in the liver, but not the gills, of cod and this response was not influenced by the acclimation temperature. The expression of hsp70 in both tissues did not differ between fish with different haemoglobin types. Acclimation temperature...... hypoxic exposure influence the organismal and cellular stress responses in Atlantic cod. We hypothesise that HbI-2 fish are more tolerant to short-term hypoxic episodes than HbI-1 fish, and this adaptation may be independent of tissue hsp70 expression....
Red blood cells free α-haemoglobin pool: a biomarker to monitor the β-thalassemia intermedia variability. The ALPHAPOOL study.

Science.gov (United States)

Vasseur, Corinne; Domingues-Hamdi, Elisa; Ledudal, Katia; Le Corvoisier, Philippe; Barau, Caroline; Ghaleh, Bijan; Rialland, Amandine; Pissard, Serge; Galactéros, Frédéric; Baudin-Creuza, Véronique

2017-10-01

The severity of β-thalassaemia (β-thal) intermedia is mainly correlated to the degree of imbalanced α/non α-globin chain synthesis. The phenotypic diversity of β-thal depends on this imbalance and reflects all possible combinations of α- and β-globin genotypes, levels of fetal haemoglobin (HbF) and co-inheritance of other modulating factors. This study aimed to demonstrate the validity of a new surrogate of α/non α-globin biosynthetic ratio by measuring the soluble α-Hb pool in lysed red blood cells. Our results confirm that the α-Hb pool measurement allows a good discrimination between β-thal intermedia patients, controls and α-thal patients (P intermedia patients and may be clinically useful for monitoring the evolution of the disequilibrium of globin synthesis in response to treatments. © 2017 John Wiley & Sons Ltd.
Sustainability of the effects of medicinal iron and iron rich food supplementation on haemoglobin, intelligence quotient and growth of school aged girls

Directory of Open Access Journals (Sweden)

Monika Jain

2014-12-01

Full Text Available Anaemia in school aged girls is an important but neglected issue. Since iron supplementation programmes have had little reported success in reducing anaemia, interest is turning to food based approaches that have higher potential for achieving far reaching benefits. The purpose of the study was to observe sustainability of the effect of iron and food supplementation on haemoglobin (Hb, intelligence quotient (IQ and growth of the subjects. At baseline, estimation of haemoglobin (Hb, red cell indices, serum iron, total iron binding capacity, serum transferrin saturation and serum ferritin was done. IQ, weight and height were measured using standard procedures. Anaemic subjectswere divided into three groups, viz., (i twice weekly supplementation of iron folic acid syrup (53 mg iron/week; (ii daily supplementation of 4 niger seed and defatted soyaflour biscuits plus 2 lemons (45 mg iron/week and (iii control. Non anaemic group(NAC was not intervened. Endline data was collected after 120 days. Follow up for Hb, IQ, weight and height was done 4 months after cessation of supplementation. The prevalence of anaemia was 77% in the study population; 46% subjects had mild anaemia and 32% had moderate anaemia. Iron status was lower in anaemic subjects (p<0.001.Iron supplementation was more effective in raising Hb and building iron stores than iron rich food supplementation. Iron supplementation improved IQ but did not bring about catch up of anaemics to non anaemics. Iron rich food supplementation was better than medicinal iron in promoting growth in anaemic girls. The impact of iron rich food supplementation on Hb, IQ and growth sustained for 4 months while that of medicinal iron did not. Effects of food supplementation are sustainable for 4 months, therefore, this strategy holds more potential to control anaemia, in school aged girls.
Soroepidemiologia para o virus da hepatite B (VHB em gestantes/parturientes e sua transmissão para recém-nascidos em Goiânia, GO

Directory of Open Access Journals (Sweden)

Divina das Dores P. Cardoso

1996-08-01

Full Text Available Foram coletadas, entre março de 1990 e julho de 1992, 1459 amostras sanguíneas de mulheres gestantes/parturientes na cidade de Goiânia-GO, objetivando detecção da infecção pelo vírus da hepatite B (VHB, através dos marcadores sorológicos AgHBs e anti-HBs. O percentual depositividade encontrado, pelo teste imunoenzimãtico, foi de 7,5%, sendo 0,5%para AgHBs e 7,0%para anti-HBs. A análise efetuada, considerando a faixa etária, mostra que 7 de 8 mulheres AgHBs-positivas pertenciam à faixa etária de até 30 anos, situação semelhante em relação ao anti-HBs(83/101. Das 8 mulheres positivas, 4 tiveram seus recém-nascidos submetidos a tratamento profilático com vacina (Engerix B e imunoglobulina humana anti-hepatite B (HBIG. Além disso, 3 dessas crianças foram analisadas sorologicamente, sendo que uma era AgHBs-positiva ao nascimento. Doença sexualmente transmissível e transfusão sanguínea foram fatores de risco que coirelacionaram significantemente com a infecção. Esses resultados parece-nos reforçar a indicação de triagem à infecção pelo vírus da hepatite B no período pré-natal, assim como a adoção de medidas imunoprofiláticas nas crianças nascidas de mães positivas.In order to detect hepatitis B vírus (HBV, 1459 serum samples from pregnant/parturient women were collected at two public hospitals in Goiânia, GO. These samples were tested by enzyme linked immunosorbent assay forHBsAg and anti-HBs. 109 (7.5% serum samples were positive. Eight (0.5% sera were positive for HBsAg and 101 (7.0% for anti-HBs. Viral positivity for both HBsAg and anti- HBs were observed in women which age ranged from 15 to 30 years. Four newborns from HBsAg positive mothers were submitted to the treatment with HBV vaccine (Engerix B and with hyperimmune gammaglobulin (HBIG - Abbott Laboratories - Brazil. Cord blood from one of the newborns was positive for HBsAg. A positive association was found between hepatitis B and sexually
Bajo impacto de la infección silente por el virus de la hepatitis B en la incidencia de hepatitis postransfusional en Venezuela

Directory of Open Access Journals (Sweden)

Gutiérrez Cristina

2001-01-01

Full Text Available Objetivo. Detectar la presencia de ADN del VHB en sueros de donantes de sangre negativos en las pruebas de los marcadores serológicos de hepatitis B empleados en el tamizaje, con el fin de evaluar el impacto de la infección silente por VHB sobre la incidencia de hepatitis B postransfusional en Venezuela. Métodos. Los sueros de 2 075 donantes de sangre negativos en las pruebas de los marcadores serológicos pesquisados en bancos de sangre venezolanos fueron analizados en 53 muestras, compuestas por la mezcla de 25-50 donaciones (0,5-1,0 mL de cada suero. Estas fueron sometidos a ultracentrifugación previa a la extracción del ADN viral por el método de proteinasa K-fenol-cloroformo. Resultados. En estas mezclas de sueros no se detectó ADN del VHB en ninguno de dos ensayos anidados de reacción en cadena de la polimerasa, mediante cebadores altamente conservados de las regiones que codifican el antígeno de superficie y de la cápside virales. Se observaron niveles normales de aminotransferasas en 98% de 200 sueros evaluados. Conclusiones. Estos resultados sugieren que el riesgo de adquirir hepatitis B postransfusional en Venezuela es bajo.
A Systematic Review of Known Mechanisms of Hydroxyurea-induced Foetal Haemoglobin for Treatment of Sickle Cell Disease

Science.gov (United States)

Pule, Gift D.; Mowla, Shaheen; Novitzky, Nicolas; Wiysonge, Charles S.; Wonkam, Ambroise

2016-01-01

Aims To report on molecular mechanisms of foetal haemoglobin (HbF) induction by hydroxyurea (HU) for the treatment of Sickle Cell Disease (SCD). Study Design Systematic review. Results Studies have provided consistent associations between genomic variations in HbF-promoting loci and variable HbF level in response to HU. Numerous signal transduction pathways have been implicated, through the identification of key genomic variants in BCL11A, HBS1L-MYB, SAR1 or XmnI polymorphism that predispose the response to the treatment, and signal transduction pathways, that modulate γ-globin expression (cAMP/cGMP; Giα/JNK/Jun; methylation and microRNA). Three main molecular pathways have been reported: 1) Epigenetic modifications, transcriptional events and signalling pathways involved in HU-mediated response, 2) Signalling pathways involving HU-mediated response and 3) Post-transcriptional pathways (regulation by microRNAs). Conclusions The complete picture of HU-mediated mechanisms of HbF production in SCD remains elusive. Research on post-transcriptional mechanisms could lead to therapeutic targets that may minimize alterations to the cellular transcriptome. PMID:26327494
Tubal origin of ovarian cancer - the double-edged sword of haemoglobin.

Science.gov (United States)

Lin, Shiou-Fu; Gerry, Emily; Shih, Ie-Ming

2017-05-01

Ovarian high-grade serous carcinoma (HGSC) is the most malignant neoplasm of the gynaecological tract. While the origins of many human malignant neoplasms are clear, the origin of HGSC remains poorly understood. This lack of knowledge limits our understanding of its pathogenesis and compromises efforts devoted to developing better early detection tools and effective preventative interventions. The paradigm of the tubal origin of HGSC has been advanced since the initial report of dysplastic lesions (now known as serous tubal intraepithelial carcinomas or STICs) that morphologically resemble HGSC in the Fallopian tube. These were observed in a group of patients with a genetic predisposition to ovarian cancer who were undergoing risk-reducing salpingo-oophorectomy. Since then, a series of clinico-pathological and molecular studies have characterized STICs and their concurrent HGSCs, and the results support the new paradigm of a tubal origin of many 'ovarian' HGSCs. Reactive oxygen species-containing ovulatory follicular fluid has been thought to be the major culprit behind DNA damage in tubal epithelial cells, leading to either cell death or, if the cells survive, mutagenesis. A recent report from this journal demonstrates that ferryl haemoglobin (Hb) in peritoneal fluid could prevent cell death from DNA-damaged fimbrial epithelial cells, facilitating ovulation-induced carcinogenesis of tubal epithelium. This timely study provides new insight into the tumour initiation event in HGSC. Copyright © 2017 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd. Copyright © 2017 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd.
Haemoglobin adducts of acrylonitrile and ethylene oxide in acrylonitrile workers, dependent on polymorphisms of the glutathione transferases GSTT1 and GSTM1.

Science.gov (United States)

Thier, R; Lewalter, J; Kempkes, M; Selinski, S; Brüning, T; Bolt, H M

1999-01-01

Fifty-nine persons with industrial handling of low levels of acrylonitrile (AN) were studied. As part of a medical surveillance programme an extended haemoglobin adduct monitoring [N-(cyanoethyl)valine, CEV; N-(methyl)valine. MV: N-(hydroxyethyl)valine, HEV] was performed. Moreover, the genetic states of the polymorphic glutathione transferases GSTM1 and GSTT1 were assayed by polymerase chain reaction (PCR). Repetitive analyses of CEV and MV in subsequent years resulted in comparable values (means, 59.8 and 70.3 microg CEV/1 blood; 6.7 and 6.7 microg MV/1 blood). Hence, the industrial AN exposures were well below current official standards. Monitoring the haemoglobin adduct CEV appears as a suitable means of biomonitoring and medical surveillance under such exposure conditions. There was also no apparent correlation between the CEV and HEV or CEV and MV adduct levels. The MV and HEV values observed represented background levels, which apparently are not related to any occupational chemical exposure. There was no consistent effect of the genetic GSTM1 or GSTT1 state on CEV adduct levels induced by acrylonitrile exposure. Therefore, neither GSTM1 nor GSTT1 appears as a major AN metabolizing isoenzyme in humans. The low and physiological background levels of MV were also not influenced by the genetic GSTM1 state, but the MV adduct levels tended to be higher in GSTT1- individuals compared to GSTT1 + persons. With respect to the background levels of HEV adducts observed, there was no major influence of the GSTM1 state, but GST- individuals displayed adduct levels that were about 1/3 higher than those of GSTT1 + individuals. The coincidence with known differences in rates of background sister chromatid exchange between GSTT1- and GSTT1 + persons suggests that the lower ethylene oxide (EO) detoxification rate in GSTT1- persons, indicated by elevated blood protein hydroxyethyl adduct levels, leads to an increased genotoxic effect of the physiological EO background.
Distribution of glycated haemoglobin and its determinants in Korean youth and young adults: a nationwide population-based study.

Science.gov (United States)

Seo, Ji-Young; Hwang, Seung-Sik; Kim, Jae Hyun; Lee, Young Ah; Lee, Seong Yong; Shin, Choong Ho; Yang, Sei Won

2018-01-31

The present study aimed to describe the distribution of and to investigate the factors associated with glycated haemoglobin (HbA1c) values in Korean youth (10-19 years old) and young adults (20-29 years old). Data from the Korea Health and Nutrition Examination Survey (2011-2015) were used. A total of 6,418 participants (male 3,140 [53.2%]) aged 10-29 years were included in the analysis. Percentiles of HbA1c were calculated and HbA1c values were compared according to age, sex, and associated factors. The mean HbA1c values (% [mmol/mol]) were 5.42 ± 0.01 (35.7 ± 0.1) for youths and 5.32 ± 0.01 (34.7 ± 0.1) for young adults (P distribution of HbA1c values in Korean youth and young adults. There were significant differences in the level of HbA1c according to age and sex.

Elva osaleb Baltimaade ühisprojektis Via Hanseatica tsooni arendamiseks / Eeva Kumberg

Index Scriptorium Estoniae

Kumberg, Eeva, 1964-

2005-01-01

Kokkuleppelise lühendiga VHB Zone tähistatud projekt keskendub turismialasele arendustegevusele kogu Via Hanseatica piirkonnas läbi kolme Balti riigi, projekti toetab Euroopa Liidu regionaalarengu programm INTERREG III B
Stability and reliability of glycated haemoglobin measurements in blood samples stored at -20°C.

Science.gov (United States)

Venkataraman, Vijayachandrika; Anjana, Ranjit Mohan; Pradeepa, Rajendra; Deepa, Mohan; Jayashri, Ramamoorthy; Anbalagan, Viknesh Prabu; Akila, Bridgitte; Madhu, Sri Venkata; Lakshmy, Ramakrishnan; Mohan, Viswanathan

2016-01-01

To validate the stability of glycated haemoglobin (HbA1c) measurements in blood samples stored at -20°C for up to one month. The study group comprised 142 type 2 diabetic subjects visiting a tertiary centre for diabetes at Chennai city in south India. The HbA1c assay was done on a fasting blood sample using the Bio-Rad Variant machine on Day 0 (day of blood sample collection). Several aliquots were stored at -20°C and the assay was repeated on the 3rd, 7th, 15th, and 30th day after the sample collection. Bland-Altman plots were constructed and variation in the HbA1c levels on the different days was compared with the day 0 level. The median differences between HbA1c levels measured on Day 0 and the 3rd, 7th, 15th, and 30th day after blood collection were 0.0%, 0.2%, 0.3% and 0.5% respectively. Bland-Altman plot analysis showed that the differences between the day '0' and the different time points tend to get larger with time, but these were not clinically significant. HbA1c levels are relatively stable up to 2weeks, if blood samples are stored at -20°C. Copyright © 2016 Elsevier Inc. All rights reserved.
Effect of dietary Fe-deficiency on growth organ weight, haemoglobin formation and 59Fe-retention in rats

International Nuclear Information System (INIS)

Sinha, R.K.; Gautam, D.

1985-01-01

Rats of the experimental group consuming diets adequate in all respects, but deficient in iron (5 ppm iron in contrast to 50 ppm iron for the control group) were found to suffer from moderate to severe anaemia (Hb 7.39 ± 0.2 g/100 ml, in contrast to 13.88 ± 0.19 g/100 ml for the control group; PCV per cent 27.88 ± 0.76 in contrast to 43.82 ± 0.65 for the control group) whereas they had satisfactory growth rates and normal outward appearance in all respects. However, their spleen and heart weight/g of body weight were also found to be significantly reduced, though liver and kidney weights remained normal. Their 59 Fe retention was considerably more than that of the control group indicating iron absorption and uptake were entirely dependent on iron-storage or haemoglobin status of the body. The results indicated that even for almost normal growth and a deceptive normal outward appearance a subject could be actually morbid because of Fe-deficiency anaemia under conditions of otherwise adequate diets and sedentary activity. (author)
Comparative clinical evaluation of glycosylated haemoglobin level in healthy and chronic periodontitis patients: A chairside diagnostic method.

Science.gov (United States)

Srinivasa, T S; Agrawal, Parul; Goyal, Pravesh; Farista, Sana; Sowmya, N K; Deonani, Sushmita

2015-01-01

Glycosylated haemoglobin (HbA1c) level can consequently be interpreted as an average of the blood glucose present over the past 3-4 months. Periodontitis is associated with glycemic control in patients with diabetes. The purpose of this study was to determine the level of HbA1c in healthy and periodontitis patients who were previously not diagnosed with diabetes mellitus. A total of 40 patients were selected for study and divided into two groups. Group 1 included patients with a healthy periodontium, and Group 2 included patients suffering from chronic periodontitis. Finger stick blood was collected by special collection unit (A1CNOW+® Bayer Health Care, Tarrytown New York, USA), for estimating level of HbA1c. Both groups showed similar HbA1c levels clinically with slight increase in levels in the test group, but was statistically significant (test--5.66 ± 0.35%, control--5.17 ± 0.3% P = 0.003). Indians are at a high-risk of developing periodontitis and diabetes. These data suggest a possible link between periodontitis and glycemic control in nondiabetic individuals, periodontal disease may be a potential contributor to the development of type 2 diabetes.
Perfil epidemiológico de la hepatitis B y D en Colombia

Directory of Open Access Journals (Sweden)

Carlos A. Espinal

1998-09-01

Full Text Available Colombia presenta una gran diversidad epidemiológica en las prevalencias de infección y portadores del virus B (VHB, de acuerdo con las regiones geográficas y sus grupos de población. El virus delta (VHD se encuentra ampliamente distribuido, asociado con epidemias de hepatitis fulminante en áreas de elevada prevalencia del VHB. Los resultados de los estudios realizados por instituciones y servicios de salud en grupos de población por regiones y departamentos, comunidades indígenas y trabajadores de salud, han permitido la configuración del mapa de riesgo para los virus B y D, de acuerdo con los patrones de alta y mediana endemicidad de ambas infecciones en la población. Las elevadas proporciones de infección informadas en comunidades, bancos de sangre y personal de salud, demuestran que Colombia es un país de alto riesgo para el VHB y VHD, con niveles intermedios en algunos departamentos. Las elevadas prevalencias en poblaciones indígenas requieren de un programa intensificado de control mediante la vacunación. Las coberturas de vacunación en la comunidad y en el personal de salud deben incrementarse con el fin de reducir la población susceptible y el riesgo de infección. Colombia presenta tasas de riesgo intermedio para el hepatocarcinoma primario. Estudios en la ciudad de Cali confirman la asociación epidemiológica entre hepatocarcinoma, cirrosis y la prevalencia por comunas del VHB. Estos factores ameritan la intensificación de la vacunación universal de la infancia y el inicio de programas de vacunación en los adolescentes. Adicionalmente, debe incrementarse la vacunación de los adultos a través de las diferentes entidades que desarrollan programas de prevención y promoción de la salud.
Changes in levels of haemoglobin A1c during the first 6 years after diagnosis of clinical type 2 diabetes

DEFF Research Database (Denmark)

Olivarius, Niels de Fine; Siersma, V.; Hansen, Lars Jørgen

2009-01-01

in HbA(1c) was investigated in a multivariate mixed model. RESULTS: During the first year after diabetes diagnosis, HbA(1c) dropped to near normal average level and then started rising almost linearly. A sharp rise in long-term glycaemic level was observed in approximately a quarter of the patients......OBJECTIVE: To assess the variability in levels of glycosylated haemoglobin (HbA(1c)) during the first six years after diagnosis of clinical type 2 diabetes in relation to possible predictors. MATERIAL AND METHODS: Data were from a population-based sample from general practice of 581 newly diagnosed...... diabetic patients aged 40 or over. Estimation of HbA(1c) was centralized. The changes in levels of HbA(1c) were described by HbA(1c) at diagnosis and a regression line fitted to the HbA(1c) measurements after 1-year follow-up for each patient. The predictive effect of patient characteristics for changes...
The role of genetic variants in CYP2C8, LPIN1, PPARGC1A and PPARγ on the trough steady-state plasma concentrations of rosiglitazone and on glycosylated haemoglobin A1c in type 2 diabetes

DEFF Research Database (Denmark)

Stage, Tore B; Christensen, Mette M H; Feddersen, Søren

2013-01-01

OBJECTIVE: The aim of this study was to examine the effect of single nucleotide polymorphisms in CYP2C8, LPIN1, PPARGC1A and PPARγ on rosiglitazone's (i) trough steady-state plasma concentration (C(ss,min)), (ii) on glycosylated haemoglobin A1c (HbA1c) and (iii) the risk of developing adverse eve...
[Vaccination against viral hepatitis A and B in adults aged over 40 years--antibody persistence and immune memory].

Science.gov (United States)

Chlibek, R; Smetana, J; Bostíková, V; Splino, M

2011-09-01

Primary vaccination with combined vaccine against viral hepatitis A (VHA) and viral hepatitis B (VHB) induces higher anti-hepatitis B surface (anti-HBs) antibody responses and similar anti-hepatitis A virus (anti-HAV) antibody responses in adults aged over 40 years in comparison with concomitant monovalent vaccines against VHA and VHB. Th e objectives were to assess, in a clinical study, persistence of anti-HAV and anti-HBs antibodies in adults aged over 40 years four years after primary VHA/VHB vaccination and antibody response following a booster dose of the vaccine. Five hundred and ninety-six subjects aged > 40 years were vaccinated with three doses of the combined VHA/VHB vaccine at Months 0, 1, 6 (HAB group) or with concomitant VHA and VHB vaccines at Months 0, 6 and 0, 1, 6 (ENG+HAV and HBVX+VAQ, respectively). Blood samples were collected one month following primary vaccination (Month 7) and then at one-year intervals for four years after the booster dose with the same vaccine as used for the primary vaccination. The anti-HBs and anti-HAV antibody levels were determined prior to the booster dose and at days 14 and 30 after the booster dose. At Month 7, > 97% of study subjects were seropositive for anti-HAV antibodies in all groups analyzed. Four years after primary vaccination, anti-HAV antibody seropositivity persisted in > 93% of study subjects, increasing to > 99% after the booster dose. At Month 7, the highest proportion of study subjects with anti-HBs antibody levels > or = 10 mIU/ml was found in the HAB group (91.7% versus 79.7% in the ENG+HAV group versus 71.0% in the HBVX+VAQ group). Four years after vaccination, anti-HBs antibody levels of 10 mIU/ml persisted in 57.1% of the HAB study subjects in comparison with 40.1% and 26.6% of the study subjects in the ENG+HAV and HBVX+VAQ groups, respectively. One month after the booster dose, anti-HBs antibody levels increased and antibody levels > or = 10 mIU/ml was achived in 95.2% of study subjects in the
Influencia del ejercicio físico aeróbico durante el embarazo en los niveles de hemoglobina y de hierro maternos. (Influence of the physical aerobic exercise during pregnancy in the maternal haemoglobin and iron levels.

Directory of Open Access Journals (Sweden)

James Stirling

2008-04-01

coexist without maternal-foetal conflicts and without the pregnancy outcome are altered. Especially when day by day, they are more the women that want to continue training in some way, during their pregnancy. The aim of this investigation is to know the influence of the moderate aerobic exercise developed during the second and third pregnancy trimesters on haemoglobin and iron maternal levels. Materials and methods: An experimental design was used. It included a total of 142 pregnant. Cases Group: integrated by 72 women. Control Group: integrated by 70 women. The studied maternal parameters were: iron levels, haemoglobin level, gestational age, type of delivery. Foetal: birth weight, size, cranial perimeter, Apgar test (1´y 5´. Results: Results show not significant differences between both groups at statistical level (p menor que 0.05, cases group (exercise present similar results related to haemoglobin levels: 12.1 ± 0.8 and iron: 65.90 ± 7.1 that the control group: haemoglobin: 12.3 ± 0.8 and iron: 66.42 ± 8.4. The birth weight was inferior in the case group inside nor- mal values (-142.1grs.. Conclusion: The moderate and aerobic exercise developed during the second and third pregnancy trimester seems not to influence in maternal haemoglobin and iron levels.
Rapid detection of pathological mutations and deletions of the haemoglobin beta gene (HBB) by High Resolution Melting (HRM) analysis and Gene Ratio Analysis Copy Enumeration PCR (GRACE-PCR).

Science.gov (United States)

Turner, Andrew; Sasse, Jurgen; Varadi, Aniko

2016-10-19

Inherited disorders of haemoglobin are the world's most common genetic diseases, resulting in significant morbidity and mortality. The large number of mutations associated with the haemoglobin beta gene (HBB) makes gene scanning by High Resolution Melting (HRM) PCR an attractive diagnostic approach. However, existing HRM-PCR assays are not able to detect all common point mutations and have only a very limited ability to detect larger gene rearrangements. The aim of the current study was to develop a HBB assay, which can be used as a screening test in highly heterogeneous populations, for detection of both point mutations and larger gene rearrangements. The assay is based on a combination of conventional HRM-PCR and a novel Gene Ratio Analysis Copy Enumeration (GRACE) PCR method. HRM-PCR was extensively optimised, which included the use of an unlabelled probe and incorporation of universal bases into primers to prevent interference from common non-pathological polymorphisms. GRACE-PCR was employed to determine HBB gene copy numbers relative to a reference gene using melt curve analysis to detect rearrangements in the HBB gene. The performance of the assay was evaluated by analysing 410 samples. A total of 44 distinct pathological genotypes were detected. In comparison with reference methods, the assay has a sensitivity of 100 % and a specificity of 98 %. We have developed an assay that detects both point mutations and larger rearrangements of the HBB gene. This assay is quick, sensitive, specific and cost effective making it suitable as an initial screening test that can be used for highly heterogeneous cohorts.
Genética molecular de las hemoglobinas bacterianas: estructura, regulación y función

OpenAIRE

Elizabeth Hernández Urzúa; Jorge Membrillo Hernández

2004-01-01

Las hemoglobinas se definen como aquellas hemoproteínas que unen reversiblemente el oxígeno. Estas proteínas se encuentran distribuidas en plantas, protozoarios, hongos y bacterias. Las hemoglobinas presentes en los microorganismos se han dividido en tres grupos. En el primer grupo se encuentran aquellas hemoproteínas que presentan un solo dominio con el grupo hemo, por ejemplo la hemoglobina de Vitreoscilla. En el segundo se encuentran aquellas hemoglobinas que presentan dos dife...
A quantitative analysis of the effects of 2,3-diphosphoglycerate, adenosine triphosphate and inositol hexaphosphate on the oxygen dissociation curve of human haemoglobin.

Science.gov (United States)

Goodford, P J; St-Louis, J; Wootton, R

1978-01-01

1. Oxygen dissociation curves have been measured for human haemoglobin solutions with different concentrations of the allosteric effectors 2,3-diphosphoglycerate, adenosine triphosphate and inositol hexaphosphate. 2. Each effector produces a concentration dependent right shift of the oxygen dissociation curve, but a point is reached where the shift is maximal and increasing the effector concentration has no further effect. 3. Mathematical models based on the Monod, Wyman & Changeux (1965) treatment of allosteric proteins have been fitted to the data. For each compound the simple two-state model and its extension to take account of subunit inequivalence were shown to be inadequate, and a better fit was obtained by allowing the effector to lower the oxygen affinity of the deoxy conformational state as well as binding preferentially to this conformation. PMID:722582
Haemoglobin-mediated response to hyper-thermal stress in the keystone species Daphnia magna.

Science.gov (United States)

Cuenca Cambronero, Maria; Zeis, Bettina; Orsini, Luisa

2018-01-01

Anthropogenic global warming has become a major geological and environmental force driving drastic changes in natural ecosystems. Due to the high thermal conductivity of water and the effects of temperature on metabolic processes, freshwater ecosystems are among the most impacted by these changes. The ability to tolerate changes in temperature may determine species long-term survival and fitness. Therefore, it is critical to identify coping mechanisms to thermal and hyper-thermal stress in aquatic organisms. A central regulatory element compensating for changes in oxygen supply and ambient temperature is the respiratory protein haemoglobin (Hb). Here, we quantify Hb plastic and evolutionary response in Daphnia magna subpopulations resurrected from the sedimentary archive of a lake with known history of increase in average temperature and recurrence of heat waves. By measuring constitutive changes in crude Hb protein content among subpopulations, we assessed evolution of the Hb gene family in response to temperature increase. To quantify the contribution of plasticity in the response of this gene family to hyper-thermal stress, we quantified changes in Hb content in all subpopulations under hyper-thermal stress as compared to nonstressful temperature. Further, we tested competitive abilities of genotypes as a function of their Hb content, constitutive and induced. We found that Hb-rich genotypes have superior competitive abilities as compared to Hb-poor genotypes under hyper-thermal stress after a period of acclimation. These findings suggest that whereas long-term adjustment to higher occurrence of heat waves may require a combination of plasticity and genetic adaptation, plasticity is most likely the coping mechanism to hyper-thermal stress in the short term. Our study suggests that with higher occurrence of heat waves, Hb-rich genotypes may be favoured with potential long-term impact on population genetic diversity.
Effect of whey guava beverage supplementation on haemoglobin level of school going children

Directory of Open Access Journals (Sweden)

Divya .

2014-12-01

Full Text Available Introduction: Iron deficiency is estimated to affect one-half of the school going children in developing countries and school years are opportune time to intervene. Rationale: No coherent, co-ordinate and effective health services are available in the country for below 16 years. So attempt was made to know real scenario of iron deficiency. Objectives: To assess the effect of whey guava beverage supplementation on the haemoglobin level of school going children. Methodology: An experimental research design was taken to conduct the study in which 200 children of 6≥and7≥ years in low socio economic status of both the genders were taken. For hemoglobin testing Sahil’s hemoglobinometer was used. Each child in experimental group was given 200ml of whey guava beverage for 90 days except holidays. Results and Discussion: The initial mean Hb levels of 6≥and7≥ year’s old boys and girls of control groups and experimental groups were ranging from 9.50 to 10.24 which were 79.17% to 85.33%. The results revealed that almost all the respondents were anaemic. After 90 days of feeding supplement the final mean Hb levels of 6≥7 years old boys and girls of control group ranged from 10.10 to 10.65 which was 84.17% to 88.75%. Whereas in experimental group it ranged from 11.06 to 11.42 which were 91.92% to 95.17%. The study clearly evidences that the respondents in experimental group had improved with more Hb levels when compared to control group. Also children who were suffering from anaemia in experimental group became normal. Conclusion: Distribution of whey guava beverage through school feeding program may prove as an outstanding strategy to combat iron deficiency in school children.
Year-to-year variability in haemoglobin mass response to two altitude training camps.

Science.gov (United States)

McLean, Blake D; Buttifant, David; Gore, Christopher J; White, Kevin; Kemp, Justin

2013-12-01

To quantify the year-to-year variability of altitude-induced changes in haemoglobin mass (Hb(mass)) in elite team-sport athletes. 12 Australian-Footballers completed a 19-day (ALT1) and 18-day (ALT2) moderate altitude (∼2100 m), training camp separated by 12 months. An additional 20 participants completed only one of the two training camps (ALT1 additional n=9, ALT2 additional n=11). Total Hb(mass) was assessed using carbon monoxide rebreathing before (PRE), after (POST₁) and 4 weeks after each camp. The typical error of Hb(mass) for the pooled data of all 32 participants was 2.6%. A contemporary statistics analysis was used with the smallest worthwhile change set to 2% for Hb(mass). POST₁ Hb(mass) was very likely increased in ALT1 (3.6 ± 1.6%, n=19; mean ± ∼90 CL) as well as ALT2 (4.4 ± 1.3%, n=23) with an individual responsiveness of 1.3% and 2.2%, respectively. There was a small correlation between ALT1 and ALT2 (R=0.21, p=0.59) for a change in Hb(mass), but a moderately inverse relationship between the change in Hb(mass) and initial relative Hb(mass) (g/kg (R=-0.51, p=0.04)). Two preseason moderate altitude camps 1 year apart yielded a similar (4%) mean increase in Hb(mass) of elite footballers, with an individual responsiveness of approximately half the group mean effect, indicating that most players gained benefit. Nevertheless, the same individuals generally did not change their Hb(mass) consistently from year to year. Thus, a 'responder' or 'non-responder' to altitude for Hb(mass) does not appear to be a fixed trait.
Comparative clinical evaluation of glycosylated haemoglobin level in healthy and chronic periodontitis patients: A chairside diagnostic method

Directory of Open Access Journals (Sweden)

T S Srinivasa

2015-01-01

Full Text Available Objective and Background: Glycosylated haemoglobin (HbA1c level can consequently be interpreted as an average of the blood glucose present over the past 3-4 months. Periodontitis is associated with glycemic control in patients with diabetes. The purpose of this study was to determine the level of HbA1c in healthy and periodontitis patients who were previously not diagnosed with diabetes mellitus. Materials and Methods: A total of 40 patients were selected for study and divided into two groups. Group 1 included patients with a healthy periodontium, and Group 2 included patients suffering from chronic periodontitis. Finger stick blood was collected by special collection unit (A1CNOW +® Bayer Health Care, Tarrytown New York, USA, for estimating level of HbA1c. Result: Both groups showed similar HbA1c levels clinically with slight increase in levels in the test group, but was statistically significant (test - 5.66 ± 0.35%, control - 5.17 ± 0.3% P = 0.003. Conclusion: Indians are at a high-risk of developing periodontitis and diabetes. These data suggest a possible link between periodontitis and glycemic control in nondiabetic individuals, periodontal disease may be a potential contributor to the development of type 2 diabetes.
Genética molecular de las hemoglobinas bacterianas: estructura, regulación y función

Directory of Open Access Journals (Sweden)

Elizabeth Hernández Urzúa

2004-01-01

Full Text Available Las hemoglobinas se definen como aquellas hemoproteínas que unen reversiblemente el oxígeno. Estas proteínas se encuentran distribuidas en plantas, protozoarios, hongos y bacterias. Las hemoglobinas presentes en los microorganismos se han dividido en tres grupos. En el primer grupo se encuentran aquellas hemoproteínas que presentan un solo dominio con el grupo hemo, por ejemplo la hemoglobina de Vitreoscilla. En el segundo se encuentran aquellas hemoglobinas que presentan dos diferentes dominios, el primer dominio con el grupo hemo el cual es homólogo a la hemoglobina de Vitreoscilla y un segundo dominio con actividad de reductasa el cual es homólogo a la familia de las proteínas ferrodoxín NADP- reductasas (FNR, a éstas hemoglobinas se les conoce como flavohemoglobinas, un ejemplo es Hmp, la flavohemoglobina de Escherichia coli, ésta fue la primera flavohemoglobina estudiada a nivel molecular. En el tercer grupo se encuentran las hemoglobinas truncadas, éstas son proteínas pequeñas de 20 a 30 aminoácidos en donde se encuentra el dominio hemo. Poco se sabe acerca de la función de estas hemoglobinas, pero se ha reportado su participación en la protección y destoxificación del óxido nítrico.
Hepatitis B reactivation and current clinical impact Reactivación de la hepatitis B y su impacto clínico actual

Directory of Open Access Journals (Sweden)

B. Álvarez Suárez

2010-09-01

Full Text Available Hepatitis B virus (HBV reactivation results from increased viral replication in inactive carriers or patients with prior infection with HBV. Reactivation may occur spontaneously or secondary to immunomodulating or immunosuppressive chemotherapy. Reactivation may manifest with no symptoms but on occasion results in acute or even severe acute hepatitis. Prevention is the best management approach, hence HBV screening using serology should be performed for all patients undergoing any immunomodulating, immunosuppressive or chemotherapeutic treatment. Antiviral prophylaxis has proven effective in inactive carriers and in some patients with former infection with HBV undergoing selected immunosuppressive therapies.La reactivación del virus de la hepatitis B se debe a un aumento de la replicación del virus en pacientes portadores inactivos o con infecciones pasadas de VHB. La reactivación puede producirse espontáneamente o de manera secundaria a tratamientos de quimioterapia, inmunomoduladores o inmunosupresores. La reactivación puede manifestarse de manera asintomática pero en algunos casos puede causar hepatitis agudas e incluso hepatitis agudas graves. El mejor tratamiento es la prevención por lo que se debe realizar un cribado del VHB mediante una serología a todos los pacientes que vayan a someterse a cualquier tratamiento inmunomodulador, de quimioterapia o inmunosupresor. El tratamiento profiláctico antiviral ha demostrado ser eficaz en los pacientes portadores inactivos y en algunos pacientes con infecciones pasadas de VHB sometidos a ciertos tratamientos inmunosupresores.
Systematic review and meta-analysis of method comparison studies of Masimo pulse co-oximeters (Radical-7™ or Pronto-7™) and HemoCue® absorption spectrometers (B-Hemoglobin or 201+) with laboratory haemoglobin estimation.

Science.gov (United States)

Hiscock, R; Kumar, D; Simmons, S W

2015-05-01

We assessed agreement in haemoglobin measurement between Masimo pulse co-oximeters (Rad-7™ and Pronto-7™) and HemoCue® photometers (201+ or B-Hemoglobin) with laboratory-based determination and identified 39 relevant studies (2915 patients in Masimo group and 3084 patients in HemoCue group). In the Masimo group, the overall mean difference was -0.03 g/dl (95% prediction interval -0.30 to 0.23) and 95% limits of agreement -3.0 to 2.9 g/dl compared to 0.08 g/dl (95% prediction interval -0.04 to 0.20) and 95% limits of agreement -1.3 to 1.4 g/dl in the HemoCue group. Only B-Hemoglobin exhibited bias (0.53, 95% prediction interval 0.27 to 0.78). The overall standard deviation of difference was larger (1.42 g/dl versus 0.64 g/dl) for Masimo pulse co-oximeters compared to HemoCue photometers. Masimo devices and HemoCue 201+ both provide an unbiased, pooled estimate of laboratory haemoglobin. However, Masimo devices have lower precision and wider 95% limits of agreement than HemoCue devices. Clinicians should carefully consider these limits of agreement before basing transfusion or other clinical decisions on these point-of-care measurements alone.
A window of opportunity: declining rates of hepatitis B virus infection among injection drug users in Rio de Janeiro, and prospects for targeted hepatitis B vaccination Ventana de oportunidad: reducción de las tasas de infección por el virus de la hepatitis B entre usuarios de drogas inyectadas en Río de Janeiro, Brasil, y planes futuros en torno a la vacunación contra la hepatitis B

Directory of Open Access Journals (Sweden)

Sabrina A. N. Oliveira

2005-11-01

Full Text Available OBJECTIVES: To measure hepatitis B virus (HBV infection rates among injection drug users in Rio de Janeiro, Brazil, and to report their knowledge of and attitudes toward hepatitis and HBV vaccination. METHODS: 609 injection drug users recruited in Rio de Janeiro between 1999 and 2001 answered a questionnaire and were tested for hepatitis B and other blood-borne infections. Questions covered sociodemographic information, alcohol and illicit drug consumption, drug injection and sexual practices, medical history, and knowledge about HIV, AIDS and viral hepatitis. RESULTS: The prevalence of HBV infection was 27.1% , with 3.4% of the sample positive for HbsAg (active infection and 0.8% positive for anti-HBs (indicating previous HBV vaccination. Most interviewees (81.3% were aware of at least one form of viral hepatitis and received information from many different sources. In agreement with laboratory findings, 96.7% of the interviewees stated they had never been vaccinated against hepatitis B, but almost all unvaccinated interviewees (97.8% said they would volunteer to be vaccinated if HBV vaccination were available. CONCLUSIONS: Few of the injection drug users surveyed had ever been vaccinated against HBV. Although most were aware of the risks posed by viral hepatitis, this awareness seldom translated into consistent behavioral change. The participants' willingness to be vaccinated against HBV suggests that the implementation of vaccination for this population may help decrease rates of hepatitis B infection.OBJETIVOS: Calcular las tasas de infección por el virus de la hepatitis B (VHB en usuarios de drogas inyectadas en Río de Janeiro, Brasil, y dar a conocer sus conocimientos y actitudes en torno a la hepatitis y a la vacunación contra el VHB. MÉTODOS: Seiscientos nueve usuarios de drogas que se reclutaron en Río de Janeiro entre 1999 y 2001 respondieron a un cuestionario y fueron sometidos a pruebas para detectar la presencia de hepatitis B

The virtual haptic back: A simulation for training in palpatory diagnosis

Directory of Open Access Journals (Sweden)

Eland David C

2008-04-01

Full Text Available Abstract Background Models and simulations are finding increased roles in medical education. The Virtual Haptic Back (VHB is a virtual reality simulation of the mechanical properties of the human back designed as an aid to teaching clinical palpatory diagnosis. Methods Eighty-nine first year medical students of the Ohio University College of Osteopathic Medicine carried out six, 15-minute practice sessions with the VHB, plus tests before and after the sessions in order to monitor progress in identifying regions of simulated abnormal tissue compliance. Students palpated with two digits, fingers or thumbs, by placing them in gimbaled thimbles at the ends of PHANToM 3.0® haptic interface arms. The interface simulated the contours and compliance of the back surface by the action of electric motors. The motors limited the compression of the virtual tissues induced by the palpating fingers, by generating counterforces. Users could see the position of their fingers with respect to the back on a video monitor just behind the plane of the haptic back. The abnormal region varied randomly among 12 locations between trials. During the practice sessions student users received immediate feedback following each trial, indicating either a correct choice or the actual location of the abnormality if an incorrect choice had been made. This allowed the user to feel the actual abnormality before going on to the next trial. Changes in accuracy, speed and Weber fraction across practice sessions were analyzed using a repeated measures analysis of variance. Results Students improved in accuracy and speed of diagnosis with practice. The smallest difference in simulated tissue compliance users were able to detect improved from 28% (SD = 9.5% to 14% (SD = 4.4% during the practice sessions while average detection time decreased from 39 (SD = 19.8 to 17 (SD = 11.7 seconds. When asked in anonymous evaluation questionnaires if they judged the VHB practice to be helpful to
Niveles de linfocitos T en pacientes portadores crónicos del virus de la hepatitis viral B en una zona hiperendémica del Perú

Directory of Open Access Journals (Sweden)

Saúl Chuchón M

2005-04-01

Full Text Available Objetivos: Determinar los niveles de linfocitos CD3, CD4, CD8 y coeficiente CD4/CD8 en portadores del virus de la hepatitis B (VHB de una zona hiperendémica del Perú (Huanta, departamento Ayacucho. Materiales y métodos: Estudio comparativo que incluyó tres grupos, pareados en función a la edad (¡Ü20 ó 20 años y sexo, a una razón aproximadamente de 1:1. Se incluyeron 114 personas, en los siguientes grupos: 30 portadores crónicos (casos, 44 pacientes con antecedente de infección (no portador o control y 40 individuos sin contacto previo con el VHB (sanos. De cada individuo, previo consentimiento informado, se obtuvieron dos muestras de sangre en un lapso de 30 a 45 días con la finalidad de caracterizar los grupos y realizar las pruebas de interés. Estas pruebas fueron: ELISA para HBsAg, anticore para anti HBc IgM y anti HBc IgG, y la técnica de diferenciación celular por citometría de flujo para la valoración de subpoblaciones de linfocitos T CD3+, CD4+ y CD8+. Resultados: Se encontró valores disminuidos del número de linfocitos T CD4/mm 3 en los portadores cróni cos de HBsAg (casos, respecto a los otros grupos (p = 0,017; en tanto que para los valores de linfocitos T CD3, T CD8 y coeficiente CD4/CD8 no se encontraron diferencias entre grupos. Asimismo, mediante ANOVA se halló diferencias entre los grupos de edad (mayor y menor de 20 años de los casos (p = 0,033, característica no observada en los otros grupos. Conclusiones: Se evidenció niveles menores de linfocitos T CD4/mm 3 en l os portadores cróni cos del VHB rel aci ón a l os otros grupos. Se sugiere realizar mayores estudios de inmunidad celular en la infección del VHB, buscando evaluar poblaciones celulares específicas que puedan emplearse como posibles marcadores de la evolución de la enfermedad.
[Practical repercussions of 3 years of experience of national hemovigilance on the subject of viral complications].

Science.gov (United States)

Laperche, S

1998-06-01

The residual risk of transmitting viral infections by transfusion of screened blood is mainly linked to donations occurring in the window period. Using a mathematical model, a French study, including a 3 year period of blood donations (1994-1996), was performed by the Hepatitis Virus and Retrovirus working groups of the French Society of Blood Transfusion. The residual risk in France was estimated as follows: for HIV, 1 in 1 million (IC 95% = 1/10 million to 1/295,000), for HTLV 1 in 5 million (IC 95% = 0 to 1/625,000), for VHC 1 in 200,000 (IC 95% = 1/530,000 to 1/97,000), for VHB 1 in 180,000 (IC 95% = 1/560,000 to 1/66,000). Based on these estimations, the number of recipients possibly contaminated should have been seven for HIV, one or two for HTLV, 35 for VHC, 40 for VHB for a 3 year period. These 83 to 84 theoretically contaminated recipients are not in accordance with the six recipients contaminated by a blood product (two with HIV, one with VHC, three with VHB) that were reported to the National Haemovigilance Unit of the Agence Française du Sang. This observed difference may be explained by an overestimated calculated risk (the whole window period is not infectious), or by an underestimation of real post-transfusion contamination due to a lack of exhaustive notifications. However, a national database of post-tranfusion contamination is useful to approach the real residual risk. Therefore, efforts to continue the recipient follow-up have to be encouraged.
Data analytics identify glycated haemoglobin co-markers for type 2 diabetes mellitus diagnosis.

Science.gov (United States)

Jelinek, Herbert F; Stranieri, Andrew; Yatsko, Andrew; Venkatraman, Sitalakshmi

2016-08-01

Glycated haemoglobin (HbA1c) is being more commonly used as an alternative test for the identification of type 2 diabetes mellitus (T2DM) or to add to fasting blood glucose level and oral glucose tolerance test results, because it is easily obtained using point-of-care technology and represents long-term blood sugar levels. HbA1c cut-off values of 6.5% or above have been recommended for clinical use based on the presence of diabetic comorbidities from population studies. However, outcomes of large trials with a HbA1c of 6.5% as a cut-off have been inconsistent for a diagnosis of T2DM. This suggests that a HbA1c cut-off of 6.5% as a single marker may not be sensitive enough or be too simple and miss individuals at risk or with already overt, undiagnosed diabetes. In this study, data mining algorithms have been applied on a large clinical dataset to identify an optimal cut-off value for HbA1c and to identify whether additional biomarkers can be used together with HbA1c to enhance diagnostic accuracy of T2DM. T2DM classification accuracy increased if 8-hydroxy-2-deoxyguanosine (8-OhdG), an oxidative stress marker, was included in the algorithm from 78.71% for HbA1c at 6.5% to 86.64%. A similar result was obtained when interleukin-6 (IL-6) was included (accuracy=85.63%) but with a lower optimal HbA1c range between 5.73 and 6.22%. The application of data analytics to medical records from the Diabetes Screening programme demonstrates that data analytics, combined with large clinical datasets can be used to identify clinically appropriate cut-off values and identify novel biomarkers that when included improve the accuracy of T2DM diagnosis even when HbA1c levels are below or equal to the current cut-off of 6.5%. Copyright © 2016 Elsevier Ltd. All rights reserved.
Dicty_cDB: VHB379 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available agilrdprkcntkgntnairgdirt*grske rri*esirii*nepikqwaagngikgfte*hnriqrhscnirigrekattssg*tktvi* eedqiekeinkilsk...srrpi pitslwiyrigrngwrngcnyscgyiqvcagilrdprkcntkgntnairgdirt*grske rri*esirii*nepikqwaagngikgfte*hnriqrhscni
Dicty_cDB: VHB162 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mRNA sequence. 72 2e-13 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus par...adoxus cDNA clone CHUL4181, mRNA sequence. 72 2e-13 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle
Dicty_cDB: VHB154 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL4181, mRNA se...quence. 72 5e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cD
Dicty_cDB: VHB553 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available , mRNA sequence. 72 1e-16 3 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus pa...65.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 72 1e-16 3 D...radoxus cDNA clone CHUL4181, mRNA sequence. 72 1e-16 3 EL513430 |EL513430.1 CHUX4
Dicty_cDB: VHB386 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 10.b1_C08.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL5210,... (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1285 0.0 1 EL476977 |EL476977.1 CHUL52
Dicty_cDB: VHB564 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 7...2 1e-17 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone
Dicty_cDB: VHB767 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vs Protein Score E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 111 7e-23 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 109 3e-22 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 108 3e-22 (Q9JLC8) RecName: Full=Sacsin; 108 3e-22 BC142916_1( BC142916 |pid:none) Danio rerio hypothetic
Dicty_cDB: VHB884 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available *nlygsnql yss*np*ktsfnsktrwnk**c*snin*yfnyyf*wyfcwyekywlnynykiliin*lii ikiiiikiiiivlhyfkdaxk*in*kf Translated... 2004.12.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N DQ538352 |DQ538352.1 Bienertia si... aralocaspica phosphoenolpyruvate carboxylase mRNA, partial cds. 48 2e-07 2 DQ538354 |DQ538354.1 Suaeda eltoni...lmekk**n** kh*f*lnhqvkelqns*rni*krlai*virkh*myqecyhiy*i*lmlqnniiwldqlen hsstmkmi*si...tfry*nd**thknykcnlginkt*nsstr**npstfcfns*nlygsnql yss*np*ktsfnsktrwnk**c*snin*yfnyyf*wyfcwyekywlnynykiliin*lii ikiiiikiiiivlhyfkda
Dicty_cDB: VHB165 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |p...id:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli
Dicty_cDB: VHB359 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available scoideum Dd-grp94 mRNA for glucose-regulated protein 94, complete cds. 78 6e-37 6 AA549925 |AA549925.1 0999m...3 gmbPfHB3.1, G. Roman Reddy Plasmodium falciparum genomic clone 0999m, DNA sequence. 92 3e-28 4 AB092411 |A
Dicty_cDB: VHB375 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available complete sequence. 34 0.40 6 AA550664 |AA550664.1 1901m3 gmbPfHB3.1, G. Roman Reddy... Plasmodium falciparum genomic clone 1901m, genomic survey sequence. 42 0.77 1 AA550658 |AA550658.1 1895m...3 gmbPfHB3.1, G. Roman Reddy Plasmodium falciparum genomic clone 1895m, DNA sequence. 42 0.77 1 AC073906 |AC
Dicty_cDB: VHB821 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ence. 34 0.17 3 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034...434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clo
Dicty_cDB: VHB466 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nce. 50 0.006 2 DD419614 |DD419614.1 GENES OF AN OTITIS MEDIA ISOLATE OF NONTYPEABLE HAEMOPHILUS INFLUENZAE.... 54 0.006 1 DD419394 |DD419394.1 GENES OF AN OTITIS MEDIA ISOLATE OF NONTYPEABLE HAEMOPHILUS INFLUENZAE. 54
Dicty_cDB: VHB614 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available rand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP142o16. 50 0.18 1 C...R044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering
Dicty_cDB: VHB619 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP142o16. 5...0 0.17 1 CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering
Dicty_cDB: VHB863 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available insertion targeting and chromosome engineering clone MHPP142o16. 50 0.17 1 CR044130 |CR044130.1 Forward str...and read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR...034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineerin...n 3'HPRT insertion targeting and chromosome engineering clone MHPP421e10. 50 0.17 1 dna update 2007. 4.17 Ho

Dicty_cDB: VHB673 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available TC TT sequence update 2002.10.25 Translated Amino Acid sequence llayw*hctnryhkrc*fiktagrwpwxvgir*gvcnns...llayw*hctnryhkrc*fiktagrwpwxvgir*gvcnnspakwtspeng*r*qwmvdaqs lkeviilltcrka*r*RKSLNVNSSGVXFSADLDG--- ---**hdl
Crystallization and preliminary structural analysis of the giant haemoglobin from Glossoscolex paulistus at 3.2 Å

Energy Technology Data Exchange (ETDEWEB)

Bachega, J. F. R., E-mail: bachega@ursa.if.sc.usp.br; Bleicher, L.; Horjales, E. R. [Centro de Biotecnologia Molecular Estrutural, Instituto de Fisica de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil); Santiago, P. S. [Instituto de Química de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil); Garratt, R. C. [Centro de Biotecnologia Molecular Estrutural, Instituto de Fisica de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil); Tabak, M., E-mail: bachega@ursa.if.sc.usp.br [Instituto de Química de São Carlos, Universidade de São Paulo, São Carlos - SP, CEP 13566-590 (Brazil)

2011-01-01

Diffraction data to 3.2 Å from crystals of the 3.6 MDa erythrocruorin from a Brazilian earthworm represent the highest resolution reported to date for similar complexes. An unambiguous molecular replacement solution shows the particle to belong to the type I class. Glossoscolex paulistus is a free-living earthworm encountered in south-east Brazil. Its oxygen transport requirements are undertaken by a giant extracellular haemoglobin, or erythrocruorin (HbGp), which has an approximate molecular mass of 3.6 MDa and, by analogy with its homologue from Lumbricus terrestris (HbLt), is believed to be composed of a total of 180 polypeptide chains. In the present work the full 3.6 MDa particle in its cyanomet state was purified and crystallized using sodium citrate or PEG8000 as precipitant. The crystals contain one-quarter of the full particle in the asymmetric unit of the I222 cell and have parameters of a = 270.8 Å, b = 320.3 Å and c = 332.4 Å. Diffraction data were collected to 3.15 Å using synchrotron radiation on beamline X29A at the Brookhaven National Laboratory and represent the highest resolution data described to date for similar erythrocruorins. The structure was solved by molecular replacement using a search model corresponding to one-twelfth of its homologue from HbLt. This revealed that HbGp belongs to the type I class of erythrocruorins and provided an interpretable initial electron density map in which many features including the haem groups and disulfide bonds could be identified.
Quality of life, physical function and MRI T2* in elderly low-risk MDS patients treated to a haemoglobin level of ≥120 g/L with darbepoetin alfa ± filgrastim or erythrocyte transfusions

DEFF Research Database (Denmark)

Nilsson-Ehle, Herman; Birgegård, Gunnar; Samuelsson, Jan

2011-01-01

Anaemia in low-risk myelodysplastic syndromes (MDS) is associated with reduced quality of life (QoL). Response to treatment with erythropoietin ± granulocyte colony-stimulating factor (G-CSF) is associated with improved QoL, but whether transfusion therapy with higher haemoglobin (Hb) target levels...... has similar effects is unknown. The objective for this prospective phase II Nordic multicentre trial was to assess QoL, response rate and physical function in elderly anaemic MDS patients treated to a target Hb level of >120 g/L....
Reinforced poly(propylene oxide): a very soft and extensible dielectric electroactive polymer

International Nuclear Information System (INIS)

Goswami, K; Mazurek, P; Daugaard, A E; Skov, A L; Galantini, F; Gallone, G

2013-01-01

Poly(propylene oxide) (PPO), a novel soft elastomeric material, and its composites were investigated as a new dielectric electroactive polymer (EAP). The PPO networks were obtained from thiol-ene chemistry by photochemical crosslinking of α,ω-diallyl PPO with a tetra-functional thiol. The elastomer was reinforced with hexamethylenedisilazane treated fumed silica to improve the mechanical properties of PPO. The mechanical properties of PPO and composites thereof were investigated by shear rheology and stress–strain measurements. It was found that incorporation of silica particles improved the stability of the otherwise mechanically weak pure PPO network. Dielectric spectroscopy revealed high relative dielectric permittivity of PPO at 10 3 Hz of 5.6. The relative permittivity was decreased slightly upon addition of fillers, but remained higher than the commonly used acrylic EAP material VHB4910. The electromechanical actuation performance of both PPO and its composites showed properties as good as VHB4910 and a lower viscous loss. (paper)
Glycated haemoglobin (HbA1c), diabetes and trajectories of change in episodic memory performance.

Science.gov (United States)

Pappas, Colleen; Andel, Ross; Infurna, Frank J; Seetharaman, Shyam

2017-02-01

As the ageing population grows, it is important to identify strategies to moderate cognitive ageing. We examined glycated haemoglobin (HbA1c) and diabetes in relation to level and change in episodic memory in older adults with and without diabetes. Data from 4419 older adults with (n=950) and without (n=3469) diabetes participating in a nationally representative longitudinal panel study (the Health and Retirement Study) were examined. Average baseline age was 72.66 years and 58% were women. HbA1c was measured in 2006 and episodic memory was measured using immediate and delayed list recall over 4 biennial waves between 2006 and 2012. Growth curve models were used to assess trajectories of episodic memory change. In growth curve models adjusted for age, sex, education, race, depressive symptoms and waist circumference, higher HbA1c levels and having diabetes were associated with poorer baseline episodic memory (p=0.036 and HbA1c on episodic memory decline was smaller than the effect of age. The results were stronger for women than men and were not modified by age or race. When the main analyses were estimated for those with and without diabetes separately, HbA1c was significantly linked to change in episodic memory only among those with diabetes. Higher HbA1c and diabetes were both associated with declines in episodic memory, with this relationship further exacerbated by having diabetes and elevated HbA1c. HbA1c appeared more important for episodic memory performance among women than men. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Metabolic and Cardiovascular Ageing Indices in Relation to Glycated Haemoglobin in Healthy and Diabetic Subjects.

Science.gov (United States)

Suvarna H I, Shruthi; Moodithaya, Shailaja; Sharma, Raghava

2017-01-01

Ageing is a natural phenomenon that has tremendous amount of control over normal physiological functions. Diabetes mellitus and ageing share common symptoms like stiffness and loss of functioning of tissues due to cross-liked proteins and free radicals. Glycated Haemoglobin (HbA1c) is often used as a stable cumulative index of glycemic control and has shown that even in non-diabetic adults, there is a steady increase in HbA1c levels with age. Aim of the study is to evaluate the strength of association of HbA1c with metabolic and cardiovascular ageing indices in subjects between the age group of 40 to 60 yrs. A total of 220 subjects, with (n=110) and without (n=110) diabetes were assessed for the metabolic and cardiovascular ageing indices. BMI, waist hip ratio, fat percentage, Fasting blood sugar and HbA1c were assessed as metabolic ageing indices. The cardiovascular ageing indices measured were resting heart rate, blood pressure and heart rate variability. Ageing indices were compared between subjects with and without diabetes using independent' t' test and showed that the T2DM group exhibit significant accelerated ageing as compared to that of the controls. Pearson's and partial correlation coefficient was used to assess the association of HbA1c with the ageing indices without and with controlling for chronological age, indicated that, strength of association of levels of HBA1c with cardiovascular and other metabolic indices of ageing is statistically significant. The study concludes that the tightness of glycemic control has a significant impact on the biological ageing process. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Mapping of calf muscle oxygenation and haemoglobin content during dynamic plantar flexion exercise by multi-channel time-resolved near-infrared spectroscopy

International Nuclear Information System (INIS)

Torricelli, Alessandro; Quaresima, Valentina; Pifferi, Antonio; Biscotti, Giovanni; Spinelli, Lorenzo; Taroni, Paola; Ferrari, Marco; Cubeddu, Rinaldo

2004-01-01

A compact and fast multi-channel time-resolved near-infrared spectroscopy system for tissue oximetry was developed. It employs semiconductor laser and fibre optics for delivery of optical signals. Photons are collected by eight 1 mm fibres and detected by a multianode photomultiplier. A time-correlated single photon counting board is used for the parallel acquisition of time-resolved reflectance curves. Estimate of the reduced scattering coefficient is achieved by fitting with a standard model of diffusion theory, while the modified Lambert-Beer law is used to assess the absorption coefficient. In vivo measurements were performed on five healthy volunteers to monitor spatial changes in calf muscle (medial and lateral gastrocnemius; MG, LG) oxygen saturation (SmO 2 ) and total haemoglobin concentration (tHb) during dynamic plantar flexion exercise performed at 50% of the maximal voluntary contraction. At rest SmO 2 was 73.0 ± 0.9 and 70.5 ± 1.7% in MG and LG, respectively (P = 0.045). At the end of the exercise, SmO 2 decreased (69.1 ± 1.8 and 63.8 ± 2.1% in MG and LG, respectively; P 2 and tHb
Detection of viral hepatitis B markers by radioimmunoassay in medical personnel

International Nuclear Information System (INIS)

Marievskij, V.F.; Lejbenzon, A.S.

1990-01-01

Results of revealing B markers of viral hepatitis (VHB) in medical personnel in the city of Zaporozhe by radioimmunoassay method are presented. By the frequency of revealing two markers (HB s Ag and anti-HB s ) risk groups are indicated depending on the profession, age (length of service) of medical personnel
Bridging Theory and Experiment to Address Structural Properties of Truncated Haemoglobins: Insights from Thermobifida fusca HbO.

Science.gov (United States)

Howes, Barry D; Boechi, Leonardo; Boffi, Alberto; Estrin, Dario E; Smulevich, Giulietta

2015-01-01

In this chapter, we will discuss the paradigmatic case of Thermobifida fusca (Tf-trHb) HbO in its ferrous and ferric states and its behaviour towards a battery of possible ligands. This choice was dictated by the fact that it has been one of the most extensively studied truncated haemoglobins, both in terms of spectroscopic and molecular dynamics studies. Tf-trHb typifies the structural properties of group II trHbs, as the active site is characterized by a highly polar distal environment in which TrpG8, TyrCD1, and TyrB10 provide three potential H-bond donors in the distal cavity capable of stabilizing the incoming ligands. The role of these residues in key topological positions, and their interplay with the iron-bound ligands, has been addressed in studies carried out on the CO, F(-), OH(-), CN(-), and HS(-) adducts formed with the wild-type protein and a combinatorial set of mutants, in which the distal polar residues, TrpG8, TyrCD1, and TyrB10, have been singly, doubly, or triply replaced by a Phe residue. In this context, such a complete analysis provides an excellent benchmark for the investigation of the relationship between protein structure and function, allowing one to translate physicochemical properties of the active site into the observed functional behaviour. Tf-trHb will be compared with other members of the group II trHbs and, more generally, with members of the other trHb subgroups. © 2015 Elsevier Ltd. All rights reserved.
Altitude training and haemoglobin mass from the optimised carbon monoxide rebreathing method determined by a meta-analysis.

Science.gov (United States)

Gore, Christopher J; Sharpe, Ken; Garvican-Lewis, Laura A; Saunders, Philo U; Humberstone, Clare E; Robertson, Eileen Y; Wachsmuth, Nadine B; Clark, Sally A; McLean, Blake D; Friedmann-Bette, Birgit; Neya, Mitsuo; Pottgiesser, Torben; Schumacher, Yorck O; Schmidt, Walter F

2013-12-01

To characterise the time course of changes in haemoglobin mass (Hbmass) in response to altitude exposure. This meta-analysis uses raw data from 17 studies that used carbon monoxide rebreathing to determine Hbmass prealtitude, during altitude and postaltitude. Seven studies were classic altitude training, eight were live high train low (LHTL) and two mixed classic and LHTL. Separate linear-mixed models were fitted to the data from the 17 studies and the resultant estimates of the effects of altitude used in a random effects meta-analysis to obtain an overall estimate of the effect of altitude, with separate analyses during altitude and postaltitude. In addition, within-subject differences from the prealtitude phase for altitude participant and all the data on control participants were used to estimate the analytical SD. The 'true' between-subject response to altitude was estimated from the within-subject differences on altitude participants, between the prealtitude and during-altitude phases, together with the estimated analytical SD. During-altitude Hbmass was estimated to increase by ∼1.1%/100 h for LHTL and classic altitude. Postaltitude Hbmass was estimated to be 3.3% higher than prealtitude values for up to 20 days. The within-subject SD was constant at ∼2% for up to 7 days between observations, indicative of analytical error. A 95% prediction interval for the 'true' response of an athlete exposed to 300 h of altitude was estimated to be 1.1-6%. Camps as short as 2 weeks of classic and LHTL altitude will quite likely increase Hbmass and most athletes can expect benefit.
Detection of viral hepatitis B markers by radioimmunoassay in medical personnel. Vyyavlenie markerov virusnogo gepatita B u meditsinskogo personala radioimmunologicheskim metodom

Energy Technology Data Exchange (ETDEWEB)

Marievskij, V F; Lejbenzon, A S

1990-10-01

Results of revealing B markers of viral hepatitis (VHB) in medical personnel in the city of Zaporozhe by radioimmunoassay method are presented. By the frequency of revealing two markers (HB {sub s}Ag and anti-HB{sub s}) risk groups are indicated depending on the profession, age (length of service) of medical personnel.
Accidentabilidad laboral con productos biológicos en profesionales sanitarios de Atención Primaria de Guadalajara (1994-2000

Directory of Open Access Journals (Sweden)

J. Cobos López

2001-11-01

Full Text Available Las infecciones por Virus de la Inmunodeficiencia Humana (VIH,Virus de la Hepatitis B (VHB y Virus de la Hepatitis C (VHC, de graves consecuencias médicas y sociales, se transmiten por contacto con sangre u otros fluídos orgánicos. El personal sanitario puede infectarse mediante el contacto con fluídos corporales y también transmitir dichas infecciones a los pacientes. Los objetivos de este estudio son conocer la magnitud y distribución de la accidentabilidad laboral con productos biológicos en los trabajadores de Atención Primaria de Guadalajara, así como la magnitud de la transmisión de la infección por VIH, VHC y VHB durante un período de siete años como paso previo para intentar reducir las infecciones transmitidas a personal sanitario y para implementar políticas de educación sanitaria que reduzcan este tipo de accidentes.Se realizó un estudio descriptivo de los accidentes laborales notificados por los trabajadores de Atención Primaria de Guadalajara y Comunidad que notificaron un accidente laboral entre 1994 y 2000.Se ha objetivado un aumento en las declaraciones de accidentes laborales con productos biológicos a lo largo del tiempo. El 71.25% de los trabajadores de centros sanitarios están vacunados frente a VHB, proporción que se ve reducida al 52.9% si se considera exclusivamente al personal facultativo. La protección con equipos de protección individual se mantenía en el 45% de los trabajadores en el momento del accidente. No se ha objetivado ninguna infección en el personal sanitario ni en población general estudiada durante el período de seguimiento.
História natural da hepatite crônica B Natural history of chronic hepatitis B

Directory of Open Access Journals (Sweden)

José Carlos Ferraz da Fonseca

2007-12-01

Full Text Available Estima-se que existam 350 milhões de portadores crônicos do VHB distribuídos ao redor do mundo. Três fases de infecção crônica pelo VHB são reconhecidas: fase de imunotolerância (HBsAg e HBeAg positivos, altos títulos de HBV-DNA, ALT normal e não evidência de doença hepática ativa; fase imunoativa ou de hepatite crônica B (HBsAg e HBeAg positivos, altos títulos de HBV-DNA, ALT elevada e evidência de doença hepática ativa; fase de portador inativo do VHB ou assintomático (HBsAg no soro sem o HBeAg , títulos do HBV-DNA An estimated 350 million people worldwide are chronically infected with hepatitis B virus (HBV. Three phases of chronic hepatitis B virus infection is are recognized: the immune tolerant phase (HBeAg-positive, high levels of serum HBV-DNA, normal ALT, and no evidence of active liver diseases, the immune clearance phase or chronic hepatitis phase (HBeAg-positive, high levels of serum HBV-DNA, elevated ALT, and active liver disease , and the inactive carrier state or asymptomatic phase (HBsAg-positive in serum without HBeAg, HBV-DNA levels than < 10(5 copies/mL, and normal ALT levels. Chronic hepatitis B is classified into 2 major forms: HBeAg-positive disease (wild-type HBV and HBeAg negative disease (pre-core/core promoter HBV variant. Both forms can lead to liver cirrhosis, hepatic decompensation and liver cancer. The purpose of this article is to review the principal aspects of natural history of chronic hepatitis B.
Seroprevalencia de marcadores de infecciones transmisibles por vía transfusional en banco de sangre de Colombia

Directory of Open Access Journals (Sweden)

Jair Alberto Patiño Bedoya

2012-12-01

Full Text Available OBJETIVO: Determinar la seroprevalencia de marcadores de infecciones transmisibles por vía transfusional. MÉTODOS: Estudio transversal con fuente de información secundaria, basada en los resultados de pruebas biológicas en los donantes de un banco de sangre de Medellín, Colombia, de 2007 a 2010. Se determinó la seroprevalencia de los marcadores de infección y se compararon según sexo y tipo de donante a través de análisis de frecuencias, chi cuadrado, Fisher y razones de prevalencia. RESULTADOS: La población de base estuvo conformada por 65.535 donantes de los cuales, 3,3% presentaran al menos una prueba biológica positiva. El marcador más prevalente en las pruebas del banco de sangre fue sífilis (1,2%, seguido de tripanosomiasis (1,0%, virus de la hepatitis C (VHC (0,6%, virus de la inmunodeficiencia humana (VIH (0,5% y virus de la hepatitis B (VHB (0,2%. Con base en el laboratorio de referencia se halló una prevalencia de 0,6% para sífilis, 0,1% para VHB y 0% para VHC, VIH y Chagas. Se hallaron diferencias estadísticas en la prevalencia de VHB y sífilis según sexo y tipo de donante. CONCLUSIONES: Los resultados son coherentes con las prevalencias dadas por la Organización Panamericana de la Salud (OPS y se pueden correlacionar con la prevalencia mundial de las infecciones transmisibles por via transfusional. Los resultados hallados en las pruebas del banco de sangre posibilitan la disminución del riesgo transfusional pero limitan la optimización de recursos al excluir donantes clasificados como falsos positivos.
The association of haemoglobin A1C levels with the clinical and CT characteristics of Klebsiella pneumoniae liver abscesses in patients with diabetes mellitus

International Nuclear Information System (INIS)

Wang, Hong-Hau; Tsai, Shih-Hung; Yu, Chih-Yung; Hsu, Hsian-He; Liu, Chang-Hsien; Huang, Guo-Shu; Chang, Wei-Chou; Lin, Jung-Chung; Cheng, Wei-Tung; Chen, Ching-Yang; Tung, Ho-Jui

2014-01-01

To compare the characteristics of Klebsiella pneumoniae liver abscesses (KPLA) in diabetic patients with different levels of glycaemic control. The institutional review board approved this retrospective study. A total of 221 patients with KPLA were included. Clinical features of KPLA were compared. We divided the 120 diabetic patients with KPLA into three subgroups based on haemoglobin A 1C (HbA 1C ) concentration (good, HbA 1C ≤ 7.0 %; suboptimal, 7.0 % 1C ≤ 9.0 %; poor, HbA 1C > 9.0 %). In this study, we used a semiautomated quantitative method to assess the gas and total abscess volumes in KPLA. Statistical analysis was performed with the chi-squared test and one-way analysis of variance. The mortality rate did not significantly differ between the nondiabetic and diabetic groups. However, patients with poor glycaemic control had significantly more complications and therefore a longer hospital stay (P 1C concentration (>9.0 %) have an association with hepatic venous thrombophlebitis, gas formation and metastatic infection complications associated with KPLA. (orig.)
Root Effect Haemoglobins in Fish May Greatly Enhance General Oxygen Delivery Relative to Other Vertebrates.

Directory of Open Access Journals (Sweden)

Jodie L Rummer

Full Text Available The teleost fishes represent over half of all extant vertebrates; they occupy nearly every body of water and in doing so, occupy a diverse array of environmental conditions. We propose that their success is related to a unique oxygen (O2 transport system involving their extremely pH-sensitive haemoglobin (Hb. A reduction in pH reduces both Hb-O2 affinity (Bohr effect and carrying capacity (Root effect. This, combined with a large arterial-venous pH change (ΔpHa-v relative to other vertebrates, may greatly enhance tissue oxygen delivery in teleosts (e.g., rainbow trout during stress, beyond that in mammals (e.g., human. We generated oxygen equilibrium curves (OECs at five different CO2 tensions for rainbow trout and determined that, when Hb-O2 saturation is 50% or greater, the change in oxygen partial pressure (ΔPO2 associated with ΔpHa-v can exceed that of the mammalian Bohr effect by at least 3-fold, but as much as 21-fold. Using known ΔpHa-v and assuming a constant arterial-venous PO2 difference (Pa-vO2, Root effect Hbs can enhance O2 release to the tissues by 73.5% in trout; whereas, the Bohr effect alone is responsible for enhancing O2 release by only 1.3% in humans. Disequilibrium states are likely operational in teleosts in vivo, and therefore the ΔpHa-v, and thus enhancement of O2 delivery, could be even larger. Modeling with known Pa-vO2 in fish during exercise and hypoxia indicates that O2 release from the Hb and therefore potentially tissue O2 delivery may double during exercise and triple during some levels of hypoxia. These characteristics may be central to performance of athletic fish species such as salmonids, but may indicate that general tissue oxygen delivery may have been the incipient function of Root effect Hbs in fish, a trait strongly associated with the adaptive radiation of teleosts.
Análisis de genotipos del virus de la hepatitis B mediante el análisis de polimorfismos de longitud de fragmentos de restricción

Directory of Open Access Journals (Sweden)

Julio-C Rendón

2016-08-01

Conclusiones. Se caracterizó el patrón de genotipificación del genotipo F, subgenotipo F3, del HBV mediante RFLP, análisis in silico y secuenciación. Se requieren nuevos análisis in silico con un número mayor de secuencias para validar los patrones de RFLP de los genotipos y subgenotipos del VHB.
Impact of a new sampling buffer on faecal haemoglobin stability in a colorectal cancer screening programme by the faecal immunochemical test.

Science.gov (United States)

Grazzini, Grazia; Ventura, Leonardo; Rubeca, Tiziana; Rapi, Stefano; Cellai, Filippo; Di Dia, Pietro P; Mallardi, Beatrice; Mantellini, Paola; Zappa, Marco; Castiglione, Guido

2017-07-01

Haemoglobin (Hb) stability in faecal samples is an important issue in colorectal cancer screening by the faecal immunochemical test (FIT) for Hb. This study evaluated the performance of the FIT-Hb (OC-Sensor Eiken) used in the Florence screening programme by comparing two different formulations of the buffer, both in an analytical and in a clinical setting. In the laboratory simulation, six faecal pools (three in each buffer type) were stored at different temperatures and analysed eight times in 10 replicates over 21 days. In the clinical setting, 7695 screenees returned two samples, using both the old and the new specimen collection device (SCD). In the laboratory simulation, 5 days from sample preparation with the buffer of the old SCD, the Hb concentration decreased by 40% at room temperature (25°C, range 22-28°C) and up to 60% at outside temperature (29°C, range 16-39°C), whereas with the new one, Hb concentration decreased by 10%. In the clinical setting, a higher mean Hb concentration with the new SCD compared with the old one was found (6.3 vs. 5.0 µg Hb/g faeces, respectively, Pbuffer under laboratory conditions, but no difference was found in the clinical performance. In our study, only marginal advantages arise from the new buffer. Improvements in sample stability represent a significant target in the screening setting.
Haemoglobin Fontainebleau (HBA2: c. 64G>C) in Oman: molecular and haematological characteristics and interaction with various haemoglobinopathies.

Science.gov (United States)

Daar, Shahina; Al Zadjali, Shoaib; Alkindi, Salam; Wali, Yasser; Al-Rawas, Abdulhakeem; Al-Haddabi, Humood; Al-Riyami, Arwa Z

2018-04-01

To describe the laboratory features of haemoglobin Fontainebleau (Hb FB) and its interactions with various α and β globin gene mutations in the Omani population. Over a period of 10 years, a total of 94 blood samples were suspected to have an α variant on HPLC at the Sultan Qaboos University Hospital, Muscat, Oman. Molecular testing was performed using PCR based techniques to define the variant and to analyse other interacting mutations in either α or β globin genes. Of 94 subjects, molecular analysis confirmed the Hb FB variant in 55 samples (38 non-cord and 17 cord blood). A total of 36/38 non-cord samples were heterozygous for the variant, while all 17 cord blood samples were heterozygotes. A total of 43/55 individuals had a concomitant α and/or β globin gene mutation. Hb FB is the the most common α variant in the Omani population. We report the different HPLC profiles of this variant that we observed, with and without other haemoglobinopathies in non-cord and cord blood samples. This is the first report describing the HPLC profiles of this α globin chain variant on 1 year follow-up testing of cord blood samples. With careful analysis by HPLC, it is possible not only to identify Hb FB but also to predict any concomitant α and/or β globin gene mutations. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Diagnostic incidence of the presence of positive HBsAg: epidemiologic, clinical, and virological characteristics Incidencia diagnóstica de AgHBs positivo: Características epidemiológicas, clínicas y virológicas

Directory of Open Access Journals (Sweden)

Elvira Poves Martínez

2012-01-01

.2% of patients. The most frequent genotype is D, followed by A, and baseline resistance is scarce.Objetivo: analizar las características epidemiológicas, clínicas y virológicas de los pacientes que han sido nuevos diagnósticos de infección activa por VHB, por la presencia de AgHBs positivo, en el servicio de Aparato Digestivo de un hospital de área. Pacientes y métodos: se trata de un estudio prospectivo realizado durante 3 años, en pacientes de nuevo diagnóstico de infección por VHB, donde se han analizado las características epidemiológicas, clínicas, marcadores completos de VHB, cuantificación de DNA-VHB e infección por virus Delta. En los pacientes con alta carga viral se han estudiado genotipos y resistencias. En los pacientes con indicación de biopsias hepáticas sus resultados. Resultados: se han diagnosticado 213 pacientes, 18,8/10.000 habitantes y año. El 61% son varones, el 59% con edad comprendida entre 20 y 40 años. El 53% corresponde a población inmigrante, 46% procedentes de Rumanía y 37% de países subsaharianos. En el momento del diagnóstico, el 2,3% tenían una hepatitis aguda, todos los casos con ictericia, y el 3,3% una cirrosis hepática con hipertensión portal. El AgHBe positivo, descontando los cuadros de hepatitis aguda, estaba presente en el 9%. Las transaminasas eran normales en el 62,2%, el DNA-VHB en el 33,8% es superior a 2.000 UI/ml y la asociación del virus Delta está presente en el 3,3%. En 70 pacientes se analiza el genotipo y resistencias, siendo el más frecuente el D, seguido del A; solo se han detectado dos resistencias basales, una a adefovir y otro a entecavir. En las 36 biopsias hepáticas realizadas, el 32,4% tenían una actividad inflamatoria mayor o igual a 2, y el 23,5% una fibrosis igual o superior a 2, valorada según la clasificación de METAVIR. El 17,4% de los diagnosticados ha precisado tratamiento específico para el VHB según práctica clínica por algún motivo, lo que ha supuesto iniciar

Concordance of haemoglobin A1c, blood pressure and C-reactive protein between children and their parents in Chinese households.

Science.gov (United States)

Dong, F; Howard, A G; Herring, A H; Adair, L S; Thompson, A L; Popkin, B M; Aiello, A E; Zhang, B; Gordon-Larsen, P

2017-10-01

China has the world's highest diabetes prevalence, which along with hypertension and inflammation continues to grow particularly among children. Little is known about the strength of the association of these cardiometabolic risk factors between parents and their children; thus, the potential of household-based strategies to reduce risk is unknown. The objective of the study is to examine the parent-child association for haemoglobin A1c (HbA1c), blood pressure (BP) and C-reactive protein (CRP) in a large, geographically diverse Chinese sample. In 940 parent-child pairs (children aged 7-17 years) who participated in the 2009 China Health and Nutrition Survey, we measured each individual's HbA1c and CRP using fasting blood and BP. We used sex-specific random-effects linear regression to examine the parent-child association for these risk factors, accounting for within-family clustering. Child's HbA1c was positively associated with parental HbA1c. Beta coefficients ranged from 0.06 (95% CI 0.03-0.12) for father-daughter to 0.43 (95% CI 0.28-0.58) for mother-son pairs. We also detected a positive mother-daughter association for BP and positive father-child associations for CRP. The statistically significant parent-child association for HbA1c, BP and CRP in Chinese families suggests that household-based interventions could be useful for confronting the high rates of diabetes, hypertension and inflammation in China. © 2016 The Authors. Pediatric Obesity published by John Wiley & Sons, Ltd on behalf of World Obesity Federation.
Malaria in Pregnancy Is a Predictor of Infant Haemoglobin Concentrations during the First Year of Life in Benin, West Africa.

Directory of Open Access Journals (Sweden)

Manfred Accrombessi

Full Text Available Anaemia is an increasingly recognized health problem in Africa, particularly in infants and pregnant women. Although malaria is known to be the main risk factor of anaemia in both groups, the consequences of maternal factors, particularly malaria in pregnancy (MiP, on infant haemoglobin (Hb concentrations during the first months of life are still unclear.We followed-up a cohort of 1005 Beninese pregnant women from the beginning of pregnancy until delivery. A subsample composed of the first 400 offspring of these women were selected at birth and followed until the first year of life. Placental histology and blood smear at 1st clinical antenatal visit (ANC, 2nd ANC and delivery were used to assess malaria during pregnancy. Infant Hb concentrations were measured at birth, 6, 9 and 12 months of age. A mixed multi-level model was used to assess the association between MiP and infant Hb variations during the first 12 months of life.Placental malaria (difference mean [dm] = - 2.8 g/L, 95% CI [-5.3, -0.3], P = 0.03 and maternal peripheral parasitaemia at delivery (dm = - 4.6 g/L, 95% CI [-7.9, -1.3], P = 0.007 were the main maternal factors significantly associated with infant Hb concentrations during the first year of life. Poor maternal nutritional status and malaria infection during infancy were also significantly associated with a decrease in infant Hb.Antimalarial control and nutritional interventions before and during pregnancy should be reinforced to reduce specifically the incidence of infant anaemia, particularly in Sub-Saharan countries.
Research

African Journals Online (AJOL)

abp

13 avr. 2016 ... infectieux transmissibles par transfusion tels que le virus de l'immunodéficience humaine (VIH), le virus de l'hépatite B (VHB), le virus de l'hépatite. C (VHC) et la .... l'instar des autres pays à faible revenu, la République Démocratique du Congo ... et du Programme National de Lutte contre le Sida et IST qui.
Coinfection of intestinal schistosomiasis and malaria and association with haemoglobin levels and nutritional status in school children in Mara region, Northwestern Tanzania: a cross-sectional exploratory study.

Science.gov (United States)

Kinung'hi, Safari M; Mazigo, Humphrey D; Dunne, David W; Kepha, Stella; Kaatano, Godfrey; Kishamawe, Coleman; Ndokeji, Samuel; Angelo, Teckla; Nuwaha, Fred

2017-11-09

Schistosomiasis represents a major public health problem in Tanzania despite ongoing national control efforts. This study examined whether intestinal schistosomiasis is associated with malaria and assessed the contribution of intestinal schistosomiasis and malaria on anaemia and undernutrition in school children in Mara region, North-western Tanzania. Stool samples were collected from each of 928 school children randomly selected from 5 schools and examined for intestinal schistosomiasis using the Kato Katz method. Finger prick blood samples were collected and examined for malaria parasites and haemoglobin concentrations using the Giemsa stain and Haemocue methods, respectively. Nutritional status was assessed by taking anthropometric measurements. The overall prevalence and infection intensity of S. mansoni was 85.6% (794/928) and 192 (100-278), respectively. The prevalence of malaria was 27.4% (254/928) with significant differences among villages (χ 2 = 96.11, p malaria are prevalent in Mara region. Coinfections of these parasites as well as chronic undernutrition were also common. We recommend Mara region to be included in national schistosomiasis control programmes.
Accidentes ocupacionales de riesgo biológico en Antioquia, Colombia. Enero de 2010 a diciembre de 2011

Directory of Open Access Journals (Sweden)

Franco E Montufar Andrade

Full Text Available Antecedentes: Los accidentes ocupacionales de riesgo biológico tienen como mayor riesgo postexposición la seroconversión para el virus de la inmunodeficiencia humana (VIH y virus de la hepatitis C (VHC y B (VHB. En la literatura latinoamericana aún faltan estudios que aporten información al respecto. Objetivo: Describir las características epidemiológicas de los accidentes ocupacionales de riesgo biológico. Metodología: Estudio descriptivo longitudinal. Resultados: Se describen 231 episodios de riesgo biológico. La mediana de edad fue 30 años. Un 65,8% fueron mujeres. Las principales actividades laborales fueron: auxiliares de enfermería (22,9%, aseo hospitalario (16,5%, estudiantes (14,3%, recolección de basuras (5,2% y médicos (4,8%. El mecanismo del accidente fue: punción (77%, herida cortante (11,3% y contacto con mucosas (9,1%. En 24% la fuente fue conocida y de estas fueron positivas para VIH un 62,5%, para VHB un 3,5% y para VHC un 5,3%. Recibieron profilaxis postexposición (PPE un 75,8% de los 231. Entre los expuestos a fuente VIH positiva, recibieron PPE biconjugada 85,1% y terapia triple 14,8% De los que recibieron profilaxis, 40% presentaron reacciones adversas, siendo las gastrointestinales (77,1% y las neurológicas (45,7% las más frecuentes. Al ingreso, un 67,1% tenían anticuerpos protectores para VHB. Durante el seguimiento se confirmó una seroconversión postexposición para VIH. Conclusión: El riesgo de adquirir infecciones postexposición ocupacional es una realidad en nuestro medio; se debe hacer énfasis en estrategias de prevención de exposición, introyectar la cultura del reporte y el manejo adecuado de la profilaxis postexposición.
Séroprévalence de l’AgHBs chez la femme enceinte dans le centre du Maroc

Science.gov (United States)

Sbiti, Mohammed; Khalki, Hanane; Benbella, Imane; louzi, Lhoussaine

2016-01-01

La transmission materno-fœtale du virus de l'hépatite B (VHB) est un problème qui préoccupe toujours les autorités sanitaires à travers le monde et suscite la mise en place de mesures préventives renforcées. Le statut réplicatif du virus chez la mère séropositive, évalué par la positivité de l'AgHbe et le taux de la charge virale, conditionne le risque de contamination qui est plus important en période péri-natale. Les mères porteuses chroniques du VHB constituent un véritable réservoir de la transmission verticale de cette infection. Nous avons étudié, à travers cette enquête sur 1120 femmes enceintes Marocaines, la séroprévalence de l'AgHBs qui était de 2,35%, dans le but d'alimenter les données nationales sur ce sujet. Parmi ces femmes séropositives pour l'AgHBs, 79,1% avaient un AgHBe négatif et ont bénéficié d'une recherche moléculaire qui s'est révélée positive dans 89,4% des cas. La vaccination de la femme en âge de procréer est l'un des piliers majeurs de la prévention de la transmission verticale du VHB, seulement 2,4% de nos patientes étaient vaccinées. Ceci relève l'intérêt du dépistage au cours de la grossesse, qui doit se focaliser sur la sensibilisation à la vaccination de femmes séronégatives, et le suivi par biologie moléculaire des mères séropositives dans le but d'instaurer un traitement prophylactique adéquat. PMID:27795784
Anisotropic D-EAP Electrodes and their Application in Spring Roll Actuators

Science.gov (United States)

Fang, Xiaomeng

Electroactive polymers (EAPs) exhibit shape change when subjected to an electric field. They are lightweight, soft, and inexpensive, while they are easy to process, shape, and tune to offer a broad range of mechanical and electrical properties. Dielectric electroactive polymers (DEAP) constitute a class of EAPs with great potential. D-EAPs consist of physically or chemically cross-linked macromolecular networks and are mechanically isotopic. Therefore, in most actuator applications that require directional electromechanical response, it is necessary to use other complex means to direct the stress/strain in the preferred direction. In this work, a simple carbon nanotube (CNT) based electrode for D-EAP actuators is demonstrated that vastly improves directional strain response originating from the mechanical anisotropy of the electrode material. Using this novel approach, the mechanical anisotropy, defined as the ratio of initial modulus in fiber direction and that in cross-fiber direction, of the CNT electroded VHB actuators, ranges from 7.9 to 11.2. Hence, the CNT-VHB flat film actuators show high directed linear actuation strain in cross-fiber direction of greater than 25% meanwhile almost no strain in fiber direction at a relatively low electric field (120 V mum-1). The morphology of the CNT sheets has critical influence on their mechanical properties and resultant actuator performance. The results demonstrate the efficacy of microcombing and selective laser etching processes to improve the CNT fiber alignment to produce pure unidirectional strain of 33% at a relatively moderate electric field. Unidirectional D-EAP composite laminates using polyurethane and polyamide monofilaments are also employed in spring roll actuators to investigate their directional mechanical and electromechanical properties. While CNT electroded D-EAP spring roll actuators were found to have about the same performance as actuators with carbon grease electrodes (6.5% strain in CNT
Ultrasound-guided diffuse optical tomography (DOT) of invasive breast carcinoma: Does tumour total haemoglobin concentration contribute to the prediction of axillary lymph node status?

Energy Technology Data Exchange (ETDEWEB)

Zhu, Qingli, E-mail: qinglizhu@gmail.com [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China); Xiao, Mengsu, E-mail: xiaomengsu_2000@sina.com [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China); You, Shanshan, E-mail: shanshan_0531@sina.com [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China); Zhang, Jing, E-mail: zhang.jing1029@163.com [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China); Jiang, Yuxin, E-mail: yuxinjiangxh@yahoo.com.cn [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China); Lai, Xingjian, E-mail: lxjpumch@yahoo.com.cn [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China); Dai, Qing, E-mail: qingdai_2000@yahoo.com [Department of Diagnostic Ultrasound, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences, Shuaifuyuan 1, Dongcheng District, Beijing 100730 (China)

2012-11-15

Objectives: To prospectively study the ultrasound-guided near-infrared diffuse optical tomography (DOT) findings of the total haemoglobin concentration (THC) detected in invasive breast carcinomas and its contribution to the prediction of axillary lymph node (LN) status. Methods: A total of 195 invasive breast carcinomas were prospectively studied with DOT before surgery. Lumpectomy or mastectomy with full axillary nodal dissection was performed. Tumour size and THC level were correlated with LN status by a logistic regression analysis. Results: One hundred twenty-four patients (63.59%) was LN(-) and 71 (36.41%) was LN(+). The average THC was significantly higher in the LN(+) group than in the LN(-) group (252.94 {+-} 69.19 {mu}mol/L versus 203.86 {+-} 83.13 {mu}mol/L, P = 0.01). A multivariate analysis showed an independent relationship between the probability of axillary metastasis, elevated THC level (P = 0.01), and tumour size (P = 0.001). The odds ratio with THC {>=} 140 {mu}mol/L was 13.651 (1.781-104.560), whereas that of tumour size with a 1 cm increment was only 1.777 (1.283-2.246). Conclusions: The THC level and the tumour size are independent and preoperative predictors of axillary nodal status; these variables may improve the diagnosis of patients with lymph node metastasis.
Haemoglobin mass and running time trial performance after recombinant human erythropoietin administration in trained men.

Directory of Open Access Journals (Sweden)

Jérôme Durussel

Full Text Available UNLABELLED: Recombinant human erythropoietin (rHuEpo increases haemoglobin mass (Hb(mass and maximal oxygen uptake (v O(2 max. PURPOSE: This study defined the time course of changes in Hb(mass, v O(2 max as well as running time trial performance following 4 weeks of rHuEpo administration to determine whether the laboratory observations would translate into actual improvements in running performance in the field. METHODS: 19 trained men received rHuEpo injections of 50 IU•kg(-1 body mass every two days for 4 weeks. Hb(mass was determined weekly using the optimized carbon monoxide rebreathing method until 4 weeks after administration. v O(2 max and 3,000 m time trial performance were measured pre, post administration and at the end of the study. RESULTS: Relative to baseline, running performance significantly improved by ∼6% after administration (10:30±1:07 min:sec vs. 11:08±1:15 min:sec, p<0.001 and remained significantly enhanced by ∼3% 4 weeks after administration (10:46±1:13 min:sec, p<0.001, while v O(2 max was also significantly increased post administration (60.7±5.8 mL•min(-1•kg(-1 vs. 56.0±6.2 mL•min(-1•kg(-1, p<0.001 and remained significantly increased 4 weeks after rHuEpo (58.0±5.6 mL•min(-1•kg(-1, p = 0.021. Hb(mass was significantly increased at the end of administration compared to baseline (15.2±1.5 g•kg(-1 vs. 12.7±1.2 g•kg(-1, p<0.001. The rate of decrease in Hb(mass toward baseline values post rHuEpo was similar to that of the increase during administration (-0.53 g•kg(-1•wk(-1, 95% confidence interval (CI (-0.68, -0.38 vs. 0.54 g•kg(-1•wk(-1, CI (0.46, 0.63 but Hb(mass was still significantly elevated 4 weeks after administration compared to baseline (13.7±1.1 g•kg(-1, p<0.001. CONCLUSION: Running performance was improved following 4 weeks of rHuEpo and remained elevated 4 weeks after administration compared to baseline. These field performance effects coincided with r
The influence of carbon monoxide bolus on the measurement of total haemoglobin mass using the optimized CO-rebreathing method

International Nuclear Information System (INIS)

Turner, G; Richardson, A J; Maxwell, N S; Pringle, J S M; Ingham, S A; Fudge, B W

2014-01-01

The optimized carbon monoxide (CO) rebreathing method (oCOR-method) is routinely used to measure total haemoglobin mass (tHbmass). The tHbmass measure is subject to a test-retest typical error of ∼2%, mostly from the precision of carboxyhaemoglobin (HbCO) measurement. We hypothesized that tHbmass would be robust to differences in the bolus of CO administered during the oCOR-method. Twelve participants (ten males and two females; age 27 ± 6 yr, height 177 ± 11 cm and mass 73.9 ± 12.1 kg) completed the oCOR-method on four occasions. Different bolus of CO were administered (LOW: 0.6 ml kg −1 ; MED 1 : 1.0 ml kg −1 and HIGH: 1.4 ml kg −1 ); to determine the reliability of MED 1 , a second trial was conducted (MED 2 ). tHbmass was found to be significantly less from the HIGH CO bolus (776 ± 148 g) when compared to the LOW CO (791 ± 149 g) or MED 1 CO (788 ± 149 g) trials. MED 2 CO was 785 ± 150 g. The measurement of tHbmass is repeatable to within 0.8%, but a small and notable difference was seen when using a HIGH CO bolus (1.4 to 1.9% less), potentially due to differences in CO uptake kinetics. Previously, an improved precision of the oCOR-method was thought to require a higher bolus of CO (i.e. larger ▵%HbCO), as commercial hemoximeters only estimate %HbCO levels to a single decimal place (usually ± 0.1%). With the new hemoximeter used in this study, a bolus of 1.0 ml kg −1 allows adequate precision with acceptable safety. (note)
Research

African Journals Online (AJOL)

ebutamanya

15 mars 2016 ... Selon les marqueurs évolutifs, 112 patients (78,3%) avaient un AgHBe négatif. Quant à la charge virale, 106 patients (74,2%) avaient une virémie inférieure à 2000UI/ml et une fibrose minime inférieure à 7kpa selon le FibroScan. Parmi eux, 13 malades avaient un ADN du VHB indétectable (<20UI/ml).
Eliminating electromechanical instability in dielectric elastomers by employing pre-stretch

International Nuclear Information System (INIS)

Jiang, Liang; Jerrams, Stephen; Betts, Anthony; Kennedy, David

2016-01-01

Electromechanical instability (EMI) is one of most common failure modes for dielectric elastomers (DEs). It has been reported that pre-stretching a DE sample can suppress EMI due to strain stiffening taking place for larger strains and a higher elastic modulus are achieved at high stretch ratios when a voltage is applied to the material. In this work, the influence of equi-biaxial stretch on DE secant modulus was studied using VHB 4910 and silicone rubber (SR) composites containing barium titanate (BaTiO 3 , BT) particles and also dopamine coated BT (DP-BT) particles. The investigation of equi-biaxial deformation and EMI failure for VHB 4910 was undertaken by introducing a voltage-stretch function. The results showed that EMI was suppressed by equi-biaxial pre-stretch for all the DEs fabricated and tested. The stiffening properties of the DE materials were also studied with respect to the secant modulus. Furthermore, a voltage-induced strain of above 200% was achieved for the polyacrylate film by applying a pre-stretch ratio of 2.0 without EMI occurring. However, a maximum voltage-induced strain in the polyacrylate film of 78% was obtained by the SR/20 wt% DP-BT composite for a lower applied pre-stretch ratio of 1.6 and again EMI was eliminated. (paper)
Diving behaviour and haemoglobin function: the primary structure of the alpha- and beta-chains of the sea turtle (Caretta caretta) and its functional implications.

Science.gov (United States)

Petruzzelli, R; Aureli, G; Lania, A; Galtieri, A; Desideri, A; Giardina, B

1996-06-15

The amino acid sequence of the alpha- and beta-chains of haemoglobin (Hb) from the loggerhead sea turtle (Caretta caretta) has been determined. Comparison with that of human Hb shows differences in several residues involved in both alpha 1 beta 1 and alpha 1 beta 2 packing contacts. On the whole, in spite of the mutations, the essential characteristics of both interfaces seem to be maintained. The functional properties of the sea turtle Hb have been investigated at different temperatures and as a function of proton, chloride and organic phosphate concentrations. In addition to overall similarities shared with most of the vertebrate Hbs previously described, this molecule shows significant differences which could be related to the life behaviour of the turtle. In fact, while the shape of the Bohr-effect curve is well adapted for gas exchange during prolonged dives, the very small enthalpy change for O2 binding ensures that O2 delivery becomes essentially insensitive to the temperature changes of the environment. Moreover, and similarly to the case of emperor penguin Hb, the small alkaline Bohr effect appears to be only choride-linked, since the pH dependence of the O2 affinity is abolished in the absence of this ion. These functional characteristics are discussed on the basis of the primary structure of alpha- and beta-chains.
[Hemoglobinopathies--clinical symptoms and diagnosis of thalassemia and abnormal hemoglobins].

Science.gov (United States)

Herklotz, R; Risch, L; Huber, A R

2006-01-01

Haemoglobinopathies constitute entities that are generated by either an abnormal haemoglobin or thalassaemias. While abnormal haemoglobins are caused by a qualitative structural abnormality of the haemoglobin molecule, thalassaemias result by diminished synthesis of the globin chain. Due to increased immigration from Asia, Africa and the Mediterranean to Northern Europe, haemoglobin S, haemoglobin C, haemoglobin E are also encountered commonly in Switzerland, while other abnormal haemoglobins are rare, yet can cause clinically relevant symptoms. This include haemolysis, polyglobulia, cyanosis or a combination thereof Thalassaemia-syndroms constitute with two million affected individuals to the most prelevant monogenetic diseases worldwide. Due to migration into Switzerland, they are also found quite commonly among our patients with 10-15 per cent of all hypochromic, microcytic, anemia second only to iron deficiency. Importantly, thalassaemias and haemoglobinopathies can occur concomitantly sometimes even with a normal haemoglobin variant. This results in wide-spread presentations, making diagnosis and clinical judgement difficult. We describe in this article not only physiological mechanisms and clinical presentation but also propose a step-wise diagnostic algorithm including selective use of molecular biology methods.
Haemoglobin changes and risk of anaemia following treatment for uncomplicated falciparum malaria in sub-Saharan Africa.

Science.gov (United States)

Zwang, Julien; D'Alessandro, Umberto; Ndiaye, Jean-Louis; Djimdé, Abdoulaye A; Dorsey, Grant; Mårtensson, Andreas A; Karema, Corine; Olliaro, Piero L

2017-06-23

Anaemia is common in malaria. It is important to quantitate the risk of anaemia and to distinguish factors related to the natural history of disease from potential drug toxicity. Individual-patient data analysis based on nine randomized controlled trials of treatments of uncomplicated falciparum malaria from 13 sub-Saharan African countries. Risk factors for reduced haemoglobin (Hb) concentrations and anaemia on presentation and after treatment were analysed using mixed effect models. Eight thousand eight hundred ninety-seven patients (77.0% <5 years-old) followed-up through 28 days treated with artemisinin combination therapy (ACT, 90%, n = 7968) or non-ACT. At baseline, under 5's had the highest risk of anaemia (77.6% vs. 32.8%) and higher parasitaemia (43,938 μl) than older subjects (2784 μl). Baseline anaemia increased the risk of parasitological recurrence. Hb began to fall after treatment start. In under 5's the estimated nadir was ~35 h (range 29-48), with a drop of -12.8% from baseline (from 9.8 g/dl to 8.7 g/dl, p = 0.001); in under 15's, the mean Hb decline between day 0-3 was -4.7% (from 9.4 to 9.0 g/dl, p = 0.001). The degree of Hb loss was greater in patients with high pre-treatment Hb and parasitaemia and with slower parasite reduction rates, and was unrelated to age. Subsequently, Hb increased linearly (+0.6%/day) until day 28, to reach +13.8% compared to baseline. Severe anaemia (<5 g/dl, 2 per 1000 patients) was transient and all patients recovered after day 14, except one case of very severe anaemia associated with parasite recurrence at day 28. There was no systematic difference in Hb concentrations between treatments and no case of delayed anaemia. On presentation with acute malaria young children with high parasitaemia have the highest risk of anaemia. The majority of patients experience a drop in Hb while on treatment as early as day 1-2, followed by a linear increase through follow-up. The degree of the early Hb dip is
Accidentabilidad laboral con productos biológicos en profesionales sanitarios de Atención Primaria de Guadalajara (1994-2000 Work accidents with biological products in Primary Care workers in Guadalajara (1994-2000

Directory of Open Access Journals (Sweden)

A. Silva Mato

2001-11-01

Full Text Available Las infecciones por Virus de la Inmunodeficiencia Humana (VIH,Virus de la Hepatitis B (VHB y Virus de la Hepatitis C (VHC, de graves consecuencias médicas y sociales, se transmiten por contacto con sangre u otros fluídos orgánicos. El personal sanitario puede infectarse mediante el contacto con fluídos corporales y también transmitir dichas infecciones a los pacientes. Los objetivos de este estudio son conocer la magnitud y distribución de la accidentabilidad laboral con productos biológicos en los trabajadores de Atención Primaria de Guadalajara, así como la magnitud de la transmisión de la infección por VIH, VHC y VHB durante un período de siete años como paso previo para intentar reducir las infecciones transmitidas a personal sanitario y para implementar políticas de educación sanitaria que reduzcan este tipo de accidentes.Se realizó un estudio descriptivo de los accidentes laborales notificados por los trabajadores de Atención Primaria de Guadalajara y Comunidad que notificaron un accidente laboral entre 1994 y 2000.Se ha objetivado un aumento en las declaraciones de accidentes laborales con productos biológicos a lo largo del tiempo. El 71.25% de los trabajadores de centros sanitarios están vacunados frente a VHB, proporción que se ve reducida al 52.9% si se considera exclusivamente al personal facultativo. La protección con equipos de protección individual se mantenía en el 45% de los trabajadores en el momento del accidente. No se ha objetivado ninguna infección en el personal sanitario ni en población general estudiada durante el período de seguimiento.Infections by Human Inmunodeficiency Virus (HIV,Hepatitis B Virus (HBV and Hepatitis C virus (HCV,with important medical and social consequences, can be transmitted by contact with human fluids. Health care workers can be infected from these fluids and they can also infect their patients. The objetive of this study is to know the magnitude and distribution of
Infección oculta por el virus de la hepatitis B en hijos de madres positivas al HBsAg

Directory of Open Access Journals (Sweden)

Marité Bello-Corredor

2016-04-01

Full Text Available La infección oculta por el virus de la hepatitis B (IOB, se caracteriza por la presencia en suero o plasma del genoma viral (ADN-VHB y anticuerpos contra la proteína de la cápside (anti-HBc en ausencia del antígeno de superficie (HBsAg, marcador que tradicionalmente se emplea para identificar la presencia del virus. Con el objetivo de caracterizar la presencia de IOB en hijos de madres positivas al HBsAg, se estudiaron 291 muestras séricas de niños con la condición de ser HBsAg (- y anticuerpos anti-HBsAg (anti-HBs menores de 50 UI/L, conservadas en la seroteca del Laboratorio de Referencia Nacional de Hepatitis Virales. Se realizaron ensayos para determinar la exposición al virus (anti-HBc, a los sueros anti-HBc (+ se les realizó Reacción en Cadena de la Polimerasa en Tiempo Real (RCP-TR para determinar y cuantificar el ADN-VHB. La prevalencia de exposición al VHB (anti-HBc fue 16,8% (49/291. El ADN viral se cuantificó en el 14% (6/43 de los casos anti-HBc (+, observándose cargas virales que oscilaban entre 2,15 x 101 hasta 3,42 x 101 UI/mL. La prevalencia de la IOB para el total de los pacientes analizados fue 2,1% (6/291, considerada relativamente baja. No se encontró asociación significativa entre las variables sociodemográficas analizadas tales como: edad, sexo y provincia de procedencia. La IOB está presente en hijos de madres positivas al HBsAg, a pesar de la profilaxis contra la hepatitis B. Por lo tanto, se requiere de pesquisajes adecuados para detectar dicha entidad. Las implicaciones clínicas y epidemiológicas de la misma, requieren de un estrecho monitoreo y atención de estos pacientes. Este estudio se realiza por primera vez en Cuba y aporta conocimientos útiles para el diagnóstico, prevención y control de esta enfermedad en niños.
Inmunogenicidad de la vacuna frente al virus de la hepatitis B en pacientes con enfermedad inflamatoria intestinal

OpenAIRE

Olsen Rodríguez, Renée

2017-01-01

La colitis ulcerosa (CU) y la enfermedad de Crohn (EC) son patologías que se denominan conjuntamente enfermedad inflamatoria intestinal (EII). Su patogenia es poco conocida, pero si se sabe que hay una respuesta inmune frente a estructuras del tubo digestivo. El tratamiento se basa es disminuir esta inmunogenicidad administrando corticoides, inmunosupresores o terapias biológicas. Todas estas circunstancias favorecen las infecciones y reactivaciones por el virus de la hepatitis B (VHB). La pr...
Conference Logistics Management 2013

CERN Document Server

Haasis, Hans-Dietrich; Kopfer, Herbert; Kotzab, Herbert; Schönberger, Jörn

2015-01-01

This contributed volume contains the collected research papers presented at the Logistik-Management-Konferenz 2013 organized by the VHB Wissenschaftliche Kommission Logistik, held in Bremen 2013. The papers reflect the current state-of-the-art in logistics and supply chain management, focusing on environmental sustainability in logistics and supply chain network dynamics and control. The target audience primarily comprises research experts in the field as well as practitioners but the book may also be beneficial for graduate students.
Vaccination contre l'hepatite B chez les patients infectes par le VIH ...

African Journals Online (AJOL)

Objectif : Les objectifs de notre étude étaient de décrire les profils d'immunisation contre le VHB des patients VIH positifs non porteurs d'Ag HBs et d'identifier les patients successibles d'être vaccinés contre l'hépatite B. Matériels et méthodes : Il s'était agi d'une étude transversale, descriptive qui s'était déroulée du 1er ...

Two-step counterdiffusion protocol for the crystallization of haemoglobin II from Lucina pectinata in the pH range 4–9

International Nuclear Information System (INIS)

Nieves-Marrero, Carlos A.; Ruiz-Martínez, Carlos R.; Estremera-Andújar, Rafael A.; González-Ramírez, Luis A.; López-Garriga, Juan; Gavira, José A.

2010-01-01

oxyHbII crystals have been grown at pH 4, 5, 8 and 9 by capillary counterdiffusion technique by a two-step protocol: (i) mini screen (searching step) and (ii) pH screen (optimization step). Lucina pectinata haemoglobin II (HbII) transports oxygen in the presence of H 2 S to the symbiotic system in this bivalve mollusc. The composition of the haem pocket at the distal site includes TyrB10 and GlnE7, which are very common in other haem proteins. Obtaining crystals of oxyHbII at various pH values is required in order to elucidate the changes in the conformations of TyrB10 and GlnE7 and structural scenarios induced by changes in pH. Here, the growth of crystals of oxyHbII using the capillary counterdiffusion (CCD) technique at various pH values using a two-step protocol is reported. In the first step, a mini-screen was used to validate sodium formate as the best precipitating reagent for the growth of oxyHbII crystals. The second step, a pH screen typically used for optimization, was used to produce crystals in the pH range 4–9. Very well faceted prismatic ruby-red crystals were obtained at all pH values. X-ray data sets were acquired using synchrotron radiation of wavelength 0.886 Å (for the crystals obtained at pH 5) and 0.908 Å (for those obtained at pH 4, 8 and 9) to maximum resolutions of 3.30, 1.95, 1.85 and 2.00 Å for the crystals obtained at pH 4, 5, 8 and 9, respectively. All of the crystals were isomorphous and belonged to space group P4 2 2 1 2
Evaluation of a New Technique for iFOBT Utilising a New Sample Collection Device with Increased Buffer Stability.

Science.gov (United States)

Bruns-Toepler, Markus; Hardt, Philip

2017-07-01

The aims of the present study were: (i) Evaluate specificity and sensitivity of Hb Smart enzyme-linked immunosorbent assay (ELISA) (ScheBo Biotech) compared to colonoscopy results and (ii) assess stability of a new sample collection device containing a newly formulated buffer to extract haemoglobin using buffer and stool samples spiked with defined concentrations of haemoglobin. Stool samples were quantified with the ELISA method. The stability of haemoglobin in the extraction buffer and in native stool samples, respectively, was determined daily by ELISA during storage for 5 days at 4°C and at room temperature after addition of haemoglobin. Haemoglobin ELISA had a sensitivity of 78.4% for detection of CRC with a specificity of 98%. Haemoglobin extracted in corresponding extraction buffer demonstrated stability throughout storage for 5 days at 4°C and at room temperature. Hb Smart represents a very promising tool for large-scale screening of CRC with regard to sample handling, stability and analysis of haemoglobin in faeces. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.
Haematological and Serum Bio-Chemical Parameters of West ...

African Journals Online (AJOL)

Haematological and Serum Bio-Chemical Parameters of West African Dwarf and Kalahari Red Goats in the Humid Tropics. ... Haematological results showed that white blood cell count, haemoglobin concentration, haematocrit, mean corpuscular volume, mean corpuscular haemoglobin and mean corpuscular haemoglobin ...
Biaxial experimental and analytical characterization of a dielectric elastomer

Science.gov (United States)

Helal, Alexander; Doumit, Marc; Shaheen, Robert

2018-01-01

Electroactive polymers (EAPs) have emerged as a strong contender for use in low-cost efficient actuators in multiple applications especially related to biomimetic and mobile-assistive devices. Dielectric elastomers (DE), a subcategory of these smart materials, have been of particular interest due to their large achievable deformation and favourable mechanical and electro-mechanical properties. Previous work has been completed to understand the behaviour of these materials; however, their properties require further investigation to properly integrate them into real-world applications. In this study, a biaxial tensile experimental evaluation of 3M™ VHB 4905 and VHB 4910 is presented with the purpose of illustrating the elastomers' transversely isotropic mechanical behaviours. These tests were applied to both tapes for equibiaxial stretch rates ranging between 0.025 and 0.300 s-1. Subsequently, a dynamic planar biaxial visco-hyperelastic constitutive relationship was derived from a Kelvin-Voigt rheological model and the general Hooke's law for transversely isotropic materials. The model was then fitted to the experimental data to obtain three general material parameters for either tapes. The model's ability to predict tensile stress response and internal energy dissipation, with respect to experimental data, is evaluated with good agreement. The model's ability to predict variations in mechanical behaviour due to changes in kinematic variables is then illustrated for different conditions.
Defining a glycated haemoglobin (HbA1c) level that predicts increased risk of penile implant infection.

Science.gov (United States)

Habous, Mohamad; Tal, Raanan; Tealab, Alaa; Soliman, Tarek; Nassar, Mohammed; Mekawi, Zenhom; Mahmoud, Saad; Abdelwahab, Osama; Elkhouly, Mohamed; Kamr, Hatem; Remeah, Abdallah; Binsaleh, Saleh; Ralph, David; Mulhall, John

2018-02-01

To re-evaluate the role of diabetes mellitus (DM) as a risk factor for penile implant infection by exploring the association between glycated haemoglobin (HbA1c) levels and penile implant infection rates and to define a threshold value that predicts implant infection. We conducted a multicentre prospective study including all patients undergoing penile implant surgery between 2009 and 2015. Preoperative, perioperative and postoperative management were identical for the entire cohort. Univariate analysis was performed to define predictors of implant infection. The HbA1c levels were analysed as continuous variables and sequential analysis was conducted using 0.5% increments to define a threshold level predicting implant infection. Multivariable analysis was performed with the following factors entered in the model: DM, HbA1C level, patient age, implant type, number of vascular risk factors (VRFs), presence of Peyronie's disease (PD), body mass index (BMI), and surgeon volume. A receiver operating characteristic (ROC) curve was generated to define the optimal HbA1C threshold for infection prediction. In all, 902 implant procedures were performed over the study period. The mean patient age was 56.6 years. The mean HbA1c level was 8.0%, with 81% of men having a HbA1c level of >6%. In all, 685 (76%) implants were malleable and 217 (24%) were inflatable devices; 302 (33.5%) patients also had a diagnosis of PD. The overall infection rate was 8.9% (80/902). Patients who had implant infection had significantly higher mean HbA1c levels, 9.5% vs 7.8% (P HbA1c level, we found infection rates were: 1.3% with HbA1c level of 9.5% (P HbA1c level, whilst a high-volume surgeon had a protective effect and was associated with a reduced infection risk. Using ROC analysis, we determined that a HbA1c threshold level of 8.5% predicted infection with a sensitivity of 80% and a specificity of 65%. Uncontrolled DM is associated with increased risk of infection after penile implant surgery
The association of haemoglobin A{sub 1C} levels with the clinical and CT characteristics of Klebsiella pneumoniae liver abscesses in patients with diabetes mellitus

Energy Technology Data Exchange (ETDEWEB)

Wang, Hong-Hau [Tri-Service General Hospital, National Defense Medical Center, Department of Radiology, Taipei (China); Tri-Service General Hospital Songshan Branch. National Defense Medical Center, Department of Radiology, Taipei (China); Tsai, Shih-Hung [Tri-Service General Hospital, National Defense Medical Center, Department of Emergency Medicine, Taipei (China); Yu, Chih-Yung; Hsu, Hsian-He; Liu, Chang-Hsien; Huang, Guo-Shu; Chang, Wei-Chou [Tri-Service General Hospital, National Defense Medical Center, Department of Radiology, Taipei (China); Lin, Jung-Chung [Tri-Service General Hospital, National Defense Medical Center, Division of Infectious Diseases and Tropical Medicine, Department of Internal Medicine, Taipei (China); Cheng, Wei-Tung; Chen, Ching-Yang [Tri-Service General Hospital Songshan Branch. National Defense Medical Center, Department of Radiology, Taipei (China); Tung, Ho-Jui [Asia University, Department of Healthcare Administration, Taichung (China)

2014-05-15

To compare the characteristics of Klebsiella pneumoniae liver abscesses (KPLA) in diabetic patients with different levels of glycaemic control. The institutional review board approved this retrospective study. A total of 221 patients with KPLA were included. Clinical features of KPLA were compared. We divided the 120 diabetic patients with KPLA into three subgroups based on haemoglobin A{sub 1C} (HbA{sub 1C}) concentration (good, HbA{sub 1C} ≤ 7.0 %; suboptimal, 7.0 % < HbA{sub 1C} ≤ 9.0 %; poor, HbA{sub 1C} > 9.0 %). In this study, we used a semiautomated quantitative method to assess the gas and total abscess volumes in KPLA. Statistical analysis was performed with the chi-squared test and one-way analysis of variance. The mortality rate did not significantly differ between the nondiabetic and diabetic groups. However, patients with poor glycaemic control had significantly more complications and therefore a longer hospital stay (P < 0.05). In our study, CT and quantitative analyses found that patients in the group with poor glycaemic control had a significantly higher incidence of gas formation and hepatic venous thrombophlebitis and a higher gas-to-abscess volume ratio than patients with suboptimal and good glycaemic control (P < 0.05). Diabetic patients with a high HbA{sub 1C} concentration (>9.0 %) have an association with hepatic venous thrombophlebitis, gas formation and metastatic infection complications associated with KPLA. (orig.)
Factores asociados a una respuesta inadecuada a la vacunación contra la hepatitis B en personal sanitario

OpenAIRE

Tolosa Martínez Natividad; Tenías Burillo José María; Pérez Bermúdez Brígido; Sanchis Álvarez Juan Bautista

1998-01-01

FUNDAMENTO: La vacuna recombinante contra la hepatitis B confiere inmunidad aproximadamente en el 95 % de los casos, pero existe un porcentaje que responde insuficientemente. El objetivo de este trabajo es evaluar los factores que se asocian con una inadecuada respuesta inmunitaria. MÉTODOS: Se trata de un estudio observacional y analítico en el que se sigue retrospectivamente una cohorte de sujetos vacunados frente al virus de la hepatitis B (VHB). Se recogieron las variables de interés del ...
Effect of health education on the knowledge and attitude to sickle cell disorder and screening practices among school of nursing students in Sokoto, Nigeria.

Science.gov (United States)

Abiola, A O; Ojika, B O; Mannir, B; Abba, S K; Muhammad, M; Ibrahim, M T O; Aschcroft, B N; Akanmu, S S

2013-01-01

Sickle cell disorder is the most important genetic hematological disease that affects people of black African descent. The years of young adulthood present a good opportunity for screening and counseling for this genetic blood disorder. To assess effect of health education and provision of free sickle cell haemoglobin screening on knowledge of sickle cell disorder, attitude towards sickle cell haemoglobin screening, and uptake of sickle cell haemoglobin screening among students of a School of Nursing. Study design was a quasi-experimental noncontrolled study. Self-administered questionnaire was used for pre- and post-intervention data collection. Implemented interventions were seminar on sickle cell disorder combined with free sickle cell haemoglobin screening. The data was analyzed with Epi-info version 3.5.1 statistical software package. Respondents who participated in all the study phases were 104. Mean knowledge score (%) was high (80.9 +/- 22.8%) at baseline and improved significantly to 91.8 +/- 9.4% (p marriage if self and fiancée are carriers of sickle cell haemoglobin. Phenotype of the respondents that volunteered to be screened for sickle cell haemoglobin were: A (70.5%), AC (6.8%) and AS (22.7%). Implemented interventions, seminar on sickle cell disorder combined with free sickle cell haemoglobin screening service yielded significant impact on respondents' knowledge, attitude and uptake of sickle cell haemoglobin screening.
The importance of haemoglobin level and effect of transfusion in HNSCC patients treated with radiotherapy - Results from the randomized DAHANCA 5 study

International Nuclear Information System (INIS)

Hoff, Camilla Molich; Hansen, Hanne Sand; Overgaard, Marie; Grau, Cai; Johansen, Jorgen; Bentzen, Jens; Overgaard, Jens

2011-01-01

Background and purpose: Patients with head and neck squamous cell carcinoma (HNSCC) and a low level of haemoglobin (Hb) often have a poor response to radiation which may be related to hypoxia induced radioresistance. The aim of the study was to evaluate the prognostic significance of low Hb level and its modification by transfusion in HNSCC patients treated with radiotherapy. The study was performed as a subrandomization in the DAHANCA 5 trial. Material and methods: Patients were randomized to treatment with the hypoxic radiosensitizer nimorazole or placebo, and in addition, patients with 'low' pre-irradiation Hb values (females < 13 g/dL; males < 14.5 g/dL) were subrandomized to plus or minus transfusion. Transfusion was given with packed red blood cells with the aim to achieve a Hb level in the 'high' value range. Results: A total of 414 patients were included, 243 patients had high Hb levels and 171 patients had low Hb levels. Of the low Hb patients, 82 were randomized to receive transfusion and 89 not to receive transfusion. The treatment arms were well balanced. In the majority of patients, transfusion resulted in increased Hb levels although this tended to decline throughout treatment. Patients with high Hb levels had a significantly better probability of locoregional control, disease-specific survival and overall survival compared to 'low Hb no transfusion' patients. In the low Hb group, transfusion did not improve the outcome in locoregional control, disease-specific survival or overall survival. In multivariate analyses, T and N classifications were significant for all outcome measures, whereas there was no significant influence of transfusion or Hb level on endpoints. Conclusion: The univariate prognostic significance of high Hb level was demonstrated in patients with HNSCC treated with radiotherapy; however, transfusion prior to and during treatment did not improve the outcome in patients with low Hb values.
Anaemia among clinically well under-fives attending a community ...

African Journals Online (AJOL)

A blood sample was collected from each child, and haemoglobin levels were assessed with a point-of-care haemoglobin testing system. Anaemia was defined as having a haemoglobin value <2 standard deviations below age-altitude adjusted normal values. Results. Three-quarters (39/52 – 75%) of children were anaemic.
Oxygen binding properties of non-mammalian nerve globins

DEFF Research Database (Denmark)

Hundahl, Christian; Fago, Angela; Dewilde, Sylvia

2006-01-01

Oxygen-binding globins occur in the nervous systems of both invertebrates and vertebrates. While the function of invertebrate nerve haemoglobins as oxygen stores that extend neural excitability under hypoxia has been convincingly demonstrated, the physiological role of vertebrate neuroglobins...... is less well understood. Here we provide a detailed analysis of the oxygenation characteristics of nerve haemoglobins from an annelid (Aphrodite aculeata), a nemertean (Cerebratulus lacteus) and a bivalve (Spisula solidissima) and of neuroglobin from zebrafish (Danio rerio). The functional differences...... have been related to haem coordination: the haem is pentacoordinate (as in human haemoglobin and myoglobin) in A. aculeata and C. lacteus nerve haemoglobins and hexacoordinate in S. solidissima nerve haemoglobin and D. rerio neuroglobin. Whereas pentacoordinate nerve globins lacked Bohr effects at all...
Analysis of haematological changes in tofacitinib-treated patients with rheumatoid arthritis across phase 3 and long-term extension studies.

Science.gov (United States)

Schulze-Koops, Hendrik; Strand, Vibeke; Nduaka, Chudy; DeMasi, Ryan; Wallenstein, Gene; Kwok, Kenneth; Wang, Lisy

2017-01-01

Tofacitinib is an oral Janus kinase inhibitor for the treatment of RA. The aim of this analysis was to characterize changes in haematological parameters following tofacitinib treatment, and to compare changes in haemoglobin with markers of disease activity, fatigue and vitality. Changes in neutrophil counts, lymphocyte counts and haemoglobin levels were analysed in patients with RA from six phase 3 randomized controlled trials (n = 4271) of tofacitinib 5 or 10 mg bd, placebo or active comparators of up to 24 months' duration, and two long-term extension (LTE) studies (n = 4858) of tofacitinib of up to 84 months' duration. Disease activity markers included CRP and ESR. Fatigue and vitality were assessed using the Functional Assessment of Chronic Illness Therapy-Fatigue (FACIT-F) and Short Form Health Survey-36 vitality domain scores. In phase 3 studies, mean neutrophil and lymphocyte counts decreased and mean haemoglobin levels increased in all tofacitinib treatment groups. Haemoglobin levels and neutrophil counts stabilized in the LTE studies, while lymphocyte count decreases stabilized at approximately month 48. Increased haemoglobin was associated with decreased ESR and CRP levels. Clinically meaningful reductions in haemoglobin levels (⩾3 g/dl from baseline or haemoglobin ⩽7 g/dl) occurred in tofacitinib treatment, which stabilized over time in the LTE studies. Changes in haemoglobin levels, although associated with changes in ESR and CRP, were not associated with fatigue or vitality. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Rheumatology.
MATERNAL ANAEMIA AND NEWBORN MORBIDITY IN A TERTIARY HOSPITAL

Directory of Open Access Journals (Sweden)

Garuda Rama

2017-02-01

Full Text Available BACKGROUND Anaemia is the commonest nutritional deficiency disorder in the world and in India prevalence in pregnancy is 50-80%. It is a risk factor for preterm delivery, low birth weight, stillbirth and foetal anaemia. The aim of the study is to find out correlation between maternal and cord haemoglobin and birth weight of newborn. MATERIALS AND METHODS Prospective observational study of 150 pregnant women delivering in KIMS from December 2014 to June 2016 for antenatal and newborn haemoglobin and newborn weight. RESULTS Of 150 mothers, 89.33% are anaemic (24% mild, 44% moderate and 21.3% severe. The incidence of low birth weight and low cord haemoglobin varied directly with severity of anaemia. Out of 150 babies, 119 (79.3% of babies had anaemia in our study. The mean haemoglobin among babies was 12.9 g/dL with a S.D. of 2.01. CONCLUSION A significant positive correlation with maternal haemoglobin and newborn weight and cord haemoglobin. RecommendationAntenatal prophylaxis with iron and folic acid to prevent anaemia and incidence of low birth weight and infantile anaemia.
Associantion between leprosy and hepatitis B infecion: a survey in Goiânia, Central Brazil Associação entre hanseniase e infecção pelo virus da hepatite B: estudo de prevalência realizado em Goiânia, Brasil Central

Directory of Open Access Journals (Sweden)

Heitor Rosa

1992-10-01

Full Text Available This investigation presents the results of Hepatitis B virus screening among leprosy patients conducted in Central Brazil as a preliminary information for a HBV vaccination programme. The main objectives were to assess the seroprevalence of HBV serum markers among lepromatous patients and to analyse institutionalization as risk factor for HBV infection in this population. Two groups of lepromatous patients were studied, 83 outpatients and 171 institutionalized ones. Screening for HBV serum markers included the detection of HBsAg, anti-HBc by radioimmune assay (RIA. The prevalence of carrier state (HBsAg was 4.8% and 8.8% among outpatients and institutionalized, respectively, (p>0.05. Seroprevalence of exposure (all markers was statistically significant different between outpatients (16.9% and institutionalized ones (50.3%. Institutionalized patients had an almost four fold risk of HBV infection when compared to the outpatients, and the highest risks were among patients with more than 21 years of residence in the colony, after adjusting for age and sex.Este estudo apresenta os resultados de investigação sorológica para o virus da hepatite B (VHB entre pacientes hansenianos como etapa inicial para um programa de vacinação contra Hepatite B na cidade de Goiânia - Brasil Central. Os principais objetivos foram determinar a soroprevalência dos marcadores sorológicos para hepatite B entre pacientes com hanseníase do polo lepromatoso da doença, e avaliar a institucionalização como fator de risco para a infecção pelo VHB. Foram estudados 83 pacientes ambulatoriais e 171 pacientes institucionalizados e os marcadores testados foram AgHBs, anti-HBs e anti-HBc, utilizando-se a técnica de radioimuno ensaio. A prevalência de portadores virais (HBsAg foi de 4,8% e 8,8% para os pacientes ambulatoriais e institucionalizados, respectivamente (P>0,05. A prevalência de exposição ao VHB (todos os marcadores foi estatisticamente diferente entre os
Non-symbiotic haemoglobins—What's happening beyond nitric oxide scavenging?

Science.gov (United States)

Hill, Robert D.

2012-01-01

Background and aims Non-symbiotic haemoglobins have been an active research topic for over 30 years, during which time a considerable portfolio of knowledge has accumulated relative to their chemical and molecular properties, and their presence and mode of induction in plants. While progress has been made towards understanding their physiological role, there remain a number of unanswered questions with respect to their biological function. This review attempts to update recent progress in this area and to introduce a hypothesis as to how non-symbiotic haemoglobins might participate in regulating hormone signal transduction. Principal results Advances have been made towards understanding the structural nuances that explain some of the differences in ligand association characteristics of class 1 and class 2 non-symbiotic haemoglobins. Non-symbiotic haemoglobins have been found to function in seed development and germination, flowering, root development and differentiation, abiotic stress responses, pathogen invasion and symbiotic bacterial associations. Microarray analyses under various stress conditions yield uneven results relative to non-symbiotic haemoglobin expression. Increasing evidence of the role of nitric oxide (NO) in hormone responses and the known involvement of non-symbiotic haemoglobins in scavenging NO provide opportunities for fruitful research, particularly at the cellular level. Conclusions Circumstantial evidence suggests that non-symbiotic haemoglobins may have a critical function in the signal transduction pathways of auxin, ethylene, jasmonic acid, salicylic acid, cytokinin and abscisic acid. There is a strong need for research on haemoglobin gene expression at the cellular level relative to hormone signal transduction. PMID:22479675
Faktor Risiko Hepatitis B Pada Tenaga Kesehatan Kota Pekanbaru

Directory of Open Access Journals (Sweden)

Rina Amtarina

2014-10-01

Full Text Available Hepatitis B is still the one of serious public health problem in the world including Indonesia. Transmission of hepatitis B virus (HBV is strongly associated with use of contaminated blood products. For many people infected with HBV, risk factors of transmission are unknown. We examined risk factors for acquiring HBV in health care worker. This research was done by retrospective to blood participants who tested positive for HBs antibody or HBs antigen, using a questionnaire.participants divided into 2 groups. Had/having exposed to VHB with ati-HBs Positive HBsag negative or HBsag positive, anti-HBs negative and never had exposed to VHB with HBsag and anti-HBs negative. Positive anti- HBs were identified in 32 (29.1% of 110 participants. Positive HBs antigen anti-HBs negative was identified in 1 (0.9% of 110 participants. In questionnaire analysis, significant risk factors for HBV infection among HBs antibody - positive participants were tooth extraction in 29 (90.6%, and needle stick injuries in 18 (56.2% of 32 participants. Only 3 (9.3% of 32 participants with HBs antibody - positive had history of post infected HBV for several years ago. In 1 participant with HBs antigen - positive, significant risk factors were needle stick injuries, acupuncture, tooth extraction, and contact infected person. The most significant risk factors for transmission of hepatitis B in health care worker in Pekanbaru city are tooth extraction and needle stick injuries.
Physiological variations in levels of 2,3-diphosphoglycerate in horse erythrocytes.

Science.gov (United States)

Lewis, I M; McLan, J G

1975-03-01

The levels of 2,3-diphosphoglycerate (2,3-DPG), which affects the transport of oxygen by haemoglobin, were examined in horse blood. Resting levels of erythrocyte 2,3-DPG were established in thoroughbred horses, and levels of 2,3-DPG together with haemoglobin levels, were examined in a variety of conditions. A negative correlation was observed between erythrocyte 2,3-DPG and haemoglobin levels. Mares had higher erythrocyte 2,3-DPG levels was observed during training, and this variation may have a significant effect on haemoglobin oxygen transport. Erythrocyte 2,3-DPG levels were not affected by age or exercise.
Accidentabilidad laboral con productos biológicos en profesionales sanitarios de Atención Primaria de Guadalajara (1994-2000)

OpenAIRE

J. Cobos López; G. de la Rosa Rodríguez; A. D. Prieto Merino; A. Silva Mato; M. I. Fernández San Martín

2001-01-01

Las infecciones por Virus de la Inmunodeficiencia Humana (VIH),Virus de la Hepatitis B (VHB) y Virus de la Hepatitis C (VHC), de graves consecuencias médicas y sociales, se transmiten por contacto con sangre u otros fluídos orgánicos. El personal sanitario puede infectarse mediante el contacto con fluídos corporales y también transmitir dichas infecciones a los pacientes. Los objetivos de este estudio son conocer la magnitud y distribución de la accidentabilidad laboral con productos biológic...
Prevalencia de las infecciones por virus de las hepatitis B, C, D y E en Bolivia Prevalence of viral hepatitis B, C, D, and E in Bolivia

Directory of Open Access Journals (Sweden)

Pilar León

1999-03-01

Full Text Available En Bolivia no se han realizado estudios específicos sobre los virus de la hepatitis, por lo que su prevalencia y patrones de circulación son prácticamente desconocidos. De 1992 a 1996 se realizó un estudio seroepidemiológico con el fin de adquirir una primera visión de conjunto sobre las prevalencias de las infecciones por virus de la hepatitis B (VHB, C (VHC, D (VHD y E (VHE en distintas poblaciones de Bolivia. Sobre la base de los datos obtenidos en otros lugares de América Latina, se prestó atención especial al estudio de las comunidades autóctonas de la región amazónica. En las zonas rurales del altiplano andino, la infección por VHB presentó una prevalencia general que correspondería a una situación de endemia media o baja (11,2% y no se encontró ningún portador de anticuerpos contra VHC o VHD. En dos poblaciones de alto riesgo de la ciudad de Cochabamba (niños sin hogar y trabajadoras del sexo, la prevalencia de infección por VHB fue similar (11,6% y podría considerarse baja en comparación con la de otras poblaciones análogas de núcleos urbanos en América Latina. La correspondiente al VHC (un caso positivo, 0,5% sería parecida a la descrita en esas mismas poblaciones, si bien el escaso número de muestras estudiadas no permite extraer conclusiones más firmes. En concordancia con observaciones anteriores de comunidades similares de zonas tropicales de Suramérica, en las poblaciones autóctonas de la Amazonia boliviana la infección por VHB es sumamente endémica (prevalencia general de 74,0%, pero no se ha detectado la circulación de VHC. Se sabe que la transmisión de VHB es horizontal y tiene lugar desde edades muy tempranas, pero se desconocen los mecanismos de esa actividad. A los 10 años de edad, más de la mitad de la población ya ha experimentado la infección natural que, 10 años más tarde, se habrá difundido a prácticamente toda la población. La tasa muy baja de individuos positivos al HbsAg (1
[Introduction of capillary glycosylated haemoglobin determination in a Primary Care Health Area: Multicentre study of the evolution of patients with type 2 diabetes mellitus].

Science.gov (United States)

Núñez-Sánchez, M Á; Cervantes-Cuesta, M Á; Brocal-Ibañez, P; Salmeron-Arjona, E; León-Martínez, L P; Cerezo-Sanmartin, M

The aim of this study was to evaluate the efficiency of a joint intervention that included educational components, self-assessment, and information to optimise diabetes control through the introduction of instant capillary glycosylated haemoglobin (HbA1c) determination in Primary Care. A multicentre prospective descriptive study was carried out over 3years in 10Primary Care Centres of the Area VII Murcia East. At the end of the study there were 804 patients with type 2 diabetes (DM2). Patients were divided into 4 groups based on initial values of HbA1c, and if changes in their treatment were needed. HbA1c, body mass index, and blood pressure were monitored. A financial assessment was also performed on the impact of the implementation of a protocol to measure instant capillary RESULTS: A significant reduction was observed in HbA1c values. The initial HbA1c mean value was 7.4±1.4%, which decreased to a final value of 6.9±1.0% (P<.001). At the end of the study, 71.4% of patients included reached diabetic control objectives. In addition, the financial assessment demonstrated that the implementation of this diabetes control system led to a decrease of the 24.7% in spending on glucose strips after the first year of study in Area VII Murcia Health Service. The introduction of capillary HbA1c determination in Primary Care has demonstrated to improve diabetes control and the efficiency of the health personnel. Furthermore, a reduction in the health costs of patients with DM2 was also shown. Copyright © 2016 SECA. Publicado por Elsevier España, S.L.U. All rights reserved.

Red cell 2,3-diphosphoglycerate levels in children with hereditary haemolytic anaemias.

Science.gov (United States)

Haidas, S; Zannos-Mariolea, L; Matsaniotis, N

1975-12-01

The role of red cell 2,3-diphosphoglycerate (2,3-DPG) in increasing the availability of haemoglobin oxygen in neonatal jaundice and hereditary haemolytic anaemias was investigated. Measurements of 2,3-DPG were carried out on 58 normal children and six normal adults, 18 full-term newborns with neonatal jaundice and 57 cases (51 children and six adults) with hereditary haemolytic anaemias. In normal children and adults, with a mean haemoglobin of 12.69 g/dl, mean 2,3-DPG was 14.90 mumol/g Hb. In jaundiced newborns with a mean haemoglobin of 16.04 g/dl mean 2,3-DPG levels were 14.51 mumol/g Hb, i.e. normal. 2,3-DPG levels were increased in patients with beta-thalassaemia major, alpha-thalassaemia, sickle-cell disease, favism, hereditary spherocytosis and in heterozygotes for beta-thalassaemia with increased haemoglobin F. In heterozygotes for beta-thalassaemia with increased haemoglobin A2 only and in sickle cell trait 2,3-DPG levels were normal.
Treatment of chronic Hepatitis B virus infection

OpenAIRE

Carreño, N.; Moreno, D.; Sangro, B.

2004-01-01

El tratamiento del paciente con hepatitis crónica por virus B (VHB) debe realizarse bajo el conocimiento de que el porcentaje de pacientes infectados por el virus B que desarrollan hepatitis crónica se mantiene entre el 5-10%. De ellos, el 10-30% presentarán infección crónica con replicación viral activa, lesión hepática necroinflamatoria, evolución a cirrosis hepática y riesgo de desarrollar hepatocarcinoma. Por este motivo la meta del tratamiento es lograr la negativización del HBeAg, la se...
Tratamiento actual y nuevas terapias contra la infección crónica por el virus de la hepatitis B

OpenAIRE

Gallo E, Simón; Caraballo C, Cesar; Orozco M, Mateo; Muñoz, Octavio Germán

2017-01-01

Resumen La infección crónica por el virus de la hepatitis B (VHB) es un grave problema de salud pública a nivel mundial. Sus consecuencias llegan a ser mortales y el tratamiento actual no ofrece curación sino control de la enfermedad. Las principales limitantes para una cura son la dificultad para destruir el ADN circular covalente cerrado (ADNccc) del virus en el núcleo celular y la presencia de material genético viral integrado en el ADN de la célula hospedera. No obstante, hay múltiples fr...
Estandarización de la PCR para el diagnóstico del virus de la Hepatitis B en el Perú

OpenAIRE

Hijar, G; Carrillo, C; Padilla, C; Cabezas, C; Suárez, M; Romero, G; Montoya, Y

1998-01-01

La detección del ADN del virus de la Hepatitis B, (VHB) es el marcador más sensible para determinar la replicación activa e infectividad del virus circulante. Por esta razón la Reacción en Cadena de la Polimerasa (PCR) fue aplicada satisfactoriamente usando primers específicos para gen del antígeno de superficie (HBsAg). Un fragmento de 260 bp fue amplificado in vitro a partir de 200 µl. de sueros de pacientes aplicando PCR. La tecnología de PCR está siendo aplicada en el diagnóstico de pacie...
Cardiovascular features in adolescents and adults with sickle cell anaemia.

Science.gov (United States)

Ayuo, P O; Abinya, N A; Joshi, M D; Lore, W

1993-05-01

Fifty five sickle cell anaemia (SCA) patients at the Kenyatta National Hospital were studied with a view to elucidating their cardiovascular status. Their age range was 13 to 27 years (median 18.9 years). They comprised 27 males and 28 females and their mean haemoglobin concentration was 8.5 +/- 1.4 g/dl. Haemoglobin level of 8.0-9.9 g/dl seen in 30 patients was noted to confer the lowest incidence of exertional dyspnoea and palpitation. Similarly, patients with this haemoglobin level had the lowest mean heart rate. The mean blood pressure was 114.9 +/- 9.9 mmHg systolic and 64.6 +/- 10 mmHg diastolic. Blood pressures, ejection fraction (EF) and differential fibre shortening (%D) were found to be directly related to haemoglobin level, whereas cardio-thoracic index (CTI) and left ventricular dimensions were inversely related to haemoglobin level. Mean echocardiographic measurements were within normal limits and left ventricular functions were found to be normal in 80.9% of the patients indicating that the majority of SCA patients at the Kenyatta National Hospital have good cardiac function.
Study of hemoglobin response to mid-ultraviolet (UVB) radiation using micro-Raman spectroscopy

Science.gov (United States)

Huang, Y. Y.; Li, N.; Zhou, S. N.; Huang, Z. T.; Zhuang, Z. F.

2017-09-01

Confocal micro-Raman spectroscopy is employed to monitor the damage to haemoglobin from mid-ultraviolet (UVB) radiation. We obtained the Raman spectra of an erythrocyte, which indicated that a peroxidation reaction occurs after UVB radiation. Further, the surface enhanced Raman scattering (SERS) spectra of isolated haemoglobin show that the intensities of the 1375 and 1399 cm-1 bands, which are markers of haem aggregation, obviously increase with prolonged UVB irradiation. This increase reveals that haem aggregation occurs in the peroxidation of erythrocytes. The UV-Vis spectra of isolated haemoglobin indicate that the Soret band, which is indicative of excitonic interactions in the aggregated haems, has a redshift ( 12 nm) after 30 min of UVB irradiation of erythrocytes. It can be deduced that an excitonic interaction occurs in the aggregated haems, which is caused by haemoglobin denaturation following UVB irradiation. In addition, the changes of the Raman marker bands during aggregation primarily originate from excitonic interactions. Throughout the process, a higher UVB radiation dose causes greater damage to haemoglobin.
Protoporphyrin IX-induced structural and functional changes in ...

Indian Academy of Sciences (India)

Unknown

Drug-protein binding; haemoglobin; myoglobin; protoporphyrin IX; red blood cells ... haemoglobin and myoglobin are potentiated by the protein-porphyrin complexation. Possible ...... 1985 Uptake and delivery of the respiratory gases; in Best ...
Prevalencia de hepatitis B en un servicio de ginecobstetricia, 1992-1993

Directory of Open Access Journals (Sweden)

Martha Velandia

1997-12-01

Full Text Available Se llevó a cabo un estudio de seroprevalencia de la infección por el virus de la hepatitis Bb (VHB en el hospital de Honda (Tolima. La población objetivo estaba compuesta por mujeres que consultaron a los servicios de ginecobstetricia de diciembre de 1992 a enero de 1993. A todas se les practicaron pruebas para detectar infección por el VHB (antígeno de superficie, anticuerpo contra el antígeno central y anticuerpo contra el antígeno de superficie. En total, se encuestaron 246 mujeres entre los 15 y los 50 años. La prevalencia encontrada fue de 13% (32 positivas, la mitad de las personas infectadas (1 6 pacientes tenía el patrón de inmunidad adquirida por la infección mientras que el resto mostraba evidencia serológica de infección reciente (14 pacientes portaban el antígeno de superficie o el anticore. Los factores de riesgo diferían de acuerdo con el estado de infección analizado. En las personas con infección reciente, los factores de riesgo eran: tener tatuajes (CSP=14,8 IC 95% 0,65-332; tener dos y más compañeros sexuales (CSP=4,3 IC 95% 0,99-12,9 y CSP=8,1 IC 95% 1,l-61,1, respectivamente (p de tendencia=O,Ol. En las personas con infección antigua, el factor de riesgo asociado fue el antecedente familiar de enfermedad hepática (CSP=3,57 IC 95% 1,19-10,5. Para los infectados (cualquier marcador positivo, el antecedente familiar de enfermedad hepática permanecía como factor de riesgo significativo (CSP=2,44 IC 95% 1,03-5,75. El patrón serológico compatible con infección reciente, en nuestro estudio, se relacionó con la actividad sexual, el efecto de dosis-respuesta hallado, entre mayor número de compañeros e infección, corrobora este hallazgo. Esta relación se diluye cuando se analizan los estadios de infección antigua o cuando se toma a todos como infectados. El uso de los diferentes estadios de infección por VHB como variables dependientes probó ser una manera más eficiente y más específica, desde el
Monitoring compliance with transfusion guidelines in hospital departments by electronic data capture

Science.gov (United States)

Norgaard, Astrid; de Lichtenberg, Trine Honnens; Nielsen, Jens; Johansson, Pär I.

2014-01-01

Background The practice of transfusing red blood cells is still liberal in some centres suggesting a lack of compliance with guidelines recommending transfusion of red blood cells at haemoglobin levels of 6–8 g/dL in the non-bleeding patient. Few databases provide ongoing feedback of data on pre-transfusion haemoglobin levels at the departmental level. In a tertiary care hospital, no such data were produced before this study. Our aim was to establish a Patient Blood Management database based on electronic data capture in order to monitor compliance with transfusion guidelines at departmental and hospital levels. Materials and methods Hospital data on admissions, diagnoses and surgical procedures were used to define the populations of patients. Data on haemoglobin measurements and red blood cell transfusions were used to calculate pre-transfusion haemoglobin, percentage of transfused patients and transfusion volumes. Results The model dataset include 33,587 admissions, of which 10% had received at least one unit of red blood cells. Haemoglobin measurements preceded 96.7% of the units transfused. The median pre-transfusion haemoglobin was 8.9 g/dL (interquartile range 8.2–9.7) at the hospital level. In only 6.5% of the cases, transfusion was initiated at 7.3 g/dL or lower as recommended by the Danish national transfusion guideline. In 27% of the cases, transfusion was initiated when the haemoglobin level was 9.3 g/dL or higher, which is not recommended. A median of two units was transfused per transfusion episode and per hospital admission. Transfusion practice was more liberal in surgical and intensive care units than in medical departments. Discussion We described pre-transfusion haemoglobin levels, transfusion rates and volumes at hospital and departmental levels, and in surgical subpopulations. Initial data revealed an extensive liberal practice and low compliance with national transfusion guidelines, and identified wards in need of intervention. PMID
Comparison of total haemoglobin mass measured with the optimized carbon monoxide rebreathing method across different Radiometer™ ABL-80 and OSM-3 hemoximeters

International Nuclear Information System (INIS)

Turner, G; Richardson, A J; Maxwell, N S; Pringle, J S M

2014-01-01

A new Radiometer™ hemoximeter (ABL-80) has recently become available to measure carboxyhaemoglobin concentration for the optimized CO-rebreathing method (oCOR-method). Within the English Institute of Sport (EIS), hemoximeters are used in three different laboratories; therefore, precision and agreement of total haemoglobin mass (tHbmass) determination across sites is essential, and comparison to the previous model OSM-3 is desirable. Six male and one female (age 30 ± 6 years, body mass 78.1 ± 10.6 kg) undertook the oCOR-method. Venous blood (∼2 ml) was sampled immediately before and at 7 min during the oCOR-method; with seven replicates from each time point simultaneously analysed on five different Radiometer™ hemoximeters [OSM-3(1), OSM-3(2), ABL-80(1), ABL-80(2) and ABL-80(3)]. There were no differences (p > 0.05) between Δ%HbCO or mean tHbmass analysed with five different hemoximeters (OSM-3(1): 886 ± 167 g; OSM-3(2): 896 ± 160 g: ABL-80(1): 904 ± 157 g; ABL-80(2): 906 ± 163 g: ABL-80(3): 906 ± 162 g). However, the Bland–Altman plot revealed that there was closer agreement between ABL-80 machines for tHbmass than for the OSM-3. The variance (i.e. % error) across replicate samples decreased as the number of samples increased, with the error derived from the ‘worse-case’ scenario (single samples) being 1.2 to 1.6 fold greater in the OSM-3 than the ABL-80. Although there were no differences in the average tHbmass measured with five different hemoximeters, the new ABL-80 were in better agreement with each other compared to the old OSM-3. Previously, five replicates were required to achieve a low error using the OSM-3; however, three replicates are sufficient with the ABL-80 model to produce an error of ≤ 1% in tHbmass. (note)
Correlation between near-infrared spectroscopy and magnetic resonance imaging of rat brain oxygenation modulation

International Nuclear Information System (INIS)

Chen Yu; Tailor, Dharmesh R; Intes, Xavier; Chance, Britton

2003-01-01

We measure the tissue oxygen and haemoglobin concentrations in the rat brain during modulation of inhaled oxygen concentration (FiO 2 ), using non-invasive frequency domain near-infrared oximetry. The rise in oxygenated haemoglobin concentration and the decline in deoxygenated haemoglobin concentration are demonstrated in correspondence with the modulation of FiO 2 , which is changed from 20% to 100% in increments of 20%. Furthermore, the tissue oxygenation saturation also shows the corresponding trend and changes ranging from approximately 70% to 90%. The relative changes in deoxygenated haemoglobin concentration are compared to the blood-oxygenation-level-dependent (BOLD) MRI signal recorded during a similar FiO 2 protocol. A linear relationship with high correlation coefficient between the relative changes in the BOLD MRI signal and the NIRS signal is observed
Correlation between near-infrared spectroscopy and magnetic resonance imaging of rat brain oxygenation modulation

Energy Technology Data Exchange (ETDEWEB)

Chen Yu [Department of Biochemistry and Biophysics, University of Pennsylvania, Philadelphia, PA (United States); Tailor, Dharmesh R [Department of Bioengineering, University of Pennsylvania, Philadelphia, PA (United States); Intes, Xavier [Department of Biochemistry and Biophysics, University of Pennsylvania, Philadelphia, PA (United States); Chance, Britton [Department of Biochemistry and Biophysics, University of Pennsylvania, Philadelphia, PA (United States)

2003-02-21

We measure the tissue oxygen and haemoglobin concentrations in the rat brain during modulation of inhaled oxygen concentration (FiO{sub 2}), using non-invasive frequency domain near-infrared oximetry. The rise in oxygenated haemoglobin concentration and the decline in deoxygenated haemoglobin concentration are demonstrated in correspondence with the modulation of FiO{sub 2}, which is changed from 20% to 100% in increments of 20%. Furthermore, the tissue oxygenation saturation also shows the corresponding trend and changes ranging from approximately 70% to 90%. The relative changes in deoxygenated haemoglobin concentration are compared to the blood-oxygenation-level-dependent (BOLD) MRI signal recorded during a similar FiO{sub 2} protocol. A linear relationship with high correlation coefficient between the relative changes in the BOLD MRI signal and the NIRS signal is observed.
Anaemia in pregnancy in the district of Anuradhapura, Sri Lanka--need for updating prevalence data and screening strategies.

Science.gov (United States)

Chathurani, U; Dharshika, I; Galgamuwa, D; Wickramasinghe, N D; Agampodi, T C; Agampodi, S B

2012-09-01

To determine the prevalence of anaemia during pregnancy in Anuradhapura district and evaluate present screening methods for anaemia. Modified WHO 30 cluster sampling method with increased precision was used to estimate the prevalence of anaemia in the Anuradhapura district, Sri Lanka. Serum haemoglobin was measured using methemoglobin method. Clinical examination was carried out to evaluate the conjunctival method in anaemia screening. Values recorded from haemoglobin colour scale method used in the field antenatal clinics were collected. A total of 990 pregnant women participated in the study. In the first, second and third trimesters, prevalence of anaemia was 7.6%, 19.7% and 19.3% respectively. Gestational age adjusted anaemia prevalence among pregnant women in this study population was 14.1% (95% CI 12.0-16.4%). Mean and median haemoglobin concentration of the study sample was 11.8g/dL (SD 1.02g/dl and IQR 11.2-12.5g/dl). Among anaemic pregnant women, average values for Mean Corpuscular Volume (MCV), Mean Corpuscular Haemoglobin (MCH), and Mean Corpuscular Haemoglobin Concentration (MCHC) were, 82.9 fl (SD 11.5), 27.6 (SD-3.6) pg/cell and 32.9g/dl (SD 1.8) respectively. Sensitivity and specificity of haemoglobin colour scale method was 50% (95% CI 29.0-71.0%) and 76.3% (95% CI 66.9-83.7%) respectively. Sensitivity and specificity of conjunctival method in detecting anaemia during pregnancy was 18.8% (95% CI 11.9-28.4) and 69.3% (95% CI 58.2- 78.6%). Prevalence of anaemia in the district of Anuradhapura was less than 50% of the estimated prevalence for Sri Lanka. Both haemoglobin colour scale and conjunctival method were having low validity in detecting anaemia in pregnancy.
RJHS Vol 4(2).cdr

African Journals Online (AJOL)

ABEOLUGBENGAS

These include gravimetric measurement, haemoglobin calorimetry, photometric techniques and volumetric assessment (Wilcox,. Hunt and Owen, 1959; Ashrat and Ramadani,. 2006). Other modalities of blood loss assessment include alterations in laboratory results (such as haemoglobin or haematocrit levels), mechanical.
Effects of diabetes mellitus on health-related quality of life at a ...

African Journals Online (AJOL)

relies on laboratory indicators, primarily glycosylated haemoglobin ... are less concerned with clinical biomarkers such as HbA1c, blood ... control and severity of type 2 diabetes: (a) glycosylated haemoglobin (HbA1c), (b) total amount of ...
Relationship between mean corpuscular haemoglobin ...

African Journals Online (AJOL)

Socio-demographic data implicate illiteracy, low household income, poor diet and inadequate antenatal care for the observed reduction in MCHC among the group A subjects. Thus, MCHC and pALP can be used to monitor fetoplacental health. Albeit, the public should be educated on the importance of healthy diet and ...
The inherited diseases of haemoglobin are an emerging global health burden

Directory of Open Access Journals (Sweden)

S. Fucharoen

2011-12-01

Full Text Available Thalasseamia is one of the common genetic disorders. A genetic defect causes reduction of the globin chains leading to chronic haemolytic anaemia from birth. The mainstay of treatment is blood transfusion to maintain adequate levels of the haemoglobin. Secondary iron overload in β-thalassaemia patients is secondary to multiple blood transfusions and increased iron absorption. Excesses iron potentially catalyses free-radicals generation and impairment in cellular function and integrity. Extensive iron-induced injury develops in the heart, liver, pancreas and endocrine system. In regularly transfused patients, in the absence of iron-chelation therapy, death from iron-induced heart failure occurs by the mid-teenage years. Conventional treatment with the parenteral iron chelator desferrioxamine improves mortality but it is too expensive for middle and lowincome countries. Oral iron chelators, such as deferiprone (L1 and deferasirox, appear to be promising, however, they are still too expensive or need special monitoring. Serum ferritin has been used for many years as a guide for chelation therapy. However, recent studies demonstrated that using serum ferritin or liver iron measurements as a monitor of iron-chelation intensive therapy would have been discontinued long before the iron had cleared from the heart. There is evidence of the value of myocardial T2* measurements by MRI for the detection of early cardiac iron overload which cannot be predicted by liver iron or serum ferritin and for the monitoring of iron-chelation therapy. The major problem is the expensiveness of MRI measurement. In conclusion, the problem of iron chelation in low-income countries may be summarized as follows: i drugs, are not available in every countries that need the medicine, ii the cost of drugs is too high for most low income countries, iii there is poor education of doctor, parents/ patients and local government about the benefit of iron chelation, iv there is need
Screening for microalbuminuria in newly diagnosed type 2 diabetics ...

African Journals Online (AJOL)

Glycated haemoglobin level is a very good prognostic indicator for the development of microalbuminuria in this group of patients. Keywords: Screening, Microalbuminuria, Type 2 diabetics, Glycated haemoglobin, Diabetic retinopathy, Systemic hypertension, Port Harcourt Port Harcourt Medical Journal Vol. 3 (1) 2008: pp.
Author Details

African Journals Online (AJOL)

Sexual behaviour of in-school adolescents in Ibadan, South-West Nigeria Abstract PDF · Vol 12, No 2 (2008) - Articles Comparative evaluation of haemoglobin estimation amongst pregnant women in Ibadan: Hemocue – B Haemoglobin analyzer versus haemiglobincyanide (Standard) method as the gold standard
Condutas de profissionais da área da saúde, vítimas de acidentes com material biológico em um Serviço de Atenção Domiciliar

OpenAIRE

Amanda Pavinski Alves

2015-01-01

Introdução: A transmissão ocupacional de patógenos veiculados pelo sangue é uma realidade na área de saúde, expondo os profissionais ao risco de aquisição do HIV, VHC e VHB dentre outros micro-organismos. Objetivo: Avaliar as condutas de profissionais da área da saúde vítimas de acidentes ocupacionais com material biológico que atuam no Serviço de Atenção Domiciliar de Ribeirão Preto. Materiais e Métodos: Trata-se de um estudo de corte transversal aprovado pelo Comitê de Ética em Pe...

Investigation on the Methaemoglobin Concentration of Three ...

African Journals Online (AJOL)

MICHAEL

80% of erythrocyte haemoglobin (Goldberg, 1993,. Roth et al., 1986). Haemoglobin molecules, taken up by endocytosis undergo hydrolysis in the parasite's digestive acidic vacuole called the food vacuole. Malaria parasites are particularly vulnerable to oxidative stress during the erythrocytic life stages. (Hunt and Stocker ...
seed on haematological parameters of albino rats

African Journals Online (AJOL)

Dr Ejere

2015-06-23

Jun 23, 2015 ... and its indices (haemoglobin content, pack cell volume, mean corpuscular volume, mean corpuscular haemoglobin ... demands in plant-based proteins for humans and livestock, ... hypogea) and animal based proteins (Siddhuraju et al.,. 1995 ..... difference in the packed cell volume (PCV) of albino rats.
Haematological characteristics of Brazilian Teleosts: III. Parameters of the hybrid tambacu (Piaractus mesopotamicus Holmberg x Colossoma macropomum Cuvier (Osteichthyes, Characidae

Directory of Open Access Journals (Sweden)

Marcos Tavares-Dias

2000-12-01

Full Text Available Fifty six specimens of the hybrid "tambacu" (Piaractus mesopotamicus Holmberg, 1887 male x Colossoma macropomum Cuvier, 1818 female were collected from fishfarm of Guariba, São Paulo, to evaluate their haematology. Fishes presented 400.0 to 3,100.0 g total weight and 20.0 to 52.0 cm total length. Haemoglobin, haematocrit, mean corpuscular haemoglobin content (MCHC and percentage of defense blood cells including leucocytes and thrombocytes, were studied. Statistical analysis showed positive correlation (P<0.01 between haematocrit, MCHC and haemoglobin rate. Nevertheless, thrombocytes and lymphocytes showed negative correlation (P<0.01.
Human deoxyhaemoglobin-2,3-diphosphoglycerate complex low-salt structure at 2.5 A resolution.

Science.gov (United States)

Richard, V; Dodson, G G; Mauguen, Y

1993-09-20

The haemoglobin-2,3-diphosphoglycerate complex structure has been solved at 2.5 A resolution using crystals grown from low-salt solutions. The results show some important differences with the precedent haemoglobin-2,3-diphosphoglycerate high-salt structure solved by Arnone. First, we observe a loss of symmetry in the binding site, secondly both of the lysine residues 82 beta interact with 2,3-diphosphoglycerate at the same time, each making two contacts. This level of interaction is in agreement with the functional behaviour of natural haemoglobin mutants with mutations at the 2,3-diphosphoglycerate binding site.
Condiciones sociolaborales, conductas de riesgo y prevalencia de infecciones de transmisión sexual en mujeres inmigrantes que ejercen la prostitución en Madrid Social and work conditions, risk behavior and prevalence of sexually transmitted diseases among female immigrant prostitutes in Madrid (Spain

Directory of Open Access Journals (Sweden)

María José Belza

2004-06-01

Full Text Available Objetivo: Describir las características sociodemográficas, las condiciones de trabajo, las conductas sexuales y la prevalencia de infecciones por el virus de la inmunodeficiencia humana (VIH, el virus de la hepatitis B (VHB, el virus de la hepatitis C (VHC y otras infecciones de transmisión sexual (ITS en un grupo de mujeres inmigrantes que ejercen la prostitución en Madrid. Métodos: Estudio transversal de 579 mujeres inmigrantes que ejercían la prostitución, atendidas en un centro de ITS de Madrid entre 1999 y 2000. Se analizan las características sociodemográficas, las condiciones de trabajo, el consumo de drogas por vía parenteral y las prácticas sexuales con los clientes y en su vida privada. La atención incluía un control de las principales ITS y el estudio serológico para el VIH, el VHB y el VHC. Resultados: La media de edad fue de 28,7 años, el 96% procedía de Latinoamérica y ninguna había consumido drogas por vía parenteral. La edad media de inicio en la prostitución fue de 27,4 años y el 93,3% había comenzado en España. En el último mes, el 98% había utilizado siempre el preservativo en las penetraciones vaginales o anales con los clientes, pero sólo el 17,6% en sus relaciones privadas. Un 30% refirió alguna rotura del preservativo durante un servicio. La prevalencia de infección por el VIH fue del 0,2%, y por el VHC del 0,9%. El 8,1% tenía anticuerpos anti-core para el VHB y el 0,5% antígeno de superficie. La prevalencia de otras ITS fue del 18,0% y la de otras infecciones genitales no necesariamente de transmisión sexual, del 27,3%. Conclusiones: Se observa un uso generalizado del preservativo con los clientes, aunque también una elevada frecuencia de roturas. La prevalencia de marcadores de infección para el VIH, el VHB y el VHC es baja, aunque la de otras ITS es elevada.Objective: To describe the sociodemographic characteristics, work conditions, sexual behavior, and prevalence of HIV, hepatitis B
Remnant B-cell-stimulative and anti-oxidant effects of Persea ...

African Journals Online (AJOL)

After the treatment with avocado fruit extract, the elevated levels of blood glucose, glycosylated haemoglobin, blood urea and serum creatinine seen in the hyperglycaemic rats, reverted back to near normal. Similarly, significantly decreased plasma insulin and haemoglobin levels went back to near normal after the treatment ...
A comparison of non-invasive versus invasive methods of ...

African Journals Online (AJOL)

Puneet Khanna

for Hb estimation from the laboratory [total haemoglobin mass (tHb)] and arterial blood gas (ABG) machine (aHb), using ... A comparison of non-invasive versus invasive methods of haemoglobin estimation in patients undergoing intracranial surgery. 161 .... making decisions for blood transfusions based on these results.
Soluble CD163 levels in children with sickle cell disease

DEFF Research Database (Denmark)

Møller, Holger Jon; Nielsen, Marianne Jensby; Bartram, Jack

2011-01-01

Sickle cell disease (SCD) is characterized by vasculopathy, which has been causally linked to intravascular haemolysis and high levels of free plasma haemoglobin. Soluble CD163 (sCD163) is implicated in the clearance of free plasma haemoglobin and high plasma concentrations have been linked to ar...
blood and plasma volumes in normal west african dwarf sheep

African Journals Online (AJOL)

Dr Olaleye

volume (PCV) and haemoglobin (Hb) values were determined as descried by Benjamin (1978) using the microhaematocrit and ... Standard dye concentration of 20 mg/ml was used for determining the dye concentration in plasma. ... Haemoglobin (Hb), Plasma Volume and Blood Volume in the West African Dwarf. Sheep.
Host iron binding proteins acting as niche indicators for Neisseria meningitidis.

Directory of Open Access Journals (Sweden)

Philip W Jordan

Full Text Available Neisseria meningitidis requires iron, and in the absence of iron alters its gene expression to increase iron acquisition and to make the best use of the iron it has. During different stages of colonization and infection available iron sources differ, particularly the host iron-binding proteins haemoglobin, transferrin, and lactoferrin. This study compared the transcriptional responses of N. meningitidis, when grown in the presence of these iron donors and ferric iron, using microarrays.Specific transcriptional responses to the different iron sources were observed, including genes that are not part of the response to iron restriction. Comparisons between growth on haemoglobin and either transferrin or lactoferrin identified changes in 124 and 114 genes, respectively, and 33 genes differed between growth on transferrin or lactoferrin. Comparison of gene expression from growth on haemoglobin or ferric iron showed that transcription is also affected by the entry of either haem or ferric iron into the cytoplasm. This is consistent with a model in which N. meningitidis uses the relative availability of host iron donor proteins as niche indicators.Growth in the presence of haemoglobin is associated with a response likely to be adaptive to survival within the bloodstream, which is supported by serum killing assays that indicate growth on haemoglobin significantly increases survival, and the response to lactoferrin is associated with increased expression of epithelial cell adhesins and oxidative stress response molecules. The transferrin receptor is the most highly transcribed receptor and has the fewest genes specifically induced in its presence, suggesting this is the favoured iron source for the bacterium. Most strikingly, the responses to haemoglobin, which is associated with unrestricted growth, indicates a low iron transcriptional profile, associated with an aggressive phenotype that may be adaptive to access host iron sources but which may also
Glucagon-like peptide receptor agonists and dipeptidyl peptidase-4 inhibitors in the treatment of diabetes: a review of clinical trials

DEFF Research Database (Denmark)

Madsbad, Sten; Krarup, Thure; Deacon, Carolyn F

2008-01-01

-acting glucagon-like peptide-1 receptor agonists liraglutide and exenatide long-acting release reduce haemoglobin A1c by about 1.0-2.0% and have fewer gastrointestinal side-effects. The orally available dipeptidyl peptidase-4 inhibitors, that is sitagliptin and vildagliptin reduce haemoglobin A1c by 0...
HIGH IONIC STRENGTH OR PRESENCE OF INOSITOL ...

African Journals Online (AJOL)

Preferred Customer

CysG11(104)α is at the α1β1 subunit interface in both the T and R quaternary structures. It is therefore ... The static titration of guinea pig haemoglobin with DTNB has shown that the haemoglobin ..... Okonjo, K.O.; Okia, T.O. J. Protein Chem.
Blood metabolites of intensively reared gravid west African dwarf ...

African Journals Online (AJOL)

Blood metabolites of intensively reared gravid west African dwarf goats fed pulverized biofibre wastes based diets. ... packed cell volume (PCV), haemoglobin (Hb), mean cell volume (MCV) and mean cell haemoglobin (MCH), while goats on PMC/CsP/BG had significantly increased (p<0.05) white blood cell (WBC).
De-worming alone versus de-worming plus iron supplementation ...

African Journals Online (AJOL)

De-worming alone versus de-worming plus iron supplementation: Effect on haemoglobin of primary school children in Aboh-Mbaise. ... Aim: To compare the effect of de-worming alone and de-worming plus iron supplementation on the haemoglobin (Hb) of primary school children. ... Journal of College of Medicine Vol.
Effect of once-weekly dulaglutide on glycated haemoglobin (HbA1c) and fasting blood glucose in patient subpopulations by gender, duration of diabetes and baseline HbA1c.

Science.gov (United States)

Gallwitz, Baptist; Dagogo-Jack, Samuel; Thieu, Vivian; Garcia-Perez, Luis-Emilio; Pavo, Imre; Yu, Maria; Robertson, Kenneth E; Zhang, Nan; Giorgino, Francesco

2018-02-01

To evaluate the efficacy and safety of dulaglutide 1.5 and 0.75 mg in patients with type 2 diabetes by subgroups of gender, duration of diabetes and baseline glycated haemoglobin (HbA1c) in the dulaglutide clinical development programme (AWARD-1 to -6 and -8 clinical trials). Change in HbA1c was analysed by gender, duration of diabetes (baseline HbA1c (baseline in weight, hypoglycaemia and gastrointestinal adverse events were evaluated for individual trials. In the pooled analysis of patients treated with dulaglutide 1.5 mg at 6 months, the reductions in HbA1c from baseline were similar across gender (men: least squares [LS] mean -1.26% [95% confidence interval {CI} -1.36, -1.16]; women: LS mean -1.33% [95% CI -1.43, -1.24]) and among duration of diabetes subgroups (baseline HbA1c ≥8.5% had greater HbA1c reductions than patients with baseline HbA1c baseline HbA1c subgroups, respectively; women had a numerically greater weight loss or less weight gain than men with both dulaglutide doses. There was no clinically meaningful difference in hypoglycaemia trends by gender or duration of diabetes. Hypoglycaemia incidence and rate were generally lower in patients with baseline HbA1c ≥8.5% than in those with baseline HbA1c, with greater HbA1c and FBG reductions in patients with a higher baseline HbA1c. Dulaglutide was well tolerated, with a safety profile similar to other glucagon-like peptide-1 receptor agonists. © 2017 John Wiley & Sons Ltd.
Factores asociados a una respuesta inadecuada a la vacunación contra la hepatitis B en personal sanitario

Directory of Open Access Journals (Sweden)

Tolosa Martínez Natividad

1998-01-01

Full Text Available FUNDAMENTO: La vacuna recombinante contra la hepatitis B confiere inmunidad aproximadamente en el 95 % de los casos, pero existe un porcentaje que responde insuficientemente. El objetivo de este trabajo es evaluar los factores que se asocian con una inadecuada respuesta inmunitaria. MÉTODOS: Se trata de un estudio observacional y analítico en el que se sigue retrospectivamente una cohorte de sujetos vacunados frente al virus de la hepatitis B (VHB. Se recogieron las variables de interés del personal sanitario que cumplía los criterios de inclusión, del Área de Salud 9 de la Comunidad Valenciana (n=827. Tras la vacunación se determinó la titulación de anticuerpos de superficie (antiHBs para comprobar la respuesta, considerándose niveles protectores los superiores a 10 mUI/ml. RESULTADOS: Se produjo una adecuada seroconversión en el 94,4% de los vacunados. La baja o nula respuesta a la vacuna se asoció significativamente y de forma independiente con variables como el sexo masculino, la edad, el índice de masa corporal (IMC y el tabaquismo. El consumo de alcohol y los niveles de GPT, aunque no se relacionaron de forma significativa con la respuesta a la vacuna, actuaron como posibles factores de confusión. CONCLUSIONES: La inmunogenicidad de la vacuna es satisfactoria. Es importante cuantificar los niveles de antiHBs, sobretodo cuando hay factores predictivos de mala respuesta. De esta manera, es posible identificar a aquellos que precisan dosis de recuerdo y a los no respondedores, evitándose así situaciones de falsa sensación de protección frente al VHB.
Prevalência de marcadores sorológicos do vírus da hepatite B em trabalhadores do serviço hospitalar

Directory of Open Access Journals (Sweden)

Fernandes José V.

1999-01-01

Full Text Available OBJETIVO: Determinar a prevalência de marcadores sorológicos do vírus da hepatite B (VHB e identificar fatores de risco, de transmissão desse vírus, no ambiente hospitalar. MÉTODOS: Foram examinados 210 indivíduos de diversas profissões que trabalham em hospital universitário. O método empregado foi o ELISA e utilizou-se, como grupo-controle, 45 doadores voluntários de sangue. RESULTADOS: Constatou-se que 20,5% dos profissionais que trabalham no hospital apresentavam positividade para, pelo menos, um dos três marcadores dos vírus pesquisados, contra 6,6% do grupo-controle. Nos trabalhadores do hospital, a prevalência de cada marcador isoladamente foi: anti-HBc 8,1%, anti-HBs 5,2% e AgHBs 2,9% , sendo que em 4,3% desses indivíduos foi detectada a presença simultânea dos marcadores anti-HBc e anti-HBs. No grupo-controle, foi detectada apenas a presença dos marcadores anti-HBc e anti-HBs, isoladamente, com prevalências de 4,4 e 2,2%, respectivamente. Os maiores índices de positividade observados foram: pessoal de laboratório, 24,0%; pessoal de enfermagem, 23,6%; médicos, 20,8%; e pessoal da limpeza, 18,2%. CONCLUSÕES: Os achados indicam que os profissionais da saúde estão mais expostos à infecção pelo VHB, sugerindo que o contato com pacientes e a manipulação de fluidos corporais são fatores de risco de transmissão ocupacional desse vírus, recomendando-se a vacinação desses profissionais contra a hepatite B.
Cloning and Sequence Analysis of Vibrio halioticoli Genes Encoding Three Types of Polyguluronate Lyase.

Science.gov (United States)

Sugimura; Sawabe; Ezura

2000-01-01

The alginate lyase-coding genes of Vibrio halioticoli IAM 14596(T), which was isolated from the gut of the abalone Haliotis discus hannai, were cloned using plasmid vector pUC 18, and expressed in Escherichia coli. Three alginate lyase-positive clones, pVHB, pVHC, and pVHE, were obtained, and all clones expressed the enzyme activity specific for polyguluronate. Three genes, alyVG1, alyVG2, and alyVG3, encoding polyguluronate lyase were sequenced: alyVG1 from pVHB was composed of a 1056-bp open reading frame (ORF) encoding 352 amino acid residues; alyVG2 gene from pVHC was composed of a 993-bp ORF encoding 331 amino acid residues; and alyVG3 gene from pVHE was composed of a 705-bp ORF encoding 235 amino acid residues. Comparison of nucleotide and deduced amino acid sequences among AlyVG1, AlyVG2, and AlyVG3 revealed low homologies. The identity value between AlyVG1 and AlyVG2 was 18.7%, and that between AlyVG2 and AlyVG3 was 17.0%. A higher identity value (26.0%) was observed between AlyVG1 and AlyVG3. Sequence comparison among known polyguluronate lyases including AlyVG1, AlyVG2, and AlyVG3 also did not reveal an identical region in these sequences. However, AlyVG1 showed the highest identity value (36.2%) and the highest similarity (73.3%) to AlyA from Klebsiella pneumoniae. A consensus region comprising nine amino acid (YFKAGXYXQ) in the carboxy-terminal region previously reported by Mallisard and colleagues was observed only in AlyVG1 and AlyVG2.
Gene frequencies of ABO and rhesus blood groups and ...

African Journals Online (AJOL)

The distribution and gene frequencies of ABO and rhesus (Rh) blood groups and haemoglobin variants for samples of the Nigerian population at Ogbomoso was determined. Data consisting of records of blood groups and haemoglobin types of different ages ranging from infants to adults for a period of 4 to 6 years (1995 ...
Los virus B y C en la enfermedad hepática crónica en Medellín

Directory of Open Access Journals (Sweden)

Juan Carlos Restrepo

2004-03-01

Full Text Available
Hepatitis B (VHB

La prevalencia de portadores en Colombia esta entre el 1% al 10% de la población, en Antioquia en donantes sanos del Urabá se reportan prevalencias hasta del 28%. En los registros de la DSSA figuran con base en los casos de notificación obligatoria los siguientes casos de infección por el VHB sin especificar el cuadro clínico: 1998 (150; 1999 (227; 2000 (235; 2001 (234; 2002 (144; 2003 (197.

El 90% de los casos de infección aguda por el VHB mejora espontáneamente. El 1% de estos desarrolla falla hepática fulminante (FHF. En los 2 principales centros hospitalarios de la ciudad en donde se tiene servicios de hepatología, se ha observado un total de infecciones agudas por el VHB en los últimos 5 años de aproximadamente 30 pacientes; de estos, con FHF se han reportado aproximadamente 5 casos (1.5% en la información del Grupo de Gastrohepatología de la Universidad de Antioquia (GGH que reune la información de los dos hospitales. Diez por ciento de los pacientes que desarrollan el episodio agudo quedan como portadores crónicos del VHB. Aquellos que no presentan alteración en el nivel de transaminasas, que no tienen la presencia del HBeAg y cuya carga viral es negativa pueden catalogarse como portadores asintomáticos. Otros pacientes desarrollan hepatitis crónica con elevación en las transaminasas, presencia o no del HBeAg pero siempre ADN del VHB positivo. De los que desarrollan hepatitis crónica, alrededor del 10% desarrollan Cirrosis Hepática (CH y de estos entre el 5 y el 7% pueden presentar Carcinoma Hepatocelular (CHC. Según el GGH, actualmente existen activos con hepatitis crónica aproximadamente 20 pacientes de los cuales 3 ( 15% tienen CH. Se han trasplantado por CH

Dielectric elastomer actuators used for pneumatic valve technology

International Nuclear Information System (INIS)

Giousouf, Metin; Kovacs, Gabor

2013-01-01

Dielectric elastomer actuators have been investigated for applications in the field of pneumatic automation technology. We have developed different valve designs with stacked dielectric elastomer actuators and with integrated high voltage converters. The actuators were made using VHB-4910 material and a stacker machine for automated fabrication of the cylindrical actuators. Typical characteristics of pneumatic valves such as flow rate, power consumption and dynamic behaviour are presented. For valve construction the force and stroke parameters of the dielectric elastomer actuator have been measured. Further, benefits for valve applications using dielectric elastomers are shown as well as their potential operational area. Finally, challenges are discussed that are relevant for the use of elastomer actuators in valves for industrial applications. (paper)
Caffeine inhibits erythrocyte membrane derangement by antioxidant activity and by blocking caspase 3 activation.

Science.gov (United States)

Tellone, Ester; Ficarra, Silvana; Russo, Annamaria; Bellocco, Ersilia; Barreca, Davide; Laganà, Giuseppina; Leuzzi, Ugo; Pirolli, Davide; De Rosa, Maria Cristina; Giardina, Bruno; Galtieri, Antonio

2012-02-01

The aim of this research was to investigate the effect of caffeine on band 3 (the anion exchanger protein), haemoglobin function, caspase 3 activation and glucose-6-phosphate metabolism during the oxygenation-deoxygenation cycle in human red blood cells. A particular attention has been given to the antioxidant activity by using in vitro antioxidant models. Caffeine crosses the erythrocyte membrane and interacts with the two extreme conformational states of haemoglobin (the T and the R-state within the framework of the simple two states allosteric model) with different binding affinities. By promoting the high affinity state (R-state), the caffeine-haemoglobin interaction does enhance the pentose phosphate pathway. This is of benefit for red blood cells since it leads to an increase of NADPH availability. Moreover, caffeine effect on band 3, mediated by haemoglobin, results in an extreme increase of the anion exchange, particularly in oxygenated erythrocytes. This enhances the transport of the endogenously produced CO(2) thereby avoiding the production of dangerous secondary radicals (carbonate and nitrogen dioxide) which are harmful to the cellular membrane. Furthermore caffeine destabilizes the haeme-protein interactions within the haemoglobin molecule and triggers the production of superoxide and met-haemoglobin. However this damaging effect is almost balanced by the surprising scavenger action of the alkaloid with respect to the hydroxyl radical. These experimental findings are supported by in silico docking and molecular dynamics studies and by what we may call the "caspase silence"; in fact, there is no evidence of any caspase 3 activity enhancement; this is likely due to the promotion of positive metabolic conditions which result in an increase of the cellular reducing power. Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Haematological characteristics of the African snakehead ...

African Journals Online (AJOL)

The haematological characteristics of the African snakehead Parachanna obscura includes mean blood haemoglobin concentration of 5.70g/dl, mean haematocrit of 19.20%, mean red blood cell count of 1.67 x 10 12/L, mean total white blood cell count of 19.07 x 103 mm-3, mean erythrocytic haemoglobin concentration of ...
and labeo capensis

African Journals Online (AJOL)

J t is known that the yellowfish (Barb us holubi), barhel (Clarias goriepinus) and mudfish (Lobeo capensis and Lobeo umbratus) all contain multiple haemoglobins (Hattingh &. Du Toit 1973; Du Toit et a/1973) but nothing is known about the structure of haemoglobin in these fish. In this paper the oxygen and carbon dioxide ...
1. Editorial

African Journals Online (AJOL)

Esem

Sickle Cell Disease encompasses a range of conditions that are characterized by the inheritance of two abnormal genes that are responsible for haemoglobin with one of them coding for haemoglobin S. With this in mind, it is obvious that this genetic condition is ubiquitous in the world as a result of interracial and interethnic ...
Factores que inciden en la anemia ferropénica de la embarazada

Directory of Open Access Journals (Sweden)

Odalis Rodríguez Ganen

2002-12-01

Full Text Available Se realizó un estudio transversal descriptivo en 292 gestantes del municipio Marianao, de ellas 145 anémicas (hemoglobina A descriptive cross-sectional study was conducted among 292 pregnant women from Marianao municipality, between March, 1999, and May, 2000. 145 of them had anemia (haemoglobin < 110 g/L and 147 had no anemia (control group. Haemoglobin at the beginning of pregnancy and from the 20th week of gestation on, variables associated with the "Prenatal" supplement and some pregestational and gestational epidemiologic factors influencing on iron-deficiency anemia, were evaluated. It was concluded that haemoglobin decreased significantly in both groups. The variables that influenced the most on the current haemoglobin of the group of anemic women were regular nutrition (78.6 %, the weeks of gestation with a higher percentage of iron-deficiency anemia between the 20th and the 34th week, parity and the intergenesic space under 2 years. Concerning the "Prenatal" supplement, the non systematic ingestion of it and the inadequate form and moment of administration had a marked influence.
Age-associated and breed-associated variations in haematological and biochemical variables in young labrador retriever and miniature schnauzer dogs.

Science.gov (United States)

Brenten, Thomas; Morris, Penelope J; Salt, Carina; Raila, Jens; Kohn, Barbara; Schweigert, Florian J; Zentek, Jürgen

2016-01-01

Breed, sex and age effects on haematological and biochemical variables were investigated in 24 labrador retriever and 25 miniature schnauzer dogs during the first year of life. Blood samples were taken regularly between weeks 8 and 52. White blood cell and red blood cell counts, haemoglobin concentration, haematocrit, mean cell volume, mean cell haemoglobin, mean cell haemoglobin concentration, platelet count as well as total protein, albumin, calcium, phosphate, alkaline phosphatase, alanine aminotransferase, aspartate aminotransferase, glutamate dehydrogenase, total cholesterol, triglycerides, creatine and urea were evaluated. For all haematological and biochemical parameters, there were significant effects of age on test results. Statistically significant effects for breed and the breed×age interaction on test results were observed for most of the parameters with the exception of haemoglobin. Variations in test results illustrate growth related alterations in body tissue and metabolism leading to dynamic and marked changes in haematological and biochemical parameters, which have to be considered for the interpretation of clinical data obtained from dogs in the first year of life.
Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

The effects of different concentrations of DPG, IHP, GTP, GDP and GMP on the anaerobic redox reaction were determined. The results showed that DPG and IHP can lead to a positive shift in the reduction peak of haemoglobin, indicating that the oxidation peak shift of haemoglobin was small as a result of stabilization of the ...
Modelling the Relative Contribution of Fasting and Post-Prandial Plasma Glucose to HbA1c in Healthy and Type 2 Diabetic Subjects

Science.gov (United States)

Ollerton, Richard L.; Luzio, Steven D.; Owens, David R.

2004-01-01

Glycated haemoglobin (HbA1c) is regarded as the gold standard of glucose homeostasis assessment in diabetes. There has been much discussion in recent medical literature of experimental results concerning the relative contribution of fasting and post-prandial glucose levels to the value of HbA1c. A mathematical model of haemoglobin glycation is…
Asymptomatic bacteriuria in children with sickle cell anemia at The University of Nigeria teaching hospital, Enugu, South East, Nigeria

Directory of Open Access Journals (Sweden)

Ikefuna Anthony N

2011-09-01

Full Text Available Abstract Background Urinary tract infection (UTI is a common cause of childhood morbidity and mortality in the tropics. Children with sickle cell anemia (SCA may have compromised kidney function arising from repeated vaso-occlusive episodes and recurrent symptomatic or asymptomatic UTI. Objectives This study aims at determining the prevalence of asymptomatic bacteriuria and sensitivity pattern in children with homozygous sickle haemoglobin compared to children with normal haemoglobin. Methods One hundred children with SCA in stable state and 100 children with normal haemoglobin aged 2-12 years were screened for asymptomatic bacteriuria using midstream urine samples. The samples were incubated aerobically at 37°C for 24 hours within one hour of collection. Children whose urine samples yielded significant bacteriuria (≥105cfu/ml on two consecutive cultures were regarded as having asymptomatic bacteriuria. Results Asymptomatic bacteriuria was noted in 6% of children with SCA and occurred more in females than males (F: M = 5:1 when compared to 2% in children with normal haemoglobin. Escherichia coli was the commonest organism isolated (33.3%. All the organisms were resistant to co-trimoxazole and ampicillin while most were sensitive to gentamicin, ceftriaxone and the quinolones. Conclusion The risk of asymptomatic bacteriuria is three times more common in children with sickle cell anemia than in children with normal haemoglobin. It is therefore important to screen SCA patients, especially the females for UTI and should be treated according to the sensitivity result of the cultured organisms.
The use of Hemopure® at Groote Schuur hospital, Cape Town: 4 ...

African Journals Online (AJOL)

Hemopure® is a cell-free haemoglobin solution that is made from bovine haemoglobin that is designed to carry oxygen in the plasma. It is approved for use in South Africa for the treatment of acute surgical anaemia. We describe the use of Hemopure® at a large tertiary hospital in Cape Town where there is a blood bank on ...
Selected haematological and biochemical indices in donkeys in the Czech and Slovak Republics

Directory of Open Access Journals (Sweden)

Markéta Sedlinská

2016-01-01

Full Text Available The aim of this study was to establish normal reference values of biochemical and haematological indices of donkeys in the Czech and Slovak Republics. Blood samples were obtained from 112 clinically healthy donkeys (37 males and 75 females. The haematological indices examined were: red blood cells, white blood cells, haemoglobin concentration, haematocrit, mean cell volume, mean cell haemoglobin, mean cell haemoglobin concentration, platelets, segmented neutrophils, neutrophil bands, lymphocytes, monocytes, eosinophils and basophils. The biochemical properties examined were: total protein, albumin, creatinine, alkaline phosphatase, aspartate aminotransferase, creatine kinase, gamma-glutamyl transferase, lactate dehydrogenase, triacylglycerols, cholesterol, calcium, phosphorus, potassium, sodium, lactate. The results reported in this study could serve as reference ranges for the donkey population in the Czech and Slovak Republics.
Borderline maintenance of erythrocyte 2,3-diphosphoglycerate concentrations in normoxic type 1 (insulin dependent) diabetic subjects.

Science.gov (United States)

Story, C J; Roberts, A P; Ryall, R G

1986-02-01

Erythrocyte 2,3-diphosphoglycerate and haemoglobin A1c concentrations were measured in 26 clinically normoxic patients with type 1 (insulin dependent) diabetes mellitus. The concentration of 2,3-diphosphoglycerate theoretically required to maintain normal erythrocyte oxygen delivery function in each subject was calculated and compared with the measured concentrations. In the majority of diabetic patients 2,3-diphosphoglycerate concentrations were sufficient to keep the erythrocyte oxygen dissociation curve within the normal range under otherwise normal blood conditions. There was, however, a minority of patients in which this was not true. It is concluded that the increased erythrocyte 2,3-diphosphoglycerate concentrations in clinically normoxic diabetic subjects are generally less than compensatory for the effect of haemoglobin A1c formation on the haemoglobin-oxygen dissociation curve.
Local descriptive body weight and dietary norms, food availability, and 10-year change in glycosylated haemoglobin in an Australian population-based biomedical cohort

Directory of Open Access Journals (Sweden)

Suzanne J. Carroll

2017-02-01

Full Text Available Abstract Background Individual-level health outcomes are shaped by environmental risk conditions. Norms figure prominently in socio-behavioural theories yet spatial variations in health-related norms have rarely been investigated as environmental risk conditions. This study assessed: 1 the contributions of local descriptive norms for overweight/obesity and dietary behaviour to 10-year change in glycosylated haemoglobin (HbA1c, accounting for food resource availability; and 2 whether associations between local descriptive norms and HbA1c were moderated by food resource availability. Methods HbA1c, representing cardiometabolic risk, was measured three times over 10 years for a population-based biomedical cohort of adults in Adelaide, South Australia. Residential environmental exposures were defined using 1600 m participant-centred road-network buffers. Local descriptive norms for overweight/obesity and insufficient fruit intake (proportion of residents with BMI ≥ 25 kg/m2 [n = 1890] or fruit intake of <2 serves/day [n = 1945], respectively were aggregated from responses to a separate geocoded population survey. Fast-food and healthful food resource availability (counts were extracted from a retail database. Separate sets of multilevel models included different predictors, one local descriptive norm and either fast-food or healthful food resource availability, with area-level education and individual-level covariates (age, sex, employment status, education, marital status, and smoking status. Interactions between local descriptive norms and food resource availability were tested. Results HbA1c concentration rose over time. Local descriptive norms for overweight/obesity and insufficient fruit intake predicted greater rates of increase in HbA1c. Neither fast-food nor healthful food resource availability were associated with change in HbA1c. Greater healthful food resource availability reduced the rate of increase in HbA1c
Impact of corpulence parameters and haemoglobin A1c on metabolic control in type 2 diabetic patients: comparison of apolipoprotein B/A-I ratio with fasting and postprandial conventional lipid ratios

Directory of Open Access Journals (Sweden)

Mustapha Diaf

2015-05-01

Full Text Available Background and objective: The incidence of diabetes co-morbidities could probably be better assessed by studying its associations with major corpulence parameters and glycaemic control indicators. We assessed the utility of body mass index (BMI, waist circumference (WC, and glycosylated haemoglobin (HbA1c levels in metabolic control for type 2 diabetic patients. Methods: Fasting and postprandial blood samples were collected from 238 type 2 diabetic patients aged 57.4±11.9 years. The sera were analysed for glucose, HbA1c, total cholesterol (TC, triglycerides (TG, high-density lipoprotein cholesterol (HDL-c, low-density lipoprotein cholesterol (LDL-c, and apolipoproteins (apoA-I and apoB. Ratios of lipids and apolipoproteins were calculated and their associations with BMI, WC, and HbA1c levels were analysed. Results: Our investigation showed increases in most fasting and postprandial lipid parameters according to BMI and WC. In men, postprandial HDL-c and TG levels were significantly higher (p<0.05 in overweight and obese patients, respectively, as well as in patients with abdominal obesity. Contrariwise, postprandial TC levels were significantly higher (p<0.01 in overweight and abdominal obese women. However, elevations of apoA-I and apoB levels were according to BMI and WC in both genders. There was a strong influence of BMI, WC, and HbA1c levels on the apoB/apoA-I ratio compared to traditional fasting and postprandial lipid ratios in both men and women. The apoB/apoA-I ratio was more correlated with postprandial TC/HDL and LDL-c/HDL-c ratios in men and with postprandial TG/HDL-c in women. Conclusion: The apoB/apoA-I ratio is helpful in assessing metabolic risk caused by overall obesity, abdominal obesity and impaired glycaemia in type 2 diabetic patients.
Intravenous iron isomaltoside 1000 (Monofer®) reduces postoperative anaemia in preoperatively non-anaemic patients undergoing elective or subacute coronary artery bypass graft, valve replacement or a combination thereof: a randomized double-blind placebo-controlled clinical trial (the PROTECT trial).

Science.gov (United States)

Johansson, P I; Rasmussen, A S; Thomsen, L L

2015-10-01

This trial explores whether intravenous iron isomaltoside 1000 (Monofer®) results in a better regeneration of haemoglobin levels and prevents anaemia compared to placebo in preoperative non-anaemic patients undergoing cardiac surgery. The trial is a prospective, double-blind, comparative, placebo-controlled trial of 60 non-anaemic patients undergoing cardiac surgery. The patients were randomized 1:1 to either 1000 mg intravenous iron isomaltoside 1000 administered perioperatively by infusion or placebo. Mean preoperative haemoglobin in the active treatment group was 14·3 g/dl vs. 14·0 g/dl in the placebo group. At discharge 5 days after surgery, haemoglobin levels were reduced to 10·7 and 10·5 g/dl, respectively. One month after surgery, haemoglobin concentration had increased to an average of 12·6 g/dl vs. 11·8 g/dl (p = 0·012) and significantly more patients were non-anaemic in the intravenous iron isomaltoside 1000-treated group compared to the placebo group (38·5% vs. 8·0%; p = 0·019). There were no differences in side-effects between the groups. A single perioperative 1000 mg dose of intravenous iron isomaltoside 1000 significantly increased the haemoglobin level and prevented anaemia 4 weeks after surgery, with a short-term safety profile similar to placebo. Future trials on potential clinical benefits of preoperative treatment with intravenous iron in non-anaemic patients are needed. © 2015 The Authors ISBT Science Series published by John Wiley & Sons Ltd on behalf of International Society of Blood Transfusion.
Correlation of routine haematological parameters between normal maternal blood and the cord blood of healthy newborns in selected hospitals of karachi

International Nuclear Information System (INIS)

Qaiser, D.H.; Ghori, G.M.; Sandila, M.P.; Omair, A.

2013-01-01

Objective: To determine any significant correlation between the routine haematological parameters of maternal blood and umbilical cord blood of their respective newborns. Study Design: Cross sectional study. Place and Duration of Study: The study was conducted at four public and private hospitals of Karachi including Sindh Government Qatar Hospital, Sindh Government Hospital, Liaquatabad, Ziauddin University Hospital and Chinniot Maternity and Child Hospital, respectively from July 2006 to April 2008. Methodology: Three milliliters venous blood was collected in EDTA containing tube for complete blood count of mothers before delivery. Five milliliters cord blood was collected from the umbilical cord of the babies immediately after delivery by clamping and cutting the babies' end of the cord. For haematological parameters a standard coultergram was done including haemoglobin, RBCs count, haematocrit (HCT), mean corpuscular volume (MCV), mean corpuscular haemoglobin (MCH), mean corpuscular haemoglobin concentration (MCHC), white blood cell count, differential leukocyte count and platelet count. Pearson's correlation co-efficient was used to determine an association between the maternal and cord blood parameters. Results: A total of 404 maternal and umbilical cord blood samples were analyzed. All the blood parameters including haemoglobin, RBCs count, HCT, MCV, MCH, white blood cell count, differential leukocyte count and platelet count were found to be high in cord blood as compared to the maternal blood, but they showed a very weak to negligible correlation. Mean Corpuscular Haemoglobin Concentration (MCHC), showed a moderate correlation. Conclusion: Routine haematological parameters of newborns are independent of maternal routine haematological parameters. (author)
Evaluation of frequency and intensity of asymptomatic anisocytosis in the Japanese dog breeds Shiba, Akita, and Hokkaido

Directory of Open Access Journals (Sweden)

Olga Aniołek

2017-01-01

Full Text Available Microcytosis is observed in healthy Japanese breed dogs. The aim of the study was to evaluate the frequency and intensity of asymptomatic anisocytosis using a three-grade scale in Japanese dog breeds with special emphasis on the following indices: mean cell volume, mean cell haemoglobin, mean cell haemoglobin concentration, and red blood cell distribution width. The retrospective study included analyses of blood morphology and blood smear for clinically healthy Japanese dog breeds Shiba, Akita, and Hokkaido aged from 6 months to 14 years, performed as a part of preventative care. A total of 74 dogs of both sexes were qualified for the study. The group included both neutered and non-neutered animals (Akita – 17 females, 12 males, Shiba – 24 females, 18 males, Hokkaido – 2 females, 1 male. The blood smear revealed significant anisocytosis in 60.8% and mild anisocytosis in 28.4% of the tested dogs – 89.2% in total. Microcytosis was reported for 25.7% of the tested Japanese breed dogs. Reduced mean cell haemoglobin and mean cell haemoglobin concentration were diagnosed in 75.7% and 40.5% of dogs, respectively. Red blood cell distribution width as an anisocytosis indicator exceeded the norm in 12% of the tested dogs. Compared to mixed breed dogs, the Japanese breeds had a reduced mean cell volume, mean cell haemoglobin concentration and significant anisocytosis in the blood smear as well as a higher red blood cell distribution width indicator. Veterinarians should consider these differences when interpreting the results of morphological blood tests.
Raman spectroscopic studies of optically trapped red blood cells

International Nuclear Information System (INIS)

Dasgupta, R.; Gupta, P.K.

2010-01-01

Raman spectroscopic studies were performed on optically trapped red blood cells (RBCs) collected from healthy volunteers and patients suffering from malaria (Plasmodium vivax infection) using near infrared (785 nm) laser source. The results show significant alteration in the spectra averaged over ∼ 50 non-parasitized RBCs per sample. As compared to RBCs from healthy donors, in cells collected from malaria patients, a significant decrease in the intensity of the low spin (oxygenated-haemoglobin) marker Raman band at 1223 cm -1 (υ 13 or υ 42 ) along with a concomitant increase in the high spin (deoxygenated-haemoglobin) marker bands at 1210 cm -1 (υ 5 + υ 18 ) and 1546 cm -1 (υ 11 ) was observed. The changes primarily suggest a reduced haemoglobin-oxygen affinity for the non-parasitized red cells in malaria patients. The possible causes include up regulation of intra-erythrocytic 2,3-diphosphoglycerate and/or ineffective erythropoiesis resulted from the disease. During the above study we also observed that significant photo-damage may results to the intracellular haemoglobin (Hb) if higher laser power is used. For a laser power above ∼ 5 mW the observed increase in intensity of the Raman bands at 975 cm -1 (υ 46 ), 1244 cm -1 (υ 42 ) and 1366 cm -1 (υ 4 ) with increasing exposure time suggests photo-denaturation of Hb and the concomitant decrease in intensity of the Raman band at 1544 cm -1 (υ 11 ) suggests photo induced methaemoglobin formation. The photo damage of intracellular haemoglobin by the above processes was also observed to result in intracellular heme aggregation. (author)
Correlación entre los niveles de Hemoglobina Glicada y las enzimas antioxidantes, en pacientes con Diabetes Mellitus Tipo 2

OpenAIRE

Vergaray, L.; Robles, Y.; Flores, E.; Suárez, S.

2014-01-01

It has been determined Glycated A1c haemoglobin, Superóxido Dismutase, Glutation peroxidase and Malondialdehide levels in 25 patients with Diabetes mellitus type 2, whom participate in the Education Program for Diabetic Patients, from Arzobispo Loayza Hospital, they were confront with 15 persons apparently healthful control group. There is a positive correlation between Glycated A1c haemoglobin - Superoxido Dismutase (r=0,164, p

Estandarización de la PCR para el diagnóstico del virus de la Hepatitis B en el Perú

Directory of Open Access Journals (Sweden)

G Hijar

1998-01-01

Full Text Available La detección del ADN del virus de la Hepatitis B, (VHB es el marcador más sensible para determinar la replicación activa e infectividad del virus circulante. Por esta razón la Reacción en Cadena de la Polimerasa (PCR fue aplicada satisfactoriamente usando primers específicos para gen del antígeno de superficie (HBsAg. Un fragmento de 260 bp fue amplificado in vitro a partir de 200 µl. de sueros de pacientes aplicando PCR. La tecnología de PCR está siendo aplicada en el diagnóstico de pacientes infectados con el virus de la Hepatitis B pertenecientes a diferentes zonas geográficas.
Blood lead level and correlation with pregnancy-associated anaemia

Directory of Open Access Journals (Sweden)

Jehan Hamadneh

2018-04-01

Full Text Available Background The most common reason that leads to anaemia is related to the reduction in certain trace elements such as Fe. However, it has been found that an elevation in some other heavy metals such as Pb could also lead to anaemia. Aims This research aims to assess the Correlation between Pb blood levels and Fe, Haemoglobin levels during pregnancy among Jordanian women. Methods A cross-sectional study was conducted in the Northern area of Jordan. Venous blood samples collected from 167 pregnant women for the determination of haemoglobin (Hb, Fe and Pb levels of which 17 in the first trimester, 19 in second trimesters, 131 in third trimesters. Women were classified into two groups, the first group included cases with blood Pb Levels ≥10µg/dL (high blood Pb level group, n=118 and the second with blood Lead levels less than 10µg/dL (low blood Lead level group, n=49. Results About 71.4 per cent of women had anaemia (n=120; Hb>10.5g/dl and 70.7 per cent of women had a high blood Pb level of ≥10µg/dL. Pb blood levels ranged from 6.45 to 28.0μg/dL. The mean (SD of blood Pb level was 12.1 (4.1 µg/dL. The mean haemoglobin and Fe levels did not differ significantly between women with low and high levels of Pb. Blood Pb levels were not significantly correlated with haemoglobin levels (r=-0.025; P=0.747 nor with iron levels (r=0.099; P=0.241. After adjusting for important variables, Pb was not significantly associated with haemoglobin (P=0.223 and with iron (P=0.116. Conclusion The level of Pb in the blood of pregnant women has no any association with haemoglobin and Fe levels during pregnancy.
Linear Alkylbenzene Sulfonate tolerance in bacteria isolated from sediment of tropical water bodies polluted with detergents

Directory of Open Access Journals (Sweden)

I.T Kehinde

2008-12-01

Full Text Available The discharge of untreated detergent-bearing waste introduces linear alkylbenzene sulfonates (LAS to the aquatic environment. The surfactant persists in some streams and rivers in Nigeria, some is adsorbed to suspended materials and end in the sediment of the receiving water bodies. In this study, bacteria isolated from sediments of some tropical detergent-effluent-polluted streams were tested for tolerance to LAS using the media dilution technique. LAS-tolerance was indicated by growth of the bacteria in the presence of the surfactant. The pH, concentrations of surfactant, population of heterotrophic bacteria and population of LAS-tolerant bacteria in the sediments were determined. A direct relationship (r= 0.9124 was found between the alkaline conditions (pH= 8.2-12.0 and high surfactant concentrations (45-132 mg/g in the sediment. The sediments harboured a high population and a wide variety of bacteria; the populations of viable heterotrophic bacteria (vHB: 2.9×10(5 to 1.2×10(7 cfu/g and LAS tolerant bacteria (LTB: 1.5×10(4 to 1.2×10(6 cfu/g had a direct relationship (r= 0.9500. An inverse relationship resulted between each of them and the concentration of surfactant in the sediment, r vHB/ LAS = -0.9303 and rLTB/ LAS = -0.9143, respectively. Twelve bacteria species were isolated from the sediment: Alcaligenes odorans, Bacillus subtilis, Burkholderia cepacia, Citrobacter freundii, Citrobacter diversus, Escherichia coli, Micrococcus luteus, Micrococcus albus, Pseudomonas putida, Pseudomonas stutzeri, Staphylococcus aureus and Streptococcus faecalis. Most of them were adapted to the surfactant with their maximum acceptable concentrations ranging between 0.03 and >1.0% (w/v. The sediments could serve as source of adapted organisms which can be used in bio-treatment of LAS-bearing waste. Rev. Biol. Trop. 56 (4:7-15. Epub 2008 December 12.La descarga de desechos que contienen detergentes liberan sulfonatos de alquibenceno lineal (LAS al
Comparing risk profiles of individuals diagnosed with diabetes by OGTT and HbA1c

DEFF Research Database (Denmark)

Borg, R.; Vistisen, D.; Witte, D.R.

2010-01-01

Glycated haemoglobin (HbA(1c)) has been proposed as an alternative to the oral glucose tolerance test for diagnosing diabetes. We compared the cardiovascular risk profile of individuals identified by these two alternative methods.......Glycated haemoglobin (HbA(1c)) has been proposed as an alternative to the oral glucose tolerance test for diagnosing diabetes. We compared the cardiovascular risk profile of individuals identified by these two alternative methods....
Profile of red blood cell morphologies and causes of anaemia among pregnant women at first clinic visit in the mount Cameroon area: a prospective cross sectional study

OpenAIRE

Anchang-Kimbi, Judith K.; Nkweti, Vera Ngenwie; Ntonifor, Helen Ngum; Apinjoh, Tobias O.; Chi, Hanesh Fru; Tata, Rolland Bantar; Achidi, Eric Akum

2017-01-01

Objective Anaemia is a serious problem in pregnancy in malaria-endemic countries. This study investigated red cell morphologies and possible causes of anaemia among pregnant women at first clinic visit. Venous blood samples from consented women were used to determine haemoglobin (Hb) levels, mean corpuscular volume (MCV) and mean corpuscular haemoglobin (MCH) using an automated haematology analyzer. Malaria parasitaemia was diagnosed by microscopy. Definitions were as follows: anaemia (Hb
Can the cerebral metabolic rate of oxygen be estimated with near-infrared spectroscopy?

International Nuclear Information System (INIS)

Boas, D A; Strangman, G; Culver, J P; Hoge, R D; Jasdzewski, G; Poldrack, R A; Rosen, B R; Mandeville, J B

2003-01-01

We have measured the changes in oxy-haemoglobin and deoxy-haemoglobin in the adult human brain during a brief finger tapping exercise using near-infrared spectroscopy (NIRS). The cerebral metabolic rate of oxygen (CMRO 2 ) can be estimated from these NIRS data provided certain model assumptions. The change in CMRO 2 is related to changes in the total haemoglobin concentration, deoxy-haemoglobin concentration and blood flow. As NIRS does not provide a measure of dynamic changes in blood flow during brain activation, we relied on a Windkessel model that relates dynamic blood volume and flow changes, which has been used previously for estimating CMRO 2 from functional magnetic resonance imaging (fMRI) data. Because of the partial volume effect we are unable to quantify the absolute changes in the local brain haemoglobin concentrations with NIRS and thus are unable to obtain an estimate of the absolute CMRO 2 change. An absolute estimate is also confounded by uncertainty in the flow-volume relationship. However, the ratio of the flow change to the CMRO 2 change is relatively insensitive to these uncertainties. For the finger tapping task, we estimate a most probable flow-consumption ratio ranging from 1.5 to 3 in agreement with previous findings presented in the literature, although we cannot exclude the possibility that there is no CMRO 2 change. The large range in the ratio arises from the large number of model parameters that must be estimated from the data. A more precise estimate of the flow-consumption ratio will require better estimates of the model parameters or flow information, as can be provided by combining NIRS with fMRI
Plasmodium falciparum infection in febrile Congolese children: prevalence of clinical malaria 10 years after introduction of artemisinin-combination therapies.

Science.gov (United States)

Etoka-Beka, Mandingha Kosso; Ntoumi, Francine; Kombo, Michael; Deibert, Julia; Poulain, Pierre; Vouvoungui, Christevy; Kobawila, Simon Charles; Koukouikila-Koussounda, Felix

2016-12-01

To investigate the proportion of malaria infection in febrile children consulting a paediatric hospital in Brazzaville, to determine the prevalence of submicroscopic malaria infection, to characterise Plasmodium falciparum infection and compare the prevalence of uncomplicated P. falciparum malaria according to haemoglobin profiles. Blood samples were collected from children aged <10 years with an axillary temperature ≥37.5 °C consulting the paediatric ward of Marien Ngouabi Hospital in Brazzaville. Parasite density was determined and all samples were screened for P. falciparum by nested polymerase chain reaction (PCR) using the P. falciparum msp-2 marker to detect submicroscopic infections and characterise P. falciparum infection. Sickle cell trait was screened by PCR. A total of 229 children with fever were recruited, of whom 10% were diagnosed with uncomplicated malaria and 21% with submicroscopic infection. The mean parasite density in children with uncomplicated malaria was 42 824 parasites/μl of blood. The multiplicity of infection (MOI) was 1.59 in children with uncomplicated malaria and 1.69 in children with submicroscopic infection. The mean haemoglobin level was 10.1 ± 1.7 for children with uncomplicated malaria and 12.0 ± 8.6 for children with submicroscopic infection. About 13% of the children harboured the sickle cell trait (HbAS); the rest had normal haemoglobin (HbAA). No difference in prevalence of uncomplicated malaria and submicroscopic infection, parasite density, haemoglobin level, MOI and P. falciparum genetic diversity was observed according to haemoglobin type. The low prevalence of uncomplicated malaria in febrile Congolese children indicates the necessity to investigate carefully other causes of fever. © 2016 John Wiley & Sons Ltd.
Haematological status of wintering great tits (Parus major) along a metal pollution gradient

Energy Technology Data Exchange (ETDEWEB)

Geens, Ann, E-mail: ann.geens@ua.ac.be [Department of Biology, University of Antwerp, Ethology, Universiteitsplein 1, B-2610 Antwerp (Belgium); Dauwe, Tom [Department of Biology, University of Antwerp, Ethology, Universiteitsplein 1, B-2610 Antwerp (Belgium); VITO, Boeretang 200, B-2400 Mol (Belgium); Bervoets, Lieven; Blust, Ronny [Department of Biology, University of Antwerp, Ecophysiology, Biochemistry and Toxicology, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Eens, Marcel [Department of Biology, University of Antwerp, Ethology, Universiteitsplein 1, B-2610 Antwerp (Belgium)

2010-02-01

In the long-term biomonitoring of wild populations inhabiting polluted areas, the use of non-destructive biomarkers as markers of condition is very important. We examined the possible effects of metal pollution on the haematological status of adult great tits (Parus major) along a well-established pollution gradient near a non-ferrous smelter in Belgium. We measured blood and feather metal concentrations and assessed the haematological status (amount of red blood cells, haemoglobin concentration, haematocrit, mean corpuscular volume and mean corpuscular haemoglobin) of adult great tits during winter at four study sites. Metal concentrations in blood and feathers indicated that cadmium and lead were the most important metals in the pollution gradient under study. Measurements of haematological parameters revealed that haemoglobin concentration, haematocrit, mean corpuscular volume and mean corpuscular haemoglobin were lower in great tits from the more polluted sites. These parameters were significantly negatively correlated with blood lead concentration. The amount of red blood cells, however, did not significantly differ among study sites. Our results indicate that the haematological status of great tits is negatively affected by metal pollution and may therefore be used as a successful biomarker for monitoring the negative impact of metal exposure in the wild.
Haematopoetic effect of methanol extract of Nigerian honey bee (Apis mellifera propolis in mice

Directory of Open Access Journals (Sweden)

Bashir Lawal

2015-08-01

Full Text Available Objective: To investigate the haematopoetic effect of methanol extract of Nigerian honey bee propolis in mice. Methods: Fifteen white Albino mice were grouped into 3(A-C of 5 animals each. Group A mice serve as control group, while groups B and C received 300 and 600 mL/kg of honey bee propolis respectively, for 21 days. The haematological parameters were determined using the automated haematologic analyzer Sysmex kx21, (product of Sysmex Corporation, Japan using standard techniques. The data were analyzed using ANOVA and the level of significance was at P 0.05 alteration to the erythrocytic indices like red blood cells, haematocrite, haemoglobin, mean corpuscular haemoglobin, mean corpuscular volume and red cell distribution width, but increase mean corpuscular haemoglobin concentration in dose related fashion. Acute oral toxicity showed the extract to be relatively safe at a high dose on acute exposure. However, 21-days of treatment with the extract do neither increase nor decrease the body weight of the mice. Conclusions: Administration of methanol extract of Nigerian honey bee propolis in mice at the doses investigated has brought about leucopoietic and thrombopoietic changes without any significant effect on red blood cells and factors that relate to it, except for the mean corpuscular haemoglobin concentration.
Effectiveness of blood transfusions and risk factors for mortality in children aged from 1 month to 4 years at the Bon Marché Hospital, Bunia, Democratic Republic of the Congo.

Science.gov (United States)

Mueller, Yolanda; Bastard, Mathieu; Ehounou, Geneviève; Itama, Jeff; Quéré, Michel; de la Tour, Roberto; Vala, Louis; Etard, Jean-François; Bottineau, Marie-Claude

2012-12-01

To assess the effectiveness of blood transfusions in a hospital of north-eastern Democratic Republic of the Congo. Prospective study of children admitted for severe anaemia. During admission, data were collected on clinical condition and haemoglobin levels, before and after blood transfusion. A linear regression model was built to explore factors associated with haemoglobin level after transfusion. Risk factors for mortality were explored through multivariate logistic regression. Haemoglobin level (Hb) was below 4 g/dl in 35% (230/657), between 4 and 6 g/dl in 58% (348/657) and at least 6 g/dl in another 6% (43/657) of the transfused children. A transfusion of 15 ml/kg of whole blood increased the Hb from 4.4 to 7.8 g/dl. Haemoglobin level after transfusion was associated with baseline Hb, quantity of delivered blood and history of previous transfusions. Overall case-fatality rate was 5.6% (37/657). Risk factors for deaths were co-morbidities such as chest infection, meningitis or malnutrition, Hb ≥ 6 g/dl, impaired consciousness or jugular venous distention on admission, and provenance. Transfusion was a frequent practice, the use of which could clearly have been rationalised. While indications should be restricted, quantities of transfused blood should be adapted to needs. © 2012 Blackwell Publishing Ltd.
Effect of an 1800 MHz electromagnetic field emitted during embryogenesis on the blood picture of one-day-old domestic hen chicks (Gallus gallus domesticus

Directory of Open Access Journals (Sweden)

Krzysztof Pawlak

2018-01-01

Full Text Available Exposure to artificial electromagnetic fields emitted mainly by mobile telephony has been steadily increasing with the development of modern technology. Haematological indices are among the most common indicators of the body’s physiological status. The aim of the study was to determine the effect of an 1800 MHz electromagnetic field emission on the blood picture of one-day-old domestic hen chicks. During the experiment, chick embryos were exposed to artificial electromagnetic fields throughout incubation for 13 ´ 2 min/day, 4 ´ 10 min/day and 1 ´ 40 min/day. After hatching, blood was collected from 10 one-day-old chicks from each group to determine: red blood cell count, haemoglobin concentration, haematocrit, mean corpuscular volume, mean corpuscular haemoglobin, mean corpuscular haemoglobin concentration, white blood cell count, and leukocyte differential count. In addition, the heterophil/lymphocyte ratio was calculated. The present study is probably the first to show an increase in the red blood cell count, haemoglobin concentration, haematocrit, white blood cell count, segmented heterophils and the heterophil/lymphocyte ratio, and a decrease in lymphocyte percentage of embryos exposed to an 1800 MHz electromagnetic field. The observed changes may be indicative of the stress-inducing effect of EMF on living organisms.
Markers of inflammation and activation of coagulation are associated with anaemia in antiretroviral-treated HIV disease

DEFF Research Database (Denmark)

Borges, Álvaro H; Weitz, Jeffrey I; Collins, Gary

2014-01-01

OBJECTIVE: The objective of this study is to determine the relationship between inflammatory interleukin-6 (IL-6) and high-sensitivity C-reactive protein (hsCRP)] and coagulation (D-dimer) biomarkers and the presence and type of anaemia among HIV-positive individuals. DESIGN: A cross-sectional...... study. METHODS: Combination antiretroviral therapy (cART)-treated adults participating in an international HIV trial with haemoglobin and mean corpuscular volume (MCV) measurements at entry were categorized by presence of anaemia (haemoglobin ≤14 g/dl in men and ≤12 g/dl in women) and, for those...... with anaemia, by type [microcytic (MCV 100 fl)]. We analysed the association between inflammation (IL-6 and hsCRP) and coagulation (D-dimer) and haemoglobin, controlling for demographics (age, race and sex), BMI, HIV plasma RNA levels, CD4⁺ T-cell counts (nadir...
Blood oxygen and carbon dioxide transport in man

OpenAIRE

McElderry, Linda A.

1981-01-01

The effect of long term domiciliary oxygen therapy on the position and shape of the oxygen dissociation curve, together with other haematologic variables such as 2,3- diphosphoglycerate (2,3-DPG), haemoglobin concentration, packed cell volume, mean corpuscular haemoglobin concentration, and arterial blood gas and pH values, has been studied in patients with chronic bronchitis. Twenty-six patients were randomly allocated to receive either no oxygen therapy or 15 hours p...
Association of napping and night-time sleep with impaired glucose regulation, insulin resistance and glycated haemoglobin in Chinese middle-aged adults with no diabetes: a cross-sectional study.

Science.gov (United States)

Baoying, Huang; Hongjie, Chen; Changsheng, Qiu; Peijian, Wu; Qingfei, Lin; Yinghua, Lin; Huibin, Huang; Jixing, Liang; Liantao, Li; Ling, Chen; Kaka, Tang; Zichun, Chen; Lixiang, Lin; Jieli, Lu; Yufang, Bi; Guang, Ning; Penli, Zhu; Junping, Wen; Gang, Chen

2014-07-23

To assess associations between napping and night-time sleep duration with impaired glucose regulation, insulin resistance (IR) and glycated haemoglobin (HbA1c). Cross-sectional study. Fujian Province, China, from June 2011 to January 2012. This study enrolled 9028 participants aged 40-65 years. Data of 7568 participants with no diabetes were included for analysis. Type 2 diabetes was defined applying WHO criteria. Participants' daytime napping and night-time sleep duration data were collected using a standardised self-reported Chinese-language questionnaire about sleep frequency and quality. Anthropometric and laboratory parameters were also measured. IR was defined as a HOMA-IR index value >2.50. ORs and 95% CIs were derived from multivariate logistic regression models. Participants (mean age 51.1±7.0 years) included 3060 males and 4508 females with average night-time sleep of 7.9 h. A higher proportion of males napped than females. After adjustment for potential confounders, ORs for HbA1c >6.0% were 1.28 and 1.26 for those napping ≤1 h and >1 h (p=0.002 and p=0.018), respectively. Statistically significant differences in IR between nappers and non-nappers were only marginal clinically. Odds for HbA1c >6.0% were significantly lower in participants with longer night-time sleep durations than in the reference group (>8 h vs 6-8 h). Odds for IR were significantly lower in participants whose night-time sleep hours deviated from the reference group (8 h vs 6-8 h) Chinese middle-aged adults with no diabetes who napped had higher HbA1c and IR; those with shorter night-time sleep durations had increased HbA1c. Night-time sleep hours that are either 8 tend to be associated with lower odds for IR. Further studies are necessary to determine the underlying clinical significance and mechanisms behind these associations. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Reinforced poly(propylene oxide)- a very soft and extensible dielectric electroactive polymer

DEFF Research Database (Denmark)

Goswami, Kaustav; Galantini, F.; Mazurek, Piotr Stanislaw

2013-01-01

Poly(propylene oxide) (PPO), a novel soft elastomeric material, and its composites were investigated as a new dielectric electroactive polymer (EAP). The PPO networks were obtained from thiol-ene chemistry by photochemical crosslinking of ,!-diallyl PPO with a tetra-functional thiol. The elastomer...... was reinforced with hexamethylenedisilazane treated fumed silica to improve the mechanical properties of PPO. The mechanical properties of PPO and composites thereof were investigated by shear rheology and stress–strain measurements. It was found that incorporation of silica particles improved the stability...... of the otherwise mechanically weak pure PPO network. Dielectric spectroscopy revealed high relative dielectric permittivity of PPO at 103 Hz of 5.6. The relative permittivity was decreased slightly upon addition of fillers, but remained higher than the commonly used acrylic EAP material VHB4910...
Preoperative anaemia and newly diagnosed cancer 1 year after elective total hip and knee arthroplasty

DEFF Research Database (Denmark)

Jørgensen, C. C.; Jans, Ø.; Kehlet, H.

2015-01-01

BACKGROUND: Preoperative anaemia is a well-established risk factor for use of blood transfusions and postoperative morbidity. Consequently, focus on preoperative evaluation of haemoglobin levels is increasing. In this context, iron deficiency anaemia may be a symptom of undiscovered gastrointesti......BACKGROUND: Preoperative anaemia is a well-established risk factor for use of blood transfusions and postoperative morbidity. Consequently, focus on preoperative evaluation of haemoglobin levels is increasing. In this context, iron deficiency anaemia may be a symptom of undiscovered...
Red blood cell transfusion in septic shock

DEFF Research Database (Denmark)

Rosland, Ragnhild G; Hagen, Marte U; Haase, Nicolai

2014-01-01

Sepsis-related Organ Failure Assessment (SOFA) scores (days 1 and 5), more days in shock (5 (3-10) vs. 2 (2-4), p = 0.0001), more days in ICU (10 (4-19) vs. 4 (2-8), p = 0.0001) and higher 90-day mortality (66 vs. 43%, p = 0.001). The latter association was lost after adjustment for admission category....../dl and independent of shock day and bleeding. Patients with cardiovascular disease were transfused at higher haemoglobin levels. Transfused patients had higher Simplified Acute Physiology Score (SAPS) II (56 (45-69) vs. 48 (37-61), p = 0.0005), more bleeding episodes, lower haemoglobin levels days 1 to 5, higher...... and SAPS II and SOFA-score on day 1. CONCLUSIONS: The decision to transfuse patients with septic shock was likely affected by disease severity and bleeding, but haemoglobin level was the only measure that consistently differed between transfused and non-transfused patients....
Evaluation of standard haemodynamic tests of autonomic function and HbA1c as predictors of delayed gastric emptying in patients with type 1 diabetes mellitus.

LENUS (Irish Health Repository)

Lydon, A

2012-02-03

We examined the relation between chronic glycaemic control (using glycosylated haemoglobin), haemodynamic autonomic function and rate of gastric emptying in 16 patients with type 1 diabetes mellitus. Gastric emptying was measured using a paracetamol absorption technique. Parameters of gastric emptying include area under the plasma paracetamol concentration time curve. Patients were classified as diabetic autonomic neuropathy positive or negative using five standardized haemodynamic reflex tests. Area under the plasma paracetamol concentration time curve in the neuropathy positive (10.36 (4.5) mmol.-1. min) and negative (9.84 (3.0) mmol.-1. min) groups were similar (.P.=0.42) using unpaired Student\\'s.t. -tests. Glycosylated haemoglobin concentration and area under the plasma paracetamol concentration time curve (.n.=16) demonstrated a Pearson\\'s correlation co-efficient of 0.24. Neither tests of haemodynamic autonomic function, nor concentration of glycosylated haemoglobin, are predictive of diabetic gastroparesis.
A molecular and haematological study of Theileria equi in Balkan donkeys.

Science.gov (United States)

Davitkov, Dajana; Davitkov, Darko; Vucicevic, Milos; Stanisic, Ljubodrag; Radakovic, Milena; Glavinic, Uros; Stanimirovic, Zoran

2017-06-01

Equine piroplasmosis in donkeys has been recognised as a serious problem of major economic importance. The present molecular study is the first investigation of the presence of Theileria equi and Babesia caballi in Balkan donkeys and of the possible haematological alterations related to it. A total of 70 apparently healthy donkeys from Serbia were included in this study. The overall prevalence of T. equi infection in donkeys tested with multiplex PCR was 50%. There was no B. caballi-positive sample. Infections in donkeys included in this study seem to be associated with decreased red blood cell count, haemoglobin concentration, haematocrit and platelet count, and with increased white blood cell count, mean corpuscular haemoglobin and mean corpuscular haemoglobin concentration. Altered haematological parameters in donkeys can lead to a decrease in working capacity and production performance. Further molecular research and long-term monitoring of equine piroplasmosis is needed in Serbia and throughout Europe.
Correlation of serum unconjugated oestriol to red cell 2,3-diphosphoglycerate levels in diabetic pregnancy.

Science.gov (United States)

Madsen, H; Ditzel, J

1983-03-01

In order to evaluate the possible underlying factors for the increase in red cell 2,3-diphosphoglycerate content observed in late diabetic pregnancy, its relationship with serum unconjugated oestriol, human placental lactogen, haemoglobin and hydrogen ion concentrations was investigated in 42 pregnant diabetic women. A significant correlation was found between red cell 2,3-diphosphoglycerate and serum unconjugated oestriol (r = 0.54, p less than 0.001), whereas no correlation was present between 2,3-diphosphoglycerate and the following variables: arterial pH, haemoglobin concentration and human placental lactogen. The content of 2,3-diphosphoglycerate correlated significantly with haemoglobin-oxygen affinity expressed as P50 at pH 7.4 (r = 0.34, p less than 0.05). The results of this study indicate that serum unconjugated oestriol may participate in the regulation of red cell 2,3-diphosphoglycerate content and thereby of the maternal blood oxygen release to the fetus.

Effectiveness of the diabetes education and self management for ongoing and newly diagnosed (DESMOND) programme for people with newly diagnosed type 2 diabetes

DEFF Research Database (Denmark)

Davies, M. J.; Heller, S.; Skinner, T. C.

2008-01-01

.001); directions of change were positive indicating greater understanding of diabetes. The intervention group had a lower depression score at 12 months: mean difference was -0.50 (95% confidence interval -0.96 to -0.04); P=0.032. A positive association was found between change in perceived personal responsibility....... Main outcome measures: Haemoglobin A1c levels, blood pressure, weight, blood lipid levels, smoking status, physical activity, quality of life, beliefs about illness, depression, and emotional impact of diabetes at baseline and up to 12 months. Main results: Haemoglobin A1c levels at 12 months had...... and weight loss at 12 months (β=0.12; P=0.008). Conclusion: A structured group education programme for patients with newly diagnosed type 2 diabetes resulted in greater improvements in weight loss and smoking cessation and positive improvements in beliefs about illness but no difference in haemoglobin A 1c...
Assessment of iron status of Sudanese pregnant women by serum ferritin

International Nuclear Information System (INIS)

Eltayeb, E.A.; Khangi, F.A.; Satti, G.M.; Abu Salab, A.

2004-03-01

Eighty five normal pregnant women were included in the study at the start of the second trimester. Two blood samples were taken during the second trimester and two blood samples during the third trimester. The height of all subjects was measured. The weights of the subjects were under iron-supplementation throughout the gestation period. Sixty four normal non-parentage women were included in the study to serve as controls. Iron status was assessed for the groups with following parameters, haemoglobin (Hb), packed corpuscular volume (PCV), red blood cells count, peripheral blood film, mean corpuscular volume (MCV), mean cell haemoglobin (MCH), Mean haemoglobin concentration (MCH C), serum iron (Si), total iron binding capacity (T IBC), serum transferrin saturation (Ts) and serum ferritin (Sf). No significant difference was observed in the mean haemoglobin concentrations but the PCV of the non-pregnant women was higher than that of the pregnant women at different stages of gestation (p<0.05). MCV, MCH and MCH C values of the non-pregnant women were lower than those of the of the pregnant at different stages of gestation (p<0.05). Serum iron and transferrin saturation of the non-pregnant women were higher than those of the pregnant women, this difference was statistically significant at weeks (16-18) and (22-24) (p<0.05). Serum ferritin of the non-pregnant women was higher than that of the pregnant women and decreased continuously during the pregnancy, but this decrease was not statistically significant. Iron deficiency anaemia was observed in both pregnant and non-pregnant women. The best parameter that could be used as a marker for iron deficiency is serum ferritin. Iron supplementation s corrected for haemoglobin but not for iron status, but more studies were needed to cover this issue using different parameters.(Author)
Expression, characterization, and cellular localization of knowpains, papain-like cysteine proteases of the Plasmodium knowlesi malaria parasite.

Directory of Open Access Journals (Sweden)

Rajesh Prasad

Full Text Available Papain-like cysteine proteases of malaria parasites degrade haemoglobin in an acidic food vacuole to provide amino acids for intraerythrocytic parasites. These proteases are potential drug targets because their inhibitors block parasite development, and efforts are underway to develop chemotherapeutic inhibitors of these proteases as the treatments for malaria. Plasmodium knowlesi has recently been shown to be an important human pathogen in parts of Asia. We report expression and characterization of three P. knowlesi papain-like proteases, termed knowpains (KP2-4. Recombinant knowpains were produced using a bacterial expression system, and tested for various biochemical properties. Antibodies against recombinant knowpains were generated and used to determine their cellular localization in parasites. Inhibitory effects of the cysteine protease inhibitor E64 were assessed on P. knowlesi culture to validate drug target potential of knowpains. All three knowpains were present in the food vacuole, active in acidic pH, and capable of degrading haemoglobin at the food vacuolar pH (≈5.5, suggesting roles in haemoglobin degradation. The proteases showed absolute (KP2 and KP3 to moderate (KP4 preference for peptide substrates containing leucine at the P2 position; KP4 preferred arginine at the P2 position. While the three knowpains appear to have redundant roles in haemoglobin degradation, KP4 may also have a role in degradation of erythrocyte cytoskeleton during merozoite egress, as it displayed broad substrate specificity and was primarily localized at the parasite periphery. Importantly, E64 blocked erythrocytic development of P. knowlesi, with enlargement of food vacuoles, indicating inhibition of haemoglobin hydrolysis and supporting the potential for inhibition of knowpains as a strategy for the treatment of malaria. Functional expression and characterization of knowpains should enable simultaneous screening of available cysteine protease
Care for Haemoglobinopathy Patients in Slovakia.

Science.gov (United States)

Fábryová, Viera; Božek, Peter; Drakulová, Monika; Kollárová, Andrea; Striežencová, Zuzana Laluhová; Macichová, Michaela; Sakalová, Adriena

2017-03-01

The paper presents the results od 22-year study of screening and follow-up of haemoglobinopathies in Slovakia, an overview of genetic mutations, the coincidence with hereditary haemochromatosis mutations, and the procedure in genetic councelling. Between 1993-2015, in three centres in Bratislava and in one centre in Kosice, carriers of beta-thalassaemic genes or other haemoglobinopathies were searched for. Diagnosis was performed by haematologists, whereby the family history was evaluated, together with the overall clinical condition, blood count and blood smear, iron and haemolysis parameters, mutations of hereditary haemochromatosis, and haemoglobin electrophoresis testing. In the last years the haemoglobin division also examined by high performance liquid chromatography (HPLC). A clinical suspicion of the heterozygous form of beta-thalassaemia or other haemoglobinopathies was documented in 554 patients. Of them 32 (5.8%) were foreigners. 213 (38.45%) patients were genetically examined. In 190 (33.93%) of them heterozygote beta-thalassaemia was confirmed. The most frequent mutations were IVS 1.110 (33.15%), IVS 2.1 (33.15%), and IVS 1.6 (14.7%). Evidence of haemoglobin S (heterozygote sickle cell anaemia) was also notable in two non-relative children, whose fathers were of African origin, and one patient from Ghana. One female patient was followed up for haemoglobin Santa Ana (non-stabile haemoglobin previously diagnosed as mutation de novo). In our group, we took care of pregnant patients with haemoglobinopathies. The study showed that there is a higher number of heterozygotes for beta-thalassaemia and rarely haemoglobinopathies in Slovakia. Over the past years, we have recorded an increase number of foreigners coming to our country. It is necessary to continue in search of pathological gene carriers to avoid serious forms of haemoglobinopathies. Copyright© by the National Institute of Public Health, Prague 2017
Common occurrence of anaemia at the end of pregnancy following exposure to zidovudine-free regimens.

Science.gov (United States)

Pinnetti, Carmela; Baroncelli, Silvia; Molinari, Atim; Nardini, Giulia; Genovese, Orazio; Ricerca, Bianca Maria; Cavaliere, Anna Franca; Guaraldi, Giovanni; Antoni, Anna Degli; Tamburrini, Enrica; Floridia, Marco

2011-08-01

Although zidovudine-free regimens are increasingly used in pregnancy, their haematological effects in mothers and newborns are incompletely defined. The haematological profiles of 119 HIV-infected women and their neonates with highly active antiretroviral regimens (HAART) in pregnancy including or not zidovudine (ZDV) were investigated. Three groups were compared: 1) women who started ZDV-lamivudine (3TC)-based HAART during pregnancy (ZDVs, n = 60); 2) women on ZDV-3TC-based HAART from conception (ZDVc, n = 18); 3) women on ZDV-free HAART from conception (ZDVf, n = 41). At the beginning of pregnancy, haemoglobin levels were similar in the three groups. By week 36 compared to baseline, haemoglobin levels had a significantly greater decrease in ZDVf women compared to ZDVs women (ZDVf: -2.03 g/dl; ZDVs: -1.36 g/dl, p = 0.036). A similar trend was observed for occurrence of maternal anaemia at 36 weeks. Newborns with no prenatal ZDV exposure had significantly higher haemoglobin levels at birth (ZDVf: 16.1 ± 1.4 g/dl, ZDVs: 14.3 ± 2.0 g/dl; ZDVc: 14.6 ± 2.4 g/dl, p = 0.044 and 0.003, respectively). Half of ZDV-unexposed mothers had anaemia at the end of pregnancy, but their neonates had normal haemoglobin levels. ZDV initiation was associated with a lower occurrence of maternal anaemia during the third trimester and decreased haemoglobin levels in the newborns. We hypothesize that foetal iron requirements could represent a major determinant of maternal anaemia at the end of pregnancy. Copyright © 2011 The British Infection Association. Published by Elsevier Ltd. All rights reserved.
Factors associated with maternal anaemia among pregnant women in Dhaka city.

Science.gov (United States)

Chowdhury, Hasina Akhter; Ahmed, Kazi Rumana; Jebunessa, Fatema; Akter, Jesmin; Hossain, Sharmin; Shahjahan, Md

2015-09-22

Maternal anaemia is a common problem in pregnancy, particularly in developing countries. The study was aimed at determining the factors associated with anaemia among a group of pregnant mothers who attended an antenatal clinic in Dhaka city. This cross-sectional study included 224 pregnant women, who visited the antenatal clinic of the Marie Stops, Dhaka. Demographic data and information on maternal age, gestational age, educational and income level, and socioeconomic status were collected from all the subjects. Haemoglobin status was measured to assess their anaemia. A qualified technician drew venous blood samples from them. The reference values of haemoglobin were categorized according to the World Health Organization (WHO) criteria as follows: normal (11 g/dL or higher), mild (10-10.9 g/dL), and moderate (7-9.9 g/dL). Mild and moderate levels of haemoglobin were defined as anaemic (haemoglobin levels of anaemia was significantly associated with age (p = 0.036), education (p = 0.002), income (p = 0.001), living area (p = 0.031). Results of binary logistic regression analysis showed that maternal anaemia was also significantly associated with age (p = 0.006), educational status (primary to 8th grade, p = 0.004; secondary and above, p = 0.002), living area (0.022), and income (0.021). A significant proportion of pregnant women were found anaemic. Most data showed education has animpact on awareness to use of health services and iron supplementation should be encouraged to improve the haemoglobin levels in pregnancy. The results indicate that anaemia is alarmingly high among pregnant women in Dhaka city. Maternal anaemia is associated with age, education level, income level, and living area. The results suggest that pregnant women and members of their families should be urgently educated to understand the importance of antenatal care.
Haemoglobin and creatinine values as prognostic factors for outcome of concurrent radiochemotherapy in locally advanced head and neck cancers. Secondary results of two European randomized phase III trials (ARO 95-06, SAKK 10/94)

International Nuclear Information System (INIS)

Ghadjar, Pirus; Stromberger, Carmen; Kaul, David; Wust, Peter; Budach, Volker; Poettgen, Christoph; Joos, Daniela; Hayoz, Stefanie; Baumann, Michael; Bodis, Stephan; Budach, Wilfried; Studer, Gabriela; Zimmermann, Frank; Plasswilm, Ludwig; Olze, Heidi; Bernier, Jacques; Aebersold, Daniel M.

2016-01-01

To determine the influence of baseline laboratory values on treatment outcome in patients with locally advanced head and neck cancer (HNSCC). Data of the randomized trials ARO 95 -06 (n = 384) and SAKK 10 /94 (n = 224) were pooled for a total sample size of 608 patients. Haemoglobin (Hb) and creatinine (Cr) were available at baseline and their association with locoregional recurrence-free survival (LRRFS), distant metastasis-free survival (DMFS), cancer-specific survival (CSS), and overall survival (OS) was analyzed using univariable and multivariable Cox regression models. A total of 580 and 564 patients were available with baseline Hb and Cr values in the pooled analysis. Univariable analyses revealed that lower baseline Hb values were significantly associated with decreased LRRFS, DMFS, CSS and OS. This effect remained significant for OS when the treatment arms (radiotherapy [RT] alone vs. chemoradiation [CRT]) were analyzed separately. Higher baseline Cr was associated with improved OS in the pooled analysis. Interestingly, the prognostic value of baseline Cr appeared to be limited to the subgroup of 284 patients who were treated with CRT. In the multivariable Cox regression model lower baseline Hb remained associated with decreased OS both in the patients who received CRT (HR 0.79, 95 % CI 0.66-0.94, p = 0.009) and in those patients who underwent RT alone (HR 0.67, 95 % CI 0.58-0.78, p < 0.001). Increased baseline Cr remained significantly associated with improved OS in patients who underwent CRT (HR 0.79, 95 % CI 0.69-0.92, p = 0.002) but not in those patients who underwent RT alone. An association between lower baseline Hb and inferior treatment outcome was confirmed. Baseline Cr was introduced as a prognosticator of outcome after CRT for locally advanced HNSCC. (orig.) [de
Medical research with radioisotopes in Greece

Energy Technology Data Exchange (ETDEWEB)

Belcher, E H [Post-graduate Medical School, Hammersmith, London (United Kingdom)

1961-07-15

An important program of research into the nature and causes of congenital haemolytic anaemias, notably the disease known as Mediterranean anaemia or Thalassaemia, which is a serious medical problem in the Mediterranean countries, is at present being carried out in the Department of Clinical Therapeutics of the University of Athens under a research contract awarded by the International Atomic Energy Agency. This program is concerned with diseases in which there is an inherited defect or abnormality in the production of haemoglobin, the iron-containing pigment of the red blood cells which is responsible for the carriage of oxygen in the blood. Two techniques have been widely used in the studies at the University of Athens. In the first of these, a radioisotope of iron, iron-59, is used to follow iron metabolism and haemoglobin production. Iron metabolism in the body is concerned largely with the synthesis and breakdown of haemoglobin, which consists of a protein, globin, linked to an iron containing substance, haeme. The second technique makes use of a radioisotope of chromium, chromium-51, to study the fate of the red cells in the blood. By performing simultaneous studies with iron- 59 and chromium-51, a detailed picture of haemoglobin synthesis and red cell production and destruction can be built up. Such investigations have been invaluable in establishing the characteristic patterns of different congenital haemolytic anaemias.
Subclinical anaemia of chronic disease in adult patients with cystic fibrosis.

LENUS (Irish Health Repository)

O'connor, T M

2012-02-03

Patients with chronic hypoxaemia develop secondary polycythaemia that improves oxygen-carrying capacity. Therefore, normal haemoglobin and haematocrit values in the presence of chronic arterial hypoxaemia in cystic fibrosis constitute \\'relative anaemia\\'. We sought to determine the cause of this relative anaemia in patients with cystic fibrosis. We studied haematological indices and oxygen saturation in healthy volunteers (n=17) and in adult patients with cystic fibrosis (n=15). Patients with cystic fibrosis had lower resting arterial oxygen saturation when compared with normal volunteers (P<0.0001), and exercise led to a greater reduction in arterial oxygen saturation (P<0.0001). However, haemoglobin and haematocrit values in patients with cystic fibrosis did not significantly differ from normal volunteers. Serum iron (P=0.002), transferrin (P=0.02), and total iron-binding capacity (P=0.01) were lower in patients with cystic fibrosis. There were no significant differences in serum ferritin, percentage iron saturation, serum erythropoietin or red cell volume between the groups. The data presented demonstrate a characteristic picture of anaemia of chronic disease in adult patients with cystic fibrosis, except for normal haemoglobin and haematocrit values. Normal haemoglobin and haematocrit values in patients with cystic fibrosis appear to represent a combination of the effects of arterial hypoxaemia promoting polycythaemia, counterbalanced by chronic inflammation promoting anaemia of chronic disease.
Anaemia prevalence and factors associated with haemoglobin ...

African Journals Online (AJOL)

felix mmassy

following radiotherapy in individuals with cancers at the Ocean Road Cancer ..... Glaspy, J. & Cavill, I. (1999) Role of iron in optimizing responses of anemic ... hemoglobin change associates with overall survival of multiple malignancies -.
Protective effect of Withania somnifera roots extract on hematoserological profiles against lead nitrate-induced toxicity in mice.

Science.gov (United States)

Sharma, Veena; Sharma, Sadhana; Pracheta

2012-12-01

The in vivo protective role of hydro-methanolic root extract of Withania somnifera (WS) was evaluated in alleviating lead nitrate (LN)-induced toxicity in male Swiss albino mice by measuring hematoserological profiles. The lead-treated (20 mg/kg body wt, p.o.) albino mice (25-30 g) concurrently received the root extract (200 and 500 mg/kg body wt, p.o.) once daily for the duration of six weeks. Animals exposed to LN showed significant (P < 0.001) decline in haemoglobin content, red blood cell count, white blood cell count, packed cell volume and insignificant decrease in mean corpuscular haemoglobin and mean corpuscular haemoglobin content, while mean corpuscular volume and platelet count were increased. A significant elevation (P < 0.001) in serum glutamate oxaloacetate transaminase, serum glutamate pyruvate transaminase, alkaline phosphatase, acid phosphatase and total cholesterol were also observed, when compared with control mice. Thus, the study demonstrated that the concurrent daily administration of root extract of WS protected the adverse effects of LN intoxication in mice.
The effect of aspirin on blood loss and transfusion requirements in patients with femoral neck fractures.

LENUS (Irish Health Repository)

Manning, Brian J

2012-02-03

Although it is widely accepted that aspirin will increase the risk of intra- and post-operative bleeding, clinical studies have not consistently supported this assumption. We aimed to assess the effect of pre-operative aspirin on blood loss and transfusion requirements in patients undergoing emergency fixation of femoral neck fractures. A prospective case-control study was undertaken in patients presenting with femoral neck fractures. Parameters recorded included intra-operative blood loss, post-operative blood loss, transfusion requirements and peri-operative reduction in haemoglobin concentration. Of 89 patients presenting with femoral neck fractures 32 were on long-term aspirin therapy. Pre-operative aspirin ingestion did not significantly affect peri-operative blood loss, or change in haemoglobin concentration or haematocrit. However those patients taking aspirin pre-operatively had a significantly lower haemoglobin concentration and haematocrit and were more likely to be anaemic at presentation than those who were not receiving aspirin. Patients taking aspirin were also more likely to receive blood transfusion post-operatively.
Hydroxyurea for reducing blood transfusion in non-transfusion dependent beta thalassaemias.

Science.gov (United States)

Foong, Wai Cheng; Ho, Jacqueline J; Loh, C Khai; Viprakasit, Vip

2016-10-18

Non-transfusion dependent beta thalassaemia is a subset of inherited haemoglobin disorders characterised by reduced production of the beta globin chain of the haemoglobin molecule leading to anaemia of varying severity. Although blood transfusion is not a necessity for survival, it is required when episodes of chronic anaemia occur. This chronic anaemia can impair growth and affect quality of life. People with non-transfusion dependent beta thalassaemia suffer from iron overload due to their body's increased capability of absorbing iron from food sources. Iron overload becomes more pronounced in those requiring blood transfusion. People with a higher foetal haemoglobin level have been found to require fewer blood transfusions. Hydroxyurea has been used to increase foetal haemoglobin level; however, its efficacy in reducing transfusion, chronic anaemia complications and its safety need to be established. To assess the effectiveness, safety and appropriate dose regimen of hydroxyurea in people with non-transfusion dependent beta thalassaemia (haemoglobin E combined with beta thalassaemia and beta thalassaemia intermedia). We searched the Cochrane Cystic Fibrosis and Genetic Disorders Group's Haemoglobinopathies Trials Register, compiled from electronic database searches and handsearching of relevant journals. We also searched ongoing trials registries and the reference lists of relevant articles and reviews.Date of last search: 30 April 2016. Randomised or quasi-randomised controlled trials of hydroxyurea in people with non-transfusion dependent beta thalassaemia comparing hydroxyurea with placebo or standard treatment or comparing different doses of hydroxyurea. Two authors independently applied the inclusion criteria in order to select trials for inclusion. Both authors assessed the risk of bias of trials and extracted the data. A third author verified these assessments. No trials comparing hydroxyurea with placebo or standard care were found. However, we included
Prevalence and predictors of the sub-target Hb level in children on dialysis

DEFF Research Database (Denmark)

van Stralen, Karlijn J; Krischock, Leah; Schaefer, Franz

2012-01-01

Anaemia is a common and potentially treatable co-morbidity of end-stage renal disease. We aimed to determine the prevalence of the sub-target haemoglobin (Hb) level among European children on dialysis and to identify factors associated with a low Hb level.......Anaemia is a common and potentially treatable co-morbidity of end-stage renal disease. We aimed to determine the prevalence of the sub-target haemoglobin (Hb) level among European children on dialysis and to identify factors associated with a low Hb level....
Monocyte expression and soluble levels of the haemoglobin receptor (CD163/sCD163 and the mannose receptor (MR/sMR in septic and critically ill non-septic ICU patients.

Directory of Open Access Journals (Sweden)

Anders G Kjærgaard

Full Text Available BACKGROUND: The diagnosis of sepsis is challenging and there is an unmet need for sensitive and specific diagnostic and prognostic biomarkers. Following activation of macrophages and monocytes, the haptoglobin-haemoglobin receptor (CD163 and the mannose receptor (MR are shed into the circulation (sCD163 and sMR. OBJECTIVE: We investigated monocyte expression of CD163 and MR, and levels of sCD163 and sMR in septic and non-septic patients, and in healthy controls. We hypothesised that these receptors are elevated during sepsis and can be used diagnostic and prognostic. METHODS: Twenty-one patients with severe sepsis or septic shock and 15 critically ill non-septic patients were included in this prospective observational study at three ICUs at Aarhus University Hospital and Randers Regional Hospital, Denmark. Fifteen age- and gender-matched healthy volunteers served as controls. Levels of sCD163 and sMR were measured using a sandwich ELISA and monocyte expression of CD163 and MR was evaluated by flow cytometry during the first four days of ICU stay. The diagnostic and prognostic values of the receptors were assessed using AUROC curves. RESULTS: At ICU admission and during the observation period, monocyte expression of CD163 and levels of sCD163 and sMR were significantly higher in septic patients compared with non-septic patients and healthy controls (p<0.01 for all comparisons. Monocytes did not express MR. The diagnostic values estimated by AUROC were 1.00 for sMR, 0.95 for sCD163, 0.87 for CRP, and 0.75 for monocyte-bound CD163. Among the septic patients, monocyte expression of CD163 was higher in non-survivors compared with survivors at ICU admission (p = 0.02 and during the observation period (p = 0.006. The prognostic value of monocyte-bound CD163 estimated by AUROC at ICU admission was 0.82. CONCLUSION: The macrophage-specific markers CD163, sCD163, and sMR are increased in septic patients. Particularly sMR is a promising new
The influence of bilirubin, haemolysis and turbidity on 20 analytical tests performed on automatic analysers. Results of an interlaboratory study.

Science.gov (United States)

Grafmeyer, D; Bondon, M; Manchon, M; Levillain, P

1995-01-01

The director of a laboratory has to be sure to give out reliable results for routine tests on automatic analysers regardless of the clinical context. However, he may find hyperbilirubinaemia in some circumstances, parenteral nutrition causing turbidity in others, and haemolysis occurring if sampling is difficult. For this reason, the Commission for Instrumentation of the Société Française de Biologie Clinique (SFBC) (president Alain Feuillu) decided to look into "visible" interferences--bilirubin, haemolysis and turbidity--and their effect on 20 major tests: 13 substrates/chemistries: albumin, calcium, cholesterol, creatinine, glucose, iron, magnesium, phosphorus, total bilirubin, total proteins, triacylglycerols, uric acid, urea, and 7 enzymatic activities: alkaline phosphatase, alanine aminotransferase, alpha-amylase, aspartate aminotransferase, creatine kinase, gamma-glutamyl transferase and lactate dehydrogenase measured on 15 automatic analysers representative of those found on the French market (Astra 8, AU 510, AU 5010, AU 5000, Chem 1, CX 7, Dax 72, Dimension, Ektachem, Hitachi 717, Hitachi 737, Hitachi 747, Monarch, Open 30, Paramax, Wako 30 R) and to see how much they affect the accuracy of results under routine conditions in the laboratory. The study was carried out following the SFBC protocol for the validation of techniques using spiked plasma pools with bilirubin, ditauro-bilirubin, haemoglobin (from haemolysate) and Intralipid (turbidity). Overall, the following results were obtained: haemolysis affects tests the most often (34.5% of cases); total bilirubin interferes in 21.7% of cases; direct bilirubin and turbidity seem to interfere less at around 17%. The different tests are not affected to the same extent; enzyme activity is hardly affected at all; on the other hand certain major tests are extremely sensitive, increasingly so as we go through the following: creatinine (interference of bilirubin), triacylglycerols (interference of bilirubin and
Detection of Egg Production of Tegal Duck by Blood Protein Polymorphism

Directory of Open Access Journals (Sweden)

Ismoyowati Ismoyowati

2008-05-01

Full Text Available The aim of this research was to study the effect of transfferine, albumine, and haemoglobine loci to egg production characteristic of Tegal duck. 100 lying of Tegal ducks keeping by batteray-pen were used in this study. Individual egg production was recorded until period of 120 days. Blood protein polymorphism analysed by electrophoresis method, and blood sample taken from each ducks.. Egg production and transfferine albumine, and haemoglobine phenotipe on electrophoresis gel were observed in this study. Genotipe and gene frequencies and genetic variant were applied in data analysis. The result showed that (1 in the transferine locus were identified 3 aleles forming 4 genotipes (TfAA,TfAB, TfBB, and TfBC, (2 in albumine were identified 3 aleles forming 5 genotipes (AlbAA, AlbAB, AlbAC, AlbBB and AlbBC and (3 haemoglobine locus were identified 6 aleles forming 4 genotipes ((HbAA, HbAB, HbAC, HbBB, HbBC dan HbCC. This study demostrated that B gene frequenci in transfferine, albumine and haemoglonine loci was highest than A and C gene frequency. Tegal Duck with AA genotipe on all loci had higher egg production than BB and CC homozigote. This research revealed that the most efective of selection method by haemoglobine protein polymorphism. (Animal Production 10(2: 122-128 (2008 Key Words: Tegal duck, egg production, selection, blood protein polymorphism
Accuracy of clinical pallor in the diagnosis of anaemia in children: a meta-analysis

Science.gov (United States)

Chalco, Juan P; Huicho, Luis; Alamo, Carlos; Carreazo, Nilton Y; Bada, Carlos A

2005-01-01

Background Anaemia is highly prevalent in children of developing countries. It is associated with impaired physical growth and mental development. Palmar pallor is recommended at primary level for diagnosing it, on the basis of few studies. The objective of the study was to systematically assess the accuracy of clinical signs in the diagnosis of anaemia in children. Methods A systematic review on the accuracy of clinical signs of anaemia in children. We performed an Internet search in various databases and an additional reference tracking. Studies had to be on performance of clinical signs in the diagnosis of anaemia, using haemoglobin as the gold standard. We calculated pooled diagnostic likelihood ratios (LR's) and odds ratios (DOR's) for each clinical sign at different haemoglobin thresholds. Results Eleven articles met the inclusion criteria. Most studies were performed in Africa, in children underfive. Chi-square test for proportions and Cochran Q for DOR's and for LR's showed heterogeneity. Type of observer and haemoglobin technique influenced the results. Pooling was done using the random effects model. Pooled DOR at haemoglobin outliers. Conclusion This meta-analysis did not document a highly accurate clinical sign of anaemia. In view of poor performance of clinical signs, universal iron supplementation may be an adequate control strategy in high prevalence areas. Further well-designed studies are needed in settings other than Africa. They should assess inter-observer variation, performance of combined clinical signs, phenotypic differences, and different degrees of anaemia. PMID:16336667
Risk factors of anaemia among rural school children in Kenitra, Morocco.

Science.gov (United States)

El Hioui, M; Ahami, A O T; Aboussaleh, Y; Rusinek, S; Dik, K; Soualem, A; Azzaoui, F-Z; Loutfi, H; Elqaj, M

2008-08-01

To determine the prevalence of anaemia and factors associated with iron deficiency among school children in rural Kenitra, Morocco. 295 students between 6 and 16 years old composed the study group. The level of haemoglobin was measured in a group of 295 school children. The iron status was determined by ferritin level in serum, and anaemia was defined when haemoglobin educational status of the parents. The mean haemoglobin concentration was 12.4 g/dl in boys and 12.5 g/dl in girls, whereas the mean ferritin level was 26.7 microg/l in boys and 27.9 microg/l in girls. The overall prevalence of anaemia in the studied population was 12.2% and iron deficiency was 20.4%. There was a significant relationship between education of the mother and anaemia in children (p= 0.01). Serum ferritin (SF), serum iron concentrations and mean corpuscular volume (MCV) were significantly correlated with haemoglobin by multiple regression analysis. However, using logistic regression analysis, the results showed that anaemia was not significantly associated with gender, parents' employment and monthly family income. Anaemia remains a common problem in the young children particularly the primary education school boys of the households of low income. The results suggest also, that iron deficiency is an important determinant of anaemia in this population; however, whole anaemia cannot be solely explained by iron deficiency. Further studies are needed to consider micronutrients status and exposure to environmental pollutants.
Temperature effect on the performance of a dissipative dielectric elastomer generator with failure modes

International Nuclear Information System (INIS)

Chen, S E; Deng, L; He, Z C; Li, Eric; Li, G Y

2016-01-01

Research on dielectric elastomer generators (DEGs) which can be utilized to convert mechanical energy to electrical energy has gained wide attention lately. However, very few works account for the operating temperature, viscoelasticity and current leakage in the analysis of DEGs simultaneously. In this study, under several compound four-stroke conversion cycles, the electromechanical performance and energy conversion of a dissipative DEG made of a very-high-bond (VHB) elastomer are investigated at different operating temperatures. The performance parameters such as energy density and conversion efficiency are calculated under different temperatures. Moreover, the common failure modes of the generator are considered: material rupture, loss of tension, electrical breakdown and electromechanical instability. The numerical results have distinctly shown that the operating temperature plays an important role in the performance of DEGs, which could possibly make a larger conversion efficiency for the DEG. (paper)

Iron deficiency - a global problem

International Nuclear Information System (INIS)

Ali, S.M.

1993-01-01

Iron deficiency is an important nutritional global problem. This paper contains summery of information gathered from a dietary survey as iron deficiency anaemia is major public health problem in many developing countries including Pakistan. Comparison of anaemia in different age group and sex versus various regions in the world are given. In Pakistan also anaemia is widespread. According to the report of Micro-Nutrient survey of Pakistan 40% of the population are found to have low level of haemoglobin, more than half of pregnant women suffered from marginal or deficient haemoglobin. (A.B.)
Dynamics of proteins at low temperatures: fibrous vs. globular

Science.gov (United States)

Foucat, L.; Renou, J.-P.; Tengroth, C.; Janssen, S.; Middendorf, H. D.

We have measured quasielastic neutron scattering from H2O-hydrated collagen and haemoglobin at Tτ>10 ps. Relative to haemoglobin, the 200-K dynamic transition is shifted upward by 20-25 K in collagen, and the T-dependence of m.-sq. displacements derived from Sqe(Q;T) suggests that in triple-helical systems there are three rather than two regimes: one up to around 120K (probably purely harmonic), an intermediate quasiharmonic region with a linear dependence up to 240K, followed by a steeper nonlinear rise similar to that in globular proteins.
Iron deficiency - a global problem

Energy Technology Data Exchange (ETDEWEB)

Ali, S M [Pakistan Council for Science and Technology, Islamabad (Pakistan)

1994-12-31

Iron deficiency is an important nutritional global problem. This paper contains summery of information gathered from a dietary survey as iron deficiency anaemia is major public health problem in many developing countries including Pakistan. Comparison of anaemia in different age group and sex versus various regions in the world are given. In Pakistan also anaemia is widespread. According to the report of Micro-Nutrient survey of Pakistan 40% of the population are found to have low level of haemoglobin, more than half of pregnant women suffered from marginal or deficient haemoglobin. (A.B.).
Unwanted road to anaemia in transthyretin familial amyloid polyneuropathy may continue irrespective of tafamidis treatment.

Science.gov (United States)

Ikeda, Tokunori; Masuda, Teruaki; Ueda, Mitsuharu; Yamashita, Taro; Misumi, Yohei; Shinriki, Satoru; Ando, Yukio

2018-01-01

Background This retrospective longitudinal study was performed to determine whether tafamidis treatment leads to improvements in commonly used blood data for transthyretin familial amyloid polyneuropathy (TTR-FAP). Methods Commonly used blood data (complete blood count [including a haemogram], total protein, albumin, blood urea nitrogen, creatinine, aspartate aminotransferase, alanine aminotransferase, alkaline phosphatase, lactate dehydrogenase, γ-glutamyl transpeptidase, total bilirubin [T-Bil], creatine kinase, choline esterase, high-density lipoprotein cholesterol, low-density lipoprotein cholesterol, estimated glomerular filtration rate [eGFR], serum amyloid A protein, TTR, haemoglobin A1c, free triiodothyronine [FT3] and free thyroxine [FT4]) were investigated in 33 TTR-FAP patients. These values included longitudinal data at three time points: six months before or after tafamidis treatment and one year after tafamidis treatment. Longitudinal changes in each blood item were examined using a linear mixed model, adjusting for age at starting tafamidis, sex, TTR-FAP stage and value before tafamidis treatment. Results Our results show elevated TTR concentrations after tafamidis treatment. In contrast, haemoglobin, mean corpuscular haemoglobin, mean corpuscular haemoglobin concentration, mean platelet volume, platelet distribution width, T-Bil, eGFR, FT3 and FT4, gradually decreased through a reference range. There were no characteristic observations in any other items. TTR binds to thyroid hormone; therefore, FT3 and FT4 decreased in inverse proportion to increased TTR concentrations. Conclusion Unfortunately, progression to anaemia may occur regardless of tafamidis treatment. Because anaemia is sometimes present in TTR-FAP, attention should be paid to longitudinal changes in commonly used blood data, irrespective of tafamidis treatment.
Design of a tissue oxygenation monitor and verification on human skin

Science.gov (United States)

Liu, Hongyuan; Kohl-Bareis, Matthias; Huang, Xiabing

2011-07-01

We report the design of a tissue oxygen and temperature monitor. The non-invasive, fibre based device monitors tissue haemoglobin (Hb) and oxygen saturation (SO2) and is based on white-light reflectance spectroscopy.Visible light with wavelengths in the 500 - 650nm range is utilized. The spectroscopic algorithm takes into account the tissue scattering and melanin absorption for the calculation of tissue haemoglobin concentration and oxygen saturation. The monitor can probe superficial layers of tissue with a high spatial resolution (mm3) and a high temporal resolution (40 Hz). It provides an accurate measurement with the accuracy of SO2 at 2 % and high reliability with less than 2 % variation of continuous SO2 measurement over 12 hours. It can also form a modular system when used in conjunction with a laser Doppler monitor, enabling simultaneous measurements of Hb, SO2 and blood flow. We found experimentally that the influence of the source-detector separation on the haemoglobin parameters is small. This finding is discussed by Monte Carlo simulations for the depth sensitivity profile. The influence of probe pressure and the skin pigmentation on the measurement parameters are assessed before in vivo experimental data is presented. The combination with laser Doppler flowmetry demonstrates the importance of a measurement of both the haemoglobin and the blood flow parameters for a full description of blood tissue perfusion. This is discussed in experimental data on human skin during cuff occlusion and after hyperemisation by a pharmacological cream. Strong correlation is observed between tissue oxygen (Hb and SO2) and blood flow measurements.
Evaluation of high performance liquid chromatography (HPLC) pattern and prevalence of beta-thalassaemia trait among sickle cell disease patients in Lagos, Nigeria.

Science.gov (United States)

Adeyemo, Titilope; Ojewunmi, Oyesola; Oyetunji, Ajoke

2014-01-01

Sickle cell disease (SCD) is the most common inherited disorder of haemoglobin worldwide. This study evaluated the chromatographic patterns and red blood cell indices of sickle cell patients to determine the co-inheritance of other haemoglobin(Hb) variants and β-thalassaemia trait. Red cell indices, blood film, sickle solubility test, Hb electrophoresis using alkaline cellulose acetate membrane, and chromatographic patterns using Bio Rad HPLC Variant II were evaluated for 180 subjects. Based on low MCV 4.0% on HPLC and Hb variants eluting outside the S and C windows, at least four haemoglobin phenotypes (SS: 87.7%; SC: 1.1%; SD Punjab: 0.6%; Sβ-thalassemia: 10.6%) were identified. Mean Hb F% was 8.1±5.1 (median 7.65) for Hb SS and 6.03±5.2 (median 3.9) for Hb Sβ-thalassemia trait. Majority of Hb SS (69.1%) had Hb F% less than 10 while 27.6% had 10-19.9 and 3.2% had ≥ 20. Mean Hb F% was higher in female Hb SS (9.55±5.09; mean age 7.4±3.8 years) than the males (7.63±4.80; mean age 6.9±3.8 years) (P=0.02). A borderline significant negative correlation between age and Hb F levels among Hb SS subjects (r= -0.169 P=0.038) was also observed. Our data suggests that α and β- thalassaemia traits, and other haemoglobin variants co-exist frequently with SCD in our population.
Evidence of mutualism between two periodontal pathogens: co-operative haem acquisition by the HmuY haemophore of Porphyromonas gingivalis and the cysteine protease interpain A (InpA) of Prevotella intermedia.

Science.gov (United States)

Byrne, D P; Potempa, J; Olczak, T; Smalley, J W

2013-06-01

Haem (iron protoporphyrin IX) is both an essential growth factor and a virulence regulator of the periodontal pathogens Porphyromonas gingivalis and Prevotella intermedia, which acquire it through the proteolytic degradation of haemoglobin and other haem-carrying plasma proteins. The haem-binding lipoprotein HmuY haemophore and the gingipain proteases of P. gingivalis form a unique synthrophic system responsible for capture of haem from haemoglobin and methaemalbumin. In this system, methaemoglobin is formed from oxyhaemoglobin by the activities of gingipain proteases and serves as a facile substrate from which HmuY can capture haem. This study examined the possibility of cooperation between HmuY and the cysteine protease interpain A (InpA) of Pr. intermedia in the haem acquisition process. Using UV-visible spectroscopy and polyacrylamide gel electrophoresis, HmuY was demonstrated to be resistant to proteolysis and so able to cooperate with InpA to extract haem from haemoglobin, which was proteolytically converted to methaemoglobin by the protease. Spectroscopic pH titrations showed that both the iron(II) and iron(III) protoporphyrin IX-HmuY complexes were stable over the pH range 4-10, demonstrating that the haemophore could function over a range of pH that may be encountered in the dental plaque biofilm. This is the first demonstration of a bacterial haemophore working in conjunction with a protease from another bacterial species to acquire haem from haemoglobin and may represent mutualism between P. gingivalis and Pr. intermedia co-inhabiting the periodontal pocket. © 2013 John Wiley & Sons A/S. Published by Blackwell Publishing Ltd.
Trichuris and hookworm infections associated with anaemia during pregnancy.

Science.gov (United States)

Gyorkos, Theresa W; Gilbert, Nicolas L; Larocque, Renée; Casapía, Martín

2011-04-01

To assess the following associations between the second and third trimesters of pregnancy: (i) the intensity of soil-transmitted helminth (STH) infection and haemoglobin/anaemia, (ii) the effect of mebendazole treatment on the occurrence of STH infection, and (iii) the effect of mebendazole treatment on haemoglobin/anaemia. Data originated from a trial of 1042 pregnant women recruited in their second trimester and followed to delivery. Baseline assessments included socio-demographic/health information from questionnaires, haemoglobin/anaemia from HemoCue ascertainment of fingerprick blood, and the presence and intensity of STH (Ascaris lumbricoides, hookworms and Trichuris trichiura) infections from Kato-Katz examination. All women were given iron supplements; half were randomly allocated to receive single dose 500 mg mebendazole, and half, placebo. Haemoglobin/anaemia and STH infection status were determined again in the third trimester of pregnancy. Complete information was available from 935 (89.7%) women. Mebendazole significantly reduced the prevalence and intensity of all three STH infections. Higher intensities of hookworm and Trichuris infections in the second trimester were associated with a higher risk of anaemia in the third trimester. Overall, women with moderate/heavy Trichuris infection were found to be at a higher risk of anaemia; the highest risk was observed among those with moderate/heavy hookworm co-infection (adjusted OR = 2.77; 95% CI: 1.26, 6.11). Mebendazole treatment did not reduce the risk of anaemia. Higher intensities of both Trichuris and hookworm infections are associated with anaemia in pregnancy. The importance of Trichuris infections during pregnancy requires renewed attention. © 2011 Blackwell Publishing Ltd.
Contactless diagnostics of biophysical parameters of skin and blood on the basis of approximating functions for radiation fluxes scattered by skin

Energy Technology Data Exchange (ETDEWEB)

Lisenko, S A; Kugeiko, M M [Belarusian State University, Minsk (Belarus)

2014-03-28

Approximating expressions are derived to calculate spectral and spatial characteristics of diffuse reflection of light from a two-layer medium mimicking human skin. The effectiveness of the use of these expressions in the optical diagnosis of skin biophysical parameters (tissue scattering parameters, concentration of melanin in the epidermis, concentration of total haemoglobin and bilirubin in the tissues of the dermis) and content of haemoglobin derivatives in blood (oxy-, deoxy-, met-, carboxy- and sulfhaemoglobin) is analysed numerically. The methods are proposed to determine in realtime these parameters without contact of the measuring instrument with the patient's body. (biophotonics)
Contactless diagnostics of biophysical parameters of skin and blood on the basis of approximating functions for radiation fluxes scattered by skin

Science.gov (United States)

Lisenko, S. A.; Kugeiko, M. M.

2014-03-01

Approximating expressions are derived to calculate spectral and spatial characteristics of diffuse reflection of light from a two-layer medium mimicking human skin. The effectiveness of the use of these expressions in the optical diagnosis of skin biophysical parameters (tissue scattering parameters, concentration of melanin in the epidermis, concentration of total haemoglobin and bilirubin in the tissues of the dermis) and content of haemoglobin derivatives in blood (oxy-, deoxy-, met-, carboxy- and sulfhaemoglobin) is analysed numerically. The methods are proposed to determine in realtime these parameters without contact of the measuring instrument with the patient's body.
Calibration of a prototype NIRS oximeter against two commercial devices on a blood-lipid phantom

DEFF Research Database (Denmark)

Hyttel-Sorensen, Simon; Kleiser, Stefan; Wolf, Martin

2013-01-01

In a blood-lipid liquid phantom the prototype near-infrared spectroscopy oximeter OxyPrem was calibrated against the INVOS® 5100c adult sensor in respect to values of regional tissue oxygen haemoglobin saturation (rStO2) for possible inclusion in the randomised clinical trial - SafeBoosC. In addi......In a blood-lipid liquid phantom the prototype near-infrared spectroscopy oximeter OxyPrem was calibrated against the INVOS® 5100c adult sensor in respect to values of regional tissue oxygen haemoglobin saturation (rStO2) for possible inclusion in the randomised clinical trial - Safe...
Skin-inspired hydrogel-elastomer hybrids with robust interfaces and functional microstructures

Science.gov (United States)

Yuk, Hyunwoo; Zhang, Teng; Parada, German Alberto; Liu, Xinyue; Zhao, Xuanhe

2016-06-01

Inspired by mammalian skins, soft hybrids integrating the merits of elastomers and hydrogels have potential applications in diverse areas including stretchable and bio-integrated electronics, microfluidics, tissue engineering, soft robotics and biomedical devices. However, existing hydrogel-elastomer hybrids have limitations such as weak interfacial bonding, low robustness and difficulties in patterning microstructures. Here, we report a simple yet versatile method to assemble hydrogels and elastomers into hybrids with extremely robust interfaces (interfacial toughness over 1,000 Jm-2) and functional microstructures such as microfluidic channels and electrical circuits. The proposed method is generally applicable to various types of tough hydrogels and diverse commonly used elastomers including polydimethylsiloxane Sylgard 184, polyurethane, latex, VHB and Ecoflex. We further demonstrate applications enabled by the robust and microstructured hydrogel-elastomer hybrids including anti-dehydration hydrogel-elastomer hybrids, stretchable and reactive hydrogel-elastomer microfluidics, and stretchable hydrogel circuit boards patterned on elastomer.
Combinatorial metabolic engineering of Pseudomonas putida KT2440 for efficient mineralization of 1,2,3-trichloropropane.

Science.gov (United States)

Gong, Ting; Xu, Xiaoqing; Che, You; Liu, Ruihua; Gao, Weixia; Zhao, Fengjie; Yu, Huilei; Liang, Jingnan; Xu, Ping; Song, Cunjiang; Yang, Chao

2017-08-01

An industrial waste, 1,2,3-trichloropropane (TCP), is toxic and extremely recalcitrant to biodegradation. To date, no natural TCP degraders able to mineralize TCP aerobically have been isolated. In this work, we engineered a biosafety Pseudomonas putida strain KT2440 for aerobic mineralization of TCP by implantation of a synthetic biodegradation pathway into the chromosome and further improved TCP mineralization using combinatorial engineering strategies. Initially, a synthetic pathway composed of haloalkane dehalogenase, haloalcohol dehalogenase and epoxide hydrolase was functionally assembled for the conversion of TCP into glycerol in P. putida KT2440. Then, the growth lag-phase of using glycerol as a growth precursor was eliminated by deleting the glpR gene, significantly enhancing the flux of carbon through the pathway. Subsequently, we improved the oxygen sequestering capacity of this strain through the heterologous expression of Vitreoscilla hemoglobin, which makes this strain able to mineralize TCP under oxygen-limited conditions. Lastly, we further improved intracellular energy charge (ATP/ADP ratio) and reducing power (NADPH/NADP + ratio) by deleting flagella-related genes in the genome of P. putida KT2440. The resulting strain (named KTU-TGVF) could efficiently utilize TCP as the sole source of carbon for growth. Degradation studies in a bioreactor highlight the value of this engineered strain for TCP bioremediation.
Haemoglobin genotypes: a prevalence study and implications for ...

African Journals Online (AJOL)

Withmany children with sickle cell disease now surviving to adulthood due to advances in medicine, a larger number of women with sickle cell disease in pregnancy with all the attendant challenges it poses should be expected in our environment. It is necessary therefore, to keep abreast with developments in the area of its ...
Fasting blood glucose and haemoglobin concentrations of healthy ...

African Journals Online (AJOL)

Menstruation is associated with loss of blood monthly in women of reproductive age. In some women this physiological phenomenon is also associated with some complaints such as menstrual pain, vomiting, and tiredness. We investigated the fasting blood glucose concentration and hemoglobin concentration before and ...
Haemoglobin and Lung Total and Lysosomal Phosphatase Activity ...

African Journals Online (AJOL)

Smoking of ordinary cigarette exposes its active smokers to health hazards and the filter-tipped cigarette, is said to reduce the hazards. However, it is not certain if the filter-tipped cigarette reduces the hazards in passive smokers since they inhail the cigarette smoke through their nostrils regardless of whether the cigarette is ...
173 original article glycated haemoglobin levels in patients

African Journals Online (AJOL)

boaz

therapy, two patients had pre-diabetes with HbA1c values of 6.0% and 5.8% while the HbA1c values of the remaining patients were less than .... determined by the blood glucose levels in the .... treatment of MDR-TB on glycaemic homeostasis.
Glycated haemoglobin and associated variables in diabetics: Ilorin ...

African Journals Online (AJOL)

Cent cinquante malades atteints de diabètes mellitus du type 2 ont été examinés afin de décider les conséquence de l'hémoglobine glycosylée et des facteurs qui pourront l'influencer. Des facteurs ainsi notés étaient: âge, sexe, la durée de la maladie et l'indice de la masse. Le HbA1c moyen était 8,0%. Quatre vingt seize ...
Blood pressure variations in Subjects with different Haemoglobin ...

African Journals Online (AJOL)

Dr Olaleye Samuel

compared with the normal controls. The systolic blood pressures in control (HB AA) and SCD patients were .... especially in older patients and may predispose them to stroke and other ... autonomic responses to change in posture or vitamin C.
Field evaluation of a novel haemoglobin measuring device ...

African Journals Online (AJOL)

Asia (48%) and Africa (41%), with infants, young children and pregnant women being partiCUlarly ... high cost, inadequate training and lack of facilities generally prevent the use of ..... S AIr Med J 1991; 79; 547-548. 5. Politzer WM, Myburgh ...

distribution of abo, rhesus blood groups and haemoglobin ...

African Journals Online (AJOL)

Daniel Owu

fetal blood leaks through the placenta and mixes with the mother's blood, the mother ... competence of the blood to supply oxygen to the tissue (Weatherall, ... on a tile and mixed with three drops of water to lyse the red cells. With the aid of an ...
Annual Frequency of Malaria Attack in Different Haemoglobin ...

African Journals Online (AJOL)

GREG F. FOMBO

believed to be due to the enzyme deficiency advantage against fatal malaria. However, the mechanism of this .... Fluorescence was produced due to the reduction of NADP+ to. NADPH. ... Presence of fluorescence indicated normal cells while weak fluorescence ..... Molecular Monitoring of Malaria Vaccine Trial. Trends in.
Prevalence of Haemoglobine s in Araraquara-SP Population.

Directory of Open Access Journals (Sweden)

Bruno Rocha de Jesus

2015-01-01

Full Text Available The Sickle Cell Anemia is a genetic hemoglobionopathy, characterized by an alteration in the hemoglobin molecule struture (HbA1, called hemoglobin S (HbS, which causes a distortion in the erythocytes structure, changing from spherical shape to sickle shape (sickle-cell, a sickling phenomenon, which leads to severe anemia in homozygous, while sickle cell trait (heterozygote leads to pain crisis, according to pathophysiology, in low O2 blood pressure situations. The most specific and sensitive test used to diagnose this anemia is the hemoglobin eletrophoresis test, which is, however, hard to be incorporated in routine laboratories, due to its high cost. The objective of this work was to estimate the sickle cell trait prevalence in Araraquara - SP population. The prevalence of asymptomatic individuals with the sickle cell trait was 1.5%. Considering the study of race prevalence, 0,6% of sickle cell trait in white individuals and 15,4% in black ones were found.
Haemoglobins with multiple reactive sulfhydryl groups: reactions of ...

African Journals Online (AJOL)

The pH dependence profile of kapp, the apparent second-order rate constant, for the fast phase resembles the titration curve of a diprotic acid. Quantitative analysis indicates that the reactivity of the sulfhydryl group to which this phase may be attributed is linked to two ionizable groups with pKas of 6.4 0.1 and 7.8 0.2.
Fasting Blood Glucose Levels in Different Haemoglobin Genotypes ...

African Journals Online (AJOL)

For the different Hb genotypes (HBAA, HBAS, HBSC and HBSS) the following mean fasting blood glucose levels were obtained respectively: 71.9±8.Omg/dl 73.4±7.4mgldl, 94.7±6.Imgldl and 94.6±5.9mgldl. There was a significant difference between the mean fasting blood glucose concentrations of blood groups O,A,B and ...
Whole blood coagulation time, haematocrit, haemoglobin and total ...

African Journals Online (AJOL)

The study was carried out to determine the values of whole blood coagulation time (WBCT), haematocrit (HM), haemaglobin (HB) and total protein (TP) of one hundred and eighteen apparently healthy turkeys reared under an extensive management system in Zaria. The mean values for WBCT, HM, HB and TP were 1.12 ...
Electrogastrography abnormalities appear early in children with diabetes type 1.

Science.gov (United States)

Posfay-Barbe, Klara M; Lindley, Keith J; Schwitzgebel, Valérie M; Belli, Dominique C; Schäppi, Michela G

2011-10-01

The objective of the study was to evaluate gastric myoelectrical activity in young patients with diabetes and to correlate it with their metabolic control [fasting blood glucose, glycosylated haemoglobin, and fructosamine] and BMI during a 3 years follow-up. Surface electrogastrography (EGG) was performed on 49 children with diabetes aged 10.3±4.4 (mean±SD) years and 17 age-matched healthy controls after fasting glucose, glycosylated haemoglobin, and fructosamine were measured. EGG parameters [percentage of bradygastria, 3 cycles per minute, tachygastria, dominant frequency instability coefficient, and power ratio] were analysed and compared with blood analysis. Patients with diabetes exhibited an increase in preprandial bradygastria 7.9±8.8 cpm (mean±SD) compared with controls 2.1±1.0 (P=0.011), with an associated decrease in preprandial normogastria (72.2±14.5 vs. 82.7±14.7; P=0.013). Normogastric power ratio (postprandial/ preprandial power) was significantly increased in the children with diabetes compared with controls (mean: 6.67 vs. 3.14, P=0.034). A longer duration of diabetes was associated with an increased risk of EGG abnormalities (P=0.036). Marked hyperglycaemia at the time of study was associated with postprandial bradygastria (P=0.01) and power ratio bradygastria (P=0.042). Changes in glycosylated haemoglobin, fructosamine and BMI did not affect EGG parameters. EGG abnormalities, presented early in a high proportion of diabetic children, are related to the acute hyperglycaemia. These abnormalities are not consistently present in the follow-up studies and not related to the glycosylated haemoglobin and fructosamine. Diabetic autonomic neuropathy is therefore an unlikely pathogenic factor for EGG abnormalities in children with diabetes.
A sequential erythropoietin and GM-CSF schedule offers clinical benefits in the treatment of anaemia in myelodysplastic syndromes.

Science.gov (United States)

Bernell, P; Stenke, L; Wallvik, J; Hippe, E; Hast, R

1996-08-01

In order to reduce anaemia in patients with myelodysplastic syndromes (MDS) a stepwise treatment protocol including erythropoietin (EP) and granulocyte-macrophage colony-stimulating factor (GM-CSF) was designed. Thirty-seven MDS patients (stages I-III) with symptomatic anaemia were first given EPO 10,000 U s.c. 3 times weekly for 6 weeks. Those not responding, i.e. increased their haemoglobin levels > 15 g/l, proceeded into the second phase of the study where GM-CSF (200 micrograms/d. s.c. on weeks 1-6) was combined with EPO (10,000 U s.c. 3 times weekly on weeks 5-14). Following the initial EPO treatment phase, 14 of the 37 patients (38%) responded with increased haemoglobin levels. Responders were significantly different from non-responders in that their pre-treatment values of s-EPO, s-LDH and bone marrow blast cell counts were lower, their baseline haemoglobin levels higher and their transfusion dependency less pronounced. Eighteen of the 23 non-responders proceeded into the second phase, 13 of those were evaluable having completed the entire schedule. Three of the 13 initially EPO resistant patients (23%) responded to the GM-CSF/EPO combination with increased haemoglobin levels, suggesting a positive synergy between the two cytokines. Thus, the overall response rate to the present protocol was 46% (17 of 37 cases), but only a limited subset of the patients did clearly benefit from the combined GM-CSF/EPO administration. Therefore, we believe this step-wise approach to multiple growth factor treatment in MDS, starting with EPO alone and reserving the combination for refractory cases, has considerable advantages, taking into account both medical and socio-economical aspects.
Interlaboratory comparison of red-cell ATP, 2,3-diphosphoglycerate and haemolysis measurements.

Science.gov (United States)

Hess, J R; Kagen, L R; van der Meer, P F; Simon, T; Cardigan, R; Greenwalt, T J; AuBuchon, J P; Brand, A; Lockwood, W; Zanella, A; Adamson, J; Snyder, E; Taylor, H L; Moroff, G; Hogman, C

2005-07-01

Red blood cell (RBC) storage systems are licensed based on their ability to prevent haemolysis and maintain RBC 24-h in vivo recovery. Preclinical testing includes measurement of RBC ATP as a surrogate for recovery, 2,3-diphosphoglycerate (DPG) as a surrogate for oxygen affinity, and free haemoglobin, which is indicative of red cell lysis. The reproducibility of RBC ATP, DPG and haemolysis measurements between centres was investigated. Five, 4-day-old leucoreduced AS-1 RBC units were pooled, aliquotted and shipped on ice to 14 laboratories in the USA and European Union (EU). Each laboratory was to sample the bag twice on day 7 and measure RBC ATP, DPG, haemoglobin and haemolysis levels in triplicate on each sample. The variability of results was assessed by using coefficients of variation (CV) and analysis of variance. Measurements were highly reproducible at the individual sites. Between sites, the CV was 16% for ATP, 35% for DPG, 2% for total haemoglobin and 54% for haemolysis. For ATP and total haemoglobin, 94 and 80% of the variance in measurements was contributed by differences between sites, and more than 80% of the variance for DPG and haemolysis measurements came from markedly discordant results from three sites and one site, respectively. In descending order, mathematical errors, unvalidated analytical methods, a lack of shared standards and fluid handling errors contributed to the variability in measurements from different sites. While the methods used by laboratories engaged in RBC storage system clinical trials demonstrated good precision, differences in results between laboratories may hinder comparative analysis. Efforts to improve performance should focus on developing robust methods, especially for measuring RBC ATP.
Iron deficiency anaemia -a risk factor for febrile seizures in children

International Nuclear Information System (INIS)

Sherjil, A.; Saeed, Z.U.; Shehzad, S.; Amjad, R.

2010-01-01

Background: Iron deficiency anaemia and febrile seizures are two common diseases in children worldwide as well as in our country. Iron insufficiency is known to cause neurological symptoms like behavioural changes, poor attention span and learning deficits in children. Therefore, it may also be associated with other neurological disturbances like febrile seizures in children. Objective of our case-control study was to find association between iron deficiency anaemia and febrile seizures in children. Methods: This multicentre study was conducted in Department of Paediatrics HIT Hospital Taxila Cantt, Department of Paediatrics CMH Mangla and Department of Paediatrics POF Hospital Wah Cantt, from June 2008 to June 2010. Three hundred and ten children aged between 6 months to 6 years were included in the study. One hundred and fifty-seven children who presented with febrile seizures were our cases, while, 153 children who presented with febrile illnesses without seizures were recruited as controls. All patients were assessed for iron deficiency anaemia by measuring haemoglobin level, serum ferritin level, Mean Corpuscular Haemoglobin Concentration (MCHC) and Mean Corpuscular Volume (MCV). Patients with iron deficiency anaemia amongst controls and cases were documented. Percentages and Odds ratio were derived from the collected data. Results: 31.85% of cases (50 out of 157) had iron deficiency anaemia whereas, 19.6% of controls (30 out of 153) were found to have iron deficiency anaemia as revealed by low levels of haemoglobin level, serum ferritin level, Mean Corpuscular Haemoglobin Concentration and Mean Corpuscular Volume. Odds ratio was 1.93. Conclusion: Patients with febrile seizures are 1.93 times more likely to have iron deficiency anaemia compared to febrile patients without seizures. (author)
Faktor determinan produktivitas kerja pada pekerja wanita

Directory of Open Access Journals (Sweden)

Suci Widiastuti

2016-12-01

Full Text Available Background: Participations of women in economy activities is not the new phenomenon in Indonesia. Every years total of female workers increase. However, health or nutrition status of female workers haven’t gotten a good attention. This is can effect on lower productivity of female workers than male workers. Objective :This study was aimed to identify determinant factors of work productivity in female workers. Method: This study was an analytical study with cross sectional design. The selection of 40 subjects was performed by simple random sampling method. Data on energy intake was obtained from 3x24 hours food recall form. Body Mass Index (BMI was measured with anthropometric method. Percentage body fat was measured by Bioelectric Impedance Analyzer (BIA. Haemoglobin was obtained from cyanmethemoglobin method, and data of work productivity was obtained by the comparison of sarong total that weaved succesfully by female workers during 5 work days with company target on time mentioned. The data analyzed with Shapiro wilk, rank spearman, and double linier regression. Result: Most of subjects (45% were deficiency of energy intake. Total of 37,5% subjects were underweight. More than half of subjects (70% were classified as normal percentage body fat. Total of 37,5% subjects were anemia, and 35% subjects were not productive. There were correlation between energy intake, percent body fat, BMI and haemoglobin with work productivity (p= 0,016; p= 0,013; p= 0,043; p= 0,000. The most correlation variable with work productivity in female workers was haemoglobin (adjusted R2 = 0,348. Conclusion: Haemoglobin had the most correlation with work productivity in female workers.
Breed-Specific Haematologic Reference Values in Adult Turkeys (Meleagris gallopavo in the Humid Tropics of Nigeria

Directory of Open Access Journals (Sweden)

Daniel-Igwe G.

2017-03-01

Full Text Available One hundred (50 males and 50 females B-not strain indigenous turkeys, Meleagris gallopavo, were used to determine the reference values for their haematological parameters. The turkeys were housed in the poultry unit and jugular venepunctures were used to collect their blood. The haematological parameters were determined using standard procedures. The mean values of: the packed cell volume (PCV; 37.29 ± 0.37 %, red blood cell (RBC counts (2.50 ± 0.44 × 106.µl−1, haemoglobin concentration (Hbc; 10.89 ± 0.34 g.dl−1, mean corpuscular volume (MCV; 150.63 ± 0.73 fl, mean corpuscular haemoglobin (MCH; 44.29 ± 1.78 pg, mean corpuscular haemoglobin concentration (MCHC; 29.10 ± 0.73 g.dl−1, and white blood cell (WBC counts (12.41 ± 0.83 × 103 µl−1 were determined. No significant differences were found between the male and female B-not strain turkeys in this study. The results will help in the interpretation of cases of disease when there are variations in the values and serve as baseline data for B-not strain of turkeys in the humid tropics.
Source separation on hyperspectral cube applied to dermatology

Science.gov (United States)

Mitra, J.; Jolivot, R.; Vabres, P.; Marzani, F. S.

2010-03-01

This paper proposes a method of quantification of the components underlying the human skin that are supposed to be responsible for the effective reflectance spectrum of the skin over the visible wavelength. The method is based on independent component analysis assuming that the epidermal melanin and the dermal haemoglobin absorbance spectra are independent of each other. The method extracts the source spectra that correspond to the ideal absorbance spectra of melanin and haemoglobin. The noisy melanin spectrum is fixed using a polynomial fit and the quantifications associated with it are reestimated. The results produce feasible quantifications of each source component in the examined skin patch.
Use of lupin, Lupinus perennis, mango, Mangifera indica, and stinging nettle, Urtica dioica, as feed additives to prevent Aeromonas hydrophila infection in rainbow trout, Oncorhynchus mykiss (Walbaum).

Science.gov (United States)

Awad, E; Austin, B

2010-05-01

Feeding rainbow trout, Oncorhynchus mykiss (Walbaum), with 1% lupin, Lupinus perennis, mango, Mangifera indica, or stinging nettle, Urtica dioica, for 14 days led to reductions in mortality after challenge with Aeromonas hydrophila. In addition, there was significant enhancement in serum bactericidal activity, respiratory burst and lysozyme activity in the treatment groups compared to the controls. Use of lupin and mango led to the highest number of red blood and white blood cells in recipient fish, with use of stinging nettle leading to the highest haematocrit and haemoglobin values; the highest value of mean corpuscular volume and haemoglobin was in the control groups and those fed with stinging nettle.
Prevalencia de los marcadores serológicos de hepatitis viral B y C en retardados mentales

Directory of Open Access Journals (Sweden)

Georgina Ma. Suárez Mendoza

1998-12-01

Full Text Available Se estudiaron 200 pacientes retrasados mentales del Hospital "La Castellana", a los cuales se les determinaron los marcadores serológicos: antígeno de superficie para el virus de la hepatitis B y anticuerpo para el virus de la hepatitis C, donde se encontró una seroprevalencia para el VHB de un 5 % y de un 17 % para el VHC; se comprueba que los pacientes con un régimen interno, con mayor tiempo de institucionalización y con enfermedades crónicas no transmisibles son más susceptibles a adquirir estos virusSUMMARY: 200 mentally retarded patients from «La Castellana» Hospital were studied. The following serological markers were determined: hepatitis B surface antigen and hepatitis C antibody. A seroprevalence of hepatitis B and C of 5 % and 17 %, respectively, was found. It was proved that interned patients with longer length of institutionalization and with non-communicable chronic diseases are more susceptible to get these viruses
A road to practical dielectric elastomer actuators based robotics and mechatronics: discrete actuation

Science.gov (United States)

Plante, Jean-Sébastien; Devita, Lauren M.; Dubowsky, Steven

2007-04-01

Fundamental studies of Dielectric Elastomer Actuators (DEAs) using viscoelastic materials such as VHB 4905/4910 from 3M showed significant advantages at high stretch rates. The film's viscous forces increase actuator life and the short power-on times minimize energy losses through current leakage. This paper presents a design paradigm that exploits these fundamental properties of DEAs called discrete actuation. Discrete actuation uses DEAs at high stretch rates to change the states of robotic or mechatronic systems in discrete steps. Each state of the system is stable and can be maintained without actuator power. Discrete actuation can be used in robotic and mechatronic applications such as manipulation and locomotion. The resolution of such systems increases with the number of discrete states, 10 to 100 being sufficient for many applications. An MRI-guided needle positioning device for cancer treatments and a space exploration robot using hopping for locomotion are presented as examples of this concept.
C-M diagram and luminosity function of the Galactic globular cluster NGC 7099. I. Photographic photometry

International Nuclear Information System (INIS)

Piotto, G.; Rosino, L.; Capaccioli, M.; Ortolani, S.; Alcaino, G.; Osservatorio Astronomico, Padua, Italy; Ministerio de Educacion de Chile, Instituto Isaac Newton, Santiago)

1987-01-01

New photographic photometry of about 4400 stars in the field of the Galactic globular cluster NGC 7099 = M30 is presented. A C-M diagram and a luminosity function are obtained from this photometry. The distance modulus is estimated at 14.5 + or - 0.5 assuming V(HB) = 15.11 + or - 0.10 and E(B-V) = 0.03 + or - 0.03. The metallicity is (Fe/H) = 1.9 + or - 0.3 based on the dereddened color index (B-V)0,g = 0.71 + or - 0.03. The theoretical isochrones of VandenBerg and Bell (1985) give a better fit to the observations assuming (Fe/H) = -1.8, (m-M)V = 14.6, and E(B-V) = 0.02. A fair fit is also obtained using isochrones of low iron content with an oxygen enhancement of 0.7. From the fit, an age of 17 + or - 4 Gyr is deduced. 41 references
Haematological, Biochemical and Antioxidant Changes in Wistar Rats Exposed to Dichlorvos Based Insecticide Formulation Used in Southeast Nigeria

Directory of Open Access Journals (Sweden)

Kingsley C. Kanu

2016-11-01

Full Text Available The indiscriminate use of pesticide is a treat to non-target organisms. This study evaluates the haematological and biochemical changes induced by inhalation of local Nigerian dichlorvos insecticide on rats. The rats were randomly assigned to a control group which received only food and water and a test group which, in addition to food and water, was exposed to the pesticide for a period of 4 h daily for 28 days, after which exposure was discontinued for seven days. Five animals were sacrificed from each group on days 1, 7, 14, 21, 28 and 35, and blood was collected by cardiac puncture for haematological, biochemical and antioxidant analysis. Results obtained showed lowered values of red blood cell count (RBC, packed cell volume (PCV, haemoglobin, mean cell haemoglobin (MCH and mean cell haemoglobin concentration (MCHC (p < 0.05 with increased white blood cell count (WBC and platelet counts after day 14 when compared to the control group. Liver enzymes aspartate amino transaminase (AST and alanine amino transaminase (ALT were higher in the exposed rats compared to the control group (p < 0.05. Urea and creatinine concentrations increased significantly after day 1 and at day 28, while superoxide dismutase (SOD, gluthathione (GSH and catalase (CAT activity increased significantly compared to the control after day 1, day 14 and day 21, respectively. The RBC, PCV and haemoglobin values of all exposed rats were restored to normal following withdrawal of the pesticide, though AST, ALT, urea, creatinine and, glutathione values remained significantly high compared to the control. Inhalation of the local insecticide is toxic to the blood, liver and kidney of laboratory rats and may be deleterious to human health following long-term exposure.
Efficacy of iron fortification compared to iron supplementation among Vietnamese schoolchildren.

Science.gov (United States)

Thi Le, Huong; Brouwer, Inge D; Burema, Jan; Nguyen, Khan Cong; Kok, Frans J

2006-12-05

The effect of iron fortification is generally assumed to be less than iron supplementation; however, the magnitude of difference in effects is not known. The present study aims to compare the efficacy of these two strategies on anaemia and iron status. After screening on low Hb, 425 anaemic children in six primary schools in Tam Nong district of Phu Tho province were included in a randomized, placebo-controlled trial comparing two groups receiving iron fortified instant noodles or iron supplementation for 6 months and a control group, with children in all groups having been dewormed. Blood samples were collected before and after intervention for haemoglobin, serum ferritin (SF), serum transferrin receptor (TfR), C-reactive protein (CRP), and haemoglobinopathies analysis. Regression analysis was used to assess the effect of iron fortification and iron supplementation on haemoglobin concentration, SF, TfR, body iron, and anaemic status as outcome variables. The improvement of haemoglobin, SF, and body iron level in the group receiving iron fortification was 42% (2.6 g/L versus 6.2 g/L), 20% (23.5 microg/L versus 117.3 microg/L), and 31.3% (1.4 mg/kg versus 4.4 mg/kg) of that in the iron supplementation group. The prevalence of anaemia dropped to 15.1% in the control group, with an additional reduction of anaemia of 8.5% in the iron supplementation group. The additional reduction due to iron fortification was 5.4%, which amounts to well over 50% of the impact of supplementation. In conclusion, the efficacy of iron fortification based on reduction of prevalence of anaemia, and on the change in haemoglobin level, is about half of the maximum impact of supplementation in case of optimal compliance. Thus, in a population of anaemic children with mild iron deficiency, iron fortification should be the preferred strategy to combat anaemia.
Role of Local Infiltration of Tranexamic Acid in Reducing Blood Loss in Peritrochanteric Fracture Surgery in the Elderly Population

Directory of Open Access Journals (Sweden)

Virani SR

2016-11-01

Full Text Available Introduction: Peritrochanteric fractures are common injuries occurring in elderly patients. Surgeries for these fractures are associated with significant blood loss. Intravenous tranexamic acid has a proven track record in many orthopaedic surgeries including trauma, arthroplasty and spine surgeries. Objective: To study the effect of local subfascial and intramuscular infiltration of tranexamic acid in reducing blood loss and the requirement for blood transfusion in intertrochanteric fracture surgery. Study Design: Single centre prospective analytical study. Materials and Methods: One hundred and thirty seven patients above 65 years of age were included in the study, divided into two groups: the intervention group received subfascial and intramuscular infiltration of 2g tranexamic acid before wound closure and the control group of alternate patients did not receive any tranexamic acid infiltration. The postoperative drain output was recorded, as well as the haemoglobin level and the patients needing blood transfusion. Results and Conclusions: The preoperative and postoperative haemoglobin values were recorded. The mean preoperative haemoglobin was 10.9% and 10.8% (p=0.79 in the trial and control groups respectively. The mean postoperative haemoglobin was 9.5gm% and 9.2gm% (p=0.36 in the two groups. The total postoperative blood loss in the tranexamic acid group and the control group was 190.3ml and 204.3ml respectively (p=0.25. Ten patients (14.9% in the intervention group and 12 patients (17.1% in the control group required blood transfusion. We conclude that tranexamic acid does not play a significant role in reducing postoperative blood loss and blood transfusion when used locally in peritochanteric fracture surgery. However a larger double blinded study comparing various modalities of use of tranexamic acid is needed to conclusively establish its role.

FACTORS AFFECTING VARIABILITY OF RESISTANCE IN GAROLE SHEEP NATURALLY INFECTED WITH HAEMONCHUS CONTORTUS

Directory of Open Access Journals (Sweden)

Manoranjan Roy

2013-06-01

Full Text Available Resistance status against natural infection to Haemonchus contortus as well as influence of season, sex, body weight, and haemoglobin type on resistance levels were evaluated in 309 numbers of Garole sheep. In adult Garole sheep, egg per gram(EPG of faeces for Haemonchus contortus was varied from 300 to 1600, but overall EPG in Garole have been recorded as 829.96 ± 20.60. The effects of season, sex, and body weight and haemoglobin type on EPG were all found to be highly significant (P < 0.01. EPG count was highest during monsoon (986.27 ± 28.26, followed by summer (832.88 ± 28.26 and lowest during winter (670.74 ± 28.26 which indicated the existence of a seasonal variation of EPG. Rams had higher EPG (954.32 ± 57.93 than ewes (705.60 ± 45.79 which reflected that males appeared to be more susceptible to Haemonchus contortus infection compared to females. Animals with lower body weight (upto 10 kg showed higher EPG (1017.20 ± 54.82, then the infection level decreased as body weight increased (886.79 ± 56.23 for 10 kg to 12 kg and 737.18 ± 50.29 for 12 kg to 14 kg and lowest EPG was recorded in animals with above 14 kg body weight (678.68 ± 54.49. This study reveals Hb-BB type animals had higher EPG count (983.81 ± 18.22 in comparison to Hb-AB type animals (676.12 ± 33.96 indicating that Haemoglobin-A locus has some relation with resistance. From our study it can be concluded that resistant level of Garole sheep against Haemonchus contortus is influenced by some intrinsic factors like sex, body weight, and haemoglobin type of the sheep and also by extrinsic factor like season.
Effect of petroleum products inhalation on some haematological indices of fuel attendants in Calabar metropolis, Nigeria.

Science.gov (United States)

Okoro, A M; Ani, E J; Ibu, J O; Akpogomeh, B A

2006-01-01

The Haematotoxic implications of exposure to petroleum fumes through inhalation in human subjects were investigated. A total of 400 subjects (200 males and 200 females) aged between 18-30 years participated. Each gender was further categorized into two groups of 100 each for control and test, respectively. The test group was again subdivided into test 1 (T1) and test 2 (T2) in both sexes. T1 subjects were exposed to petroleum fumes for two years and below while T2 subjects were exposed for more than two years. Samples of blood were collected daily and subjected to haematological analysis. The results obtained showed that in males and females, red blood cell counts (10(6) /mm3) was significantly [P < 0.001] decreased in T1 (4.4 +/- 0.13) and T2 (3.85 +/- 0.07) compared to control (4.76 +/- 0.01). White blood cell counts, haematocrit, haemoglobin concentration and mean corpusclular haemoglobin concentration (MCHC) were significantly [P < 0.01] decreased in both sexes of test groups when compared with control. There was also a significant [P < 0.001] decrease in mean corpuscular haemoglobin (MCH) and mean corpuscular volume (MCV) in test 2 males compared with control. Most subjects exposed for longer than two years (T2) had significantly [P < 0.001] lower values of red blood cell count, haemoglobin concentration and haematocrit than those exposed for less than two years. The odds/odds ratio that a subject would become anaemic progressively rose from less than 1 in the control to greater than 1 or infinity on exposure to petroleum fumes. These results indicate that the petroleum fumes cause a reduction in haematological indices which worsens with prolonged exposure.
Night-shift work is associated with poorer glycaemic control in patients with type 2 diabetes.

Science.gov (United States)

Manodpitipong, Areesa; Saetung, Sunee; Nimitphong, Hataikarn; Siwasaranond, Nantaporn; Wongphan, Thanawat; Sornsiriwong, Chotima; Luckanajantachote, Pranee; Mangjit, Prasitchai; Keesukphan, Prasit; Crowley, Stephanie J; Hood, Megan M; Reutrakul, Sirimon

2017-12-01

The circadian system plays a role in regulating metabolism. Night-shift work, a form of circadian misalignment, is associated with increased type 2 diabetes risk. This study aimed to determine if night-shift workers with type 2 diabetes experience poorer glycaemic control than non-shift workers. Patients with type 2 diabetes (104 unemployed, 85 day workers and 60 night-shift workers) participated. Sleep duration, sleep quality, morningness-eveningness preference, depressive symptoms and dietary intake were assessed using standardized questionnaires. Haemoglobin A1c levels were measured. Night-shift workers had significantly higher haemoglobin A1c levels compared with others, while there were no differences between day workers and unemployed participants (median 7.86% versus 7.24% versus 7.09%, respectively). Additionally, night-shift workers were younger, had a higher body mass index, and consumed more daily calories than others. Among night-shift workers, there were no significant differences in haemoglobin A1c levels between those performing rotating versus non-rotating shifts (P = 0.856), or those with clockwise versus counterclockwise shift rotation (P = 0.833). After adjusting for age, body mass index, insulin use, sleep duration, morningness-eveningness preference and percentage of daily intake from carbohydrates, night-shift work, compared with day work, was associated with significantly higher haemoglobin A1c (B = 0.059, P = 0.044), while there were no differences between unemployed participants and day workers (B = 0.016, P = 0.572). In summary, night-shift work is associated with poorer glycaemic control in patients with type 2 diabetes. © The Authors. Journal of Sleep Research published by John Wiley & Sons Ltd on behalf of European Sleep Research Society.
Impact of placental Plasmodium falciparum malaria on the profile of some oxidative stress biomarkers in women living in Yaoundé, Cameroon.

Directory of Open Access Journals (Sweden)

Rosette Megnekou

Full Text Available Impact of the pathophysiology of Plasmodium falciparum placental malaria (PM on the profile of some oxidative stress biomarkers and their relationship with poor pregnancy outcomes in women remain unknown.Between 2013 and 2014, peripheral blood and placenta tissue from 120 Cameroonian women at delivery were assessed for maternal haemoglobin and, parasitaemia respectively. Parasite accumulation in the placenta was investigated histologically. The levels of oxidative stress biomarkers Malondialdehyde (MDA, Nitric Oxide (NO, Superoxide dismutase (SOD, Catalase (CAT and Gluthatione (GSH in the supernatant of teased placenta tissues were determined by Colorimetric enzymatic assays.Parasitaemia was inversely related to haemoglobin levels and birth weight (P <0.001 and 0.012, respectively. The level of lipid peroxide product (MDA was significantly higher in the malaria infected (P = 0.0047 and anaemic (P = 0.024 women compared to their non-infected and non-anaemic counterparts, respectively. A similar trend was observed with SOD levels, though not significant. The levels of MDA also correlated positively with parasitaemia (P = 0.0024 but negatively with haemoglobin levels (P = 0.002. There was no association between parasitaemia, haemoglobin level and the other oxidative stress biomarkers. From histological studies, levels of MDA associated positively and significantly with placenta malaria infection and the presence of malaria pigments. The levels of SOD, NO and CAT increased with decreasing leukocyte accumulation in the intervillous space. Baby birth weight increased significantly with SOD and CAT levels, but decreased with levels of GSH.Placental P. falciparum infection may cause oxidative stress of the placenta tissue with MDA as a potential biomarker of PM, which alongside GSH could lead to poor pregnancy outcomes (anaemia and low birth weight. This finding contributes to the understanding of the pathophysiology of P. falciparum placental malaria
Blood biochemical changes in lambs infected with normal and gamma irradiated third stage larvae of Dictyocaulus filaria

Energy Technology Data Exchange (ETDEWEB)

Bhat, T.K.; Dhar, D.N.; Bansal, G.C.; Sharma, R.L. (Indian Veterinary Research Inst., Srinagar (India). Regional Centre)

1984-09-01

Primary infections with normal third stage larvae of Dictyocaulus filaria at a dose of 150 1/kg caused significant decrease in the levels of haemoglobin, blood glucose, serum total proteins, serum albumin, albumin/globulin ratio and increase in levels of total globulins and lactate dehydrogenase (LDH) activity in lambs. Almost similar changes in the above blood constituents excepting for haemoglobin, blood glucose and LDH activity were noticed in lambs immunised with two doses of gamma irradiation larvae and subsequently challenged with normal larvae of D. filaria at a dose of 150 1/kg. In both the infected groups, serum calcium, inorganic phosphorus, malate dehydrogenase and alkaline phosphatase activities were, however, not affected.
Stress Response to Long Distance Transportation of Common Carp (Cyprinus carpio L.

Directory of Open Access Journals (Sweden)

R. Dobšíková

2006-01-01

Full Text Available The stress responses and changes in biochemical and haematological indices were investigated in three-year-old common carp (Cyprinus carpio L. during a long-distance transportation in special truck tanks. Twelve-hour transportation caused a significant increase in ammonia (p < 0.01, mean corpuscular volume MCV (p < 0.01, metamyelocytes ( p < 0.05 and band neutrophils (p < 0.01, and a significant decrease in Cl- (p < 0.05, lactate (p < 0.05, ALT (p < 0.05 and ALP (p < 0.01 levels. The values of LDH (p < 0.01, AST (p < 0.05, CK (p < 0.01 and haematocrit PCV (p < 0.05 were also significantly influenced by the transportation, but no time-dependent relation was found. On the contrary, the levels of cortisol, glucose and total protein in the biochemical profile, and the values of erythrocyte count (RBC, haemoglobin (Hb, mean corpuscular haemoglobin (MCH, mean corpuscular haemoglobin concentration (MCHC, leukocyte counts (WBC and leukogram (except for metamyelocytes and band neutrophils in the haematological profile were not significantly influenced by the transportation. Results showed that pre-transport fish manipulation (hauling, netting, handling, loading was found to be an important stressor for fish. Long-distance transportation itself was relatively considerate for the common carp tested.
Effects of Aqueous Root Bark Extracts of Anogeissusleiocarpus (DC Guill&Perrand TerminaliaavicennioidesGuill&Perr on Redox and Haematological Parameters of Diethylnitrosamine-Administered Rats

Directory of Open Access Journals (Sweden)

Amadu Kayode Salau

2015-11-01

Full Text Available Background: This study investigated the protective effects of aqueous extracts of Anogeissusleiocarpus (DC Guill&Perr (family: Combretaceae and Terminaliaavicennioides Guill&Perr (family: Combretaceae root barks, as well as their 1:1 (w/w mixture on liver redox and haematological parameters of diethylnitrosamine-treated rats. Methods: Rats were orally administered distilled water, diethylnitrosamine (30 mg/kg body weight once a week on weeks 3 and 4, curcumin (200 mg/kg body weight, extracts and 1:1 mixture (200, 400 and 800 mg/kg body weight for 4 weeks. Malondialdehyde, markers of oxidative stress and hematological indices were evaluated. Results: The extracts and their mixture significantly (P<0.05 reversed the diethylnitrosamine-induced alterations in the levels of liver malondialdehyde, superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase, glucose 6-phosphate dehydrogenase, glutathione, vitamin C and platelet counts. The other haematological parameters (red blood cell count, haemoglobin concentration, packed cell volume, mean corpuscular volume, mean corpuscular haemoglobin, mean corpuscular haemoglobin concentration, white blood cell count, lymphocyte count and neutrophil count were not affected by diethylnitrosamine and extracts. Conclusion: The extracts possess antioxidant, hepatoprotective and haemoprotective activities that compared well with curcumin. These activities were better exhibited by the mixture than the individual extracts.
Blood transfusion in patients having caesarean section: a prospective multicentre observational study of practice in three Pakistan hospitals.

Science.gov (United States)

Ismail, S; Siddiqui, S; Shafiq, F; Ishaq, M; Khan, S

2014-08-01

Increasing awareness of the risks of blood transfusion has prompted examination of red cell transfusion practice in obstetrics. A six-month prospective observational study was performed to examine blood transfusion practices in patients undergoing caesarean delivery at three hospitals in Pakistan. In the three hospitals (two private, one public) 3438 caesarean deliveries were performed in the study period. Data were collected on patient demographics, indications for transfusion, ordering physicians, consent, associations with obstetric factors, estimated allowable blood loss, calculated blood loss, pre- and post-transfusion haemoglobin and discharge haemoglobin. A total number of 397 (11.5%) patients who underwent caesarean section received a blood transfusion. The highest transfusion rate of 16% was recorded in the public tertiary care hospital compared to 5% in the two private hospitals. Emergency caesarean delivery and multiparity were associated with blood transfusion (Ptransfusion in 98% of cases. In 343 (86%) patients, blood transfusion was given even when the haemoglobin was >7g/dL. The method for documenting the indication or consent for transfusion was not found in any of the three hospitals. Blood transfusion was prescribed more readily in the public hospital. Identification of a transfusion trigger and the development of institutional guidelines to reduce unnecessary transfusion are required. Copyright © 2014 Elsevier Ltd. All rights reserved.
Haemolytic anaemia and acute pancreatitis associated with zinc toxicosis in a dog.

Science.gov (United States)

Blundell, R; Adam, F

2013-01-05

We describe a case of zinc toxicity in a 14-month-old, female, neutered, Cavalier King Charles spaniel with a 48-hour history of haematochezia, icterus and collapse. Regenerative anaemia with a packed-cell volume of 7 per cent was seen. Prior to referral, radiography had revealed a gastric, metallic foreign body which was removed at exploratory laparotomy. On presentation, the dog was comatose, hypothermic and bradycardic - resuscitation was performed successfully, but the dog then displayed marked abdominal pain. The dog died 12 hours after presentation. At postmortem examination, the animal showed severe icterus. Both kidneys were diffusely dark red; the pancreas was diffusely pale and nodular. Histopathological examination revealed evidence of intravascular haemolysis with blood vessel lumens containing haemoglobin. The renal tubules also contained large amounts of intraluminal haemoglobin with haemoglobin crystals scattered throughout the cortex and medulla. The pancreas exhibited multifocal coagulative necrosis, surrounded by a neutrophil-dominated inflammatory infiltrate. Zinc levels were markedly increased above the normal reference range in both liver and kidney. This report describes the clinical and pathological findings of a case of acute zinc toxicity in a dog following ingestion of a metallic object which resulted in marked haemolytic anaemia and acute pancreatitis.
Intravenous iron sucrose therapy for moderate to severe anaemia in pregnancy.

Science.gov (United States)

Kriplani, Alka; Mahey, Reeta; Dash, Biswa Bhusan; Kulshreshta, Vidushi; Agarwal, Nutan; Bhatla, Neerja

2013-01-01

Iron deficiency anaemia (IDA) is the most common nutritional deficiency in pregnancy. Prophylactic oral iron is recommended during pregnancy to meet the increased requirement. In India, women become pregnant with low baseline haemoglobin level resulting in high incidence of moderate to severe anaemia in pregnancy where oral iron therapy cannot meet the requirement. Pregnant women with moderate anaemia are to be treated with parentral iron therapy. This study was undertaken to evaluate the response and effect of intravenous iron sucrose complex (ISC) given to pregnant women with IDA. A prospective study was conducted (June 2009 to June 2011) in the department of Obstetrics & Gynecology, All India Institute of Medical Sciences, New Delhi. One hundred pregnant women with haemoglobin between 5-9 g% with diagnosed iron deficiency attending antenatal clinic were given intravenous iron sucrose complex in a dose of 200 mg twice weekly schedule after calculating the dose requirement. The mean haemoglobin raised from 7.63 ± 0.61 to 11.20 ± 0.73 g% (Panaemia. Intravenous iron sucrose can be used in hospital settings and tertiary urban hospitals where it can replace intramuscular therapy due to injection related side effects. Further, long-term comparative studies are required to recommend its use at peripheral level.
A preliminary study of placental umbilical cord whole blood transfusion in under resourced patients with malaria in the background of anaemia.

Science.gov (United States)

Bhattacharya, Niranjan

2006-03-23

Malaria is an annual killer of over one million people globally and its essential co-morbidity is anaemia. Cord blood, because of its rich mix of foetal and adult haemoglobin, high platelet and WBC counts, hypo-antigenic nature, altered metabolic profile and high affinity for oxygen as well as its anti-malarial effect, is an ideal choice in malaria with anaemia, necessitating blood transfusion. This paper presents an alternative protocol for fresh whole blood/packed cell transfusion from the hospital's biological waste resources, i.e., the placenta, after the birth of a healthy baby from a healthy mother. This collected blood was routinely transfused to patients admitted in our hospital with severe anaemia in the background of confirmed malaria. 94 units of placental umbilical cord whole blood were collected after lower uterine caesarean section (LUCS) from consenting mothers (from 1st April 1999 to April 2005), and safely transfused to 39 informed, consenting patients (age varying from 8 to 72 years). The collected volume of cord blood from each placenta (Unit) varied from 52 ml to 143 ml, with a mean packed cell volume of 48.9 +/- 4.1 SD and a mean haemoglobin concentration of 16.4 Gm percent +/- 1.6 Gm percent SD. The blood was immediately transfused after following the standard adult blood transfusion protocol of screening and cross-matching between the donor and the recipient. On occasion, the collected cord blood was preserved in the refrigerator, if no volunteer was readily available, and transfused within 72 hours of collection. Cord blood transfusion was tested on twenty two patients infected with Plasmodium falciparum and 17 patients with Plasmodium vivax. For inclusion in this study, the patient's plasma haemoglobin had to be 8 gm percent or less (the pre-transfusion haemoglobin in the malaria-infected patients in this series varied from 5.4 gm/dl to 7.9 gm/dl). The rise of haemoglobin within 72 hours of two units of freshly collected cord blood
A preliminary study of placental umbilical cord whole blood transfusion in under resourced patients with malaria in the background of anaemia

Directory of Open Access Journals (Sweden)

Bhattacharya Niranjan

2006-03-01

Full Text Available Abstract Background Malaria is an annual killer of over one million people globally and its essential co-morbidity is anaemia. Cord blood, because of its rich mix of foetal and adult haemoglobin, high platelet and WBC counts, hypo-antigenic nature, altered metabolic profile and high affinity for oxygen as well as its anti-malarial effect, is an ideal choice in malaria with anaemia, necessitating blood transfusion. Methods This paper presents an alternative protocol for fresh whole blood/packed cell transfusion from the hospital's biological waste resources, i.e., the placenta, after the birth of a healthy baby from a healthy mother. This collected blood was routinely transfused to patients admitted in our hospital with severe anaemia in the background of confirmed malaria. 94 units of placental umbilical cord whole blood were collected after lower uterine caesarean section (LUCS from consenting mothers (from 1st April 1999 to April 2005, and safely transfused to 39 informed, consenting patients (age varying from 8 to 72 years. The collected volume of cord blood from each placenta (Unit varied from 52 ml to 143 ml, with a mean packed cell volume of 48.9 ± 4.1 SD and a mean haemoglobin concentration of 16.4 Gm percent ± 1.6 Gm percent SD. The blood was immediately transfused after following the standard adult blood transfusion protocol of screening and cross-matching between the donor and the recipient. On occasion, the collected cord blood was preserved in the refrigerator, if no volunteer was readily available, and transfused within 72 hours of collection. Results Cord blood transfusion was tested on twenty two patients infected with Plasmodium falciparum and 17 patients with Plasmodium vivax. For inclusion in this study, the patient's plasma haemoglobin had to be 8 gm percent or less (the pre-transfusion haemoglobin in the malaria-infected patients in this series varied from 5.4 gm/dl to 7.9 gm/dl. The rise of haemoglobin within 72 hours of
Prepartum anaemia: prevention and treatment.

Science.gov (United States)

Milman, Nils

2008-12-01

This review focuses on the occurrence, prevention and treatment of anaemia during pregnancy in Western societies. Iron deficiency anaemia (IDA) is the most prevalent deficiency disorder and the most frequent form of anaemia in pregnant women. Minor causes of anaemia are folate and vitamin B12 deficiency, haemoglobinopathy and haemolytic anaemia. Anaemia is defined as haemoglobin of pregnancy. The prevalence of prepartum anaemia in the third trimester ranges 14-52% in women taking placebo and 0-25% in women taking iron supplements, dependent on the doses of iron. In studies incorporating serum ferritin, the frequency of IDA in placebo-treated women ranges 12-17% and in iron-supplemented women 0-3%. Requirements for absorbed iron increase during pregnancy from 0.8 mg/day in the first trimester to 7.5 mg/day in the third trimester, on the average approximately 4.4 mg/day, and dietary measures are inadequate to reduce the frequency of prepartum IDA. However, IDA is efficiently prevented by oral iron supplements in doses of 30-40 mg ferrous iron taken between meals from early pregnancy to delivery. Treatment of IDA should aim at replenishing body iron deficits by oral and/or intravenous administration of iron. In women with slight to moderate IDA, i.e. haemoglobin of 90-105 g/L, treatment with oral ferrous iron of approximately 100 mg/day between meals is the therapeutic option in the first and second trimester; haemoglobin should be checked after 2 weeks and provided an increase of >or=10 g/L, oral iron therapy has proved effective and should continue. Treatment with intravenous iron is superior to oral iron with respect to the haematological response. Intravenous iron is considered safe in the second and third trimester, while there is little experience in the first trimester. Intravenous iron of 600-1,200 mg should be considered: (1) as second option if oral iron fails to increase haemoglobin within 2 weeks; (2) as first option at profound IDA, i.e. haemoglobin of
impact of polyparasitism on the haemoglobin values of primary ...

African Journals Online (AJOL)

Rose

One goal might be to increase the density and strength of the material. ... The purpose of this study is to determine the spatial grain size distribution of a sintered metal. Since it is not ...... Segmentation of Grain Boundaries in WC-Co Cermets.
impact of polyparasitism on the haemoglobin values of primary ...

African Journals Online (AJOL)

Rose

The relationship between parasitic infections and development of anemia was investigated among pupils of ... typical rural community until recently when it was made the capital of Biase ..... Fundamental Diagnostic Haematology: Anaemia,.
Lack of association of glycated haemoglobin with blood pressure ...

African Journals Online (AJOL)

2013-04-12

Apr 12, 2013 ... Therefore, we examined the relationships of fasting glucose and glycated ... but factors that did associate significantly were age, male gender, rural location, abdominal obesity, alcohol intake .... in continuous variables were.
Reticulocyte haemoglobin content as a diagnostic tool for iron ...

African Journals Online (AJOL)

IDA) in ill children is complicated by the unreliability of serum ferritin (S-ferritin). The presence of a microcytic, hypochromic anaemia suggests IDA but is not specific. There is a need for a diagnostic test that will be accessible, cost-effective and ...
The impact of haemoglobin level and concomitant infections on ...

African Journals Online (AJOL)

... of paroxysm during Plasmodium infection. Likewise, the presence of concomitant infections in the clinically ill subjects quickened the on-set of clinical signs. The need for proper laboratory diagnosis to ascertain real cause/s of fever during malaria attack so as to avoid wrong treatment/under treatment, and balanced diet to ...
Evaluating point-of-care testing for glycosylated haemoglobin in ...

African Journals Online (AJOL)

In the SA public sector, random blood glucose is commonly ... R Mash,1 MB ChB, FCFP, FRCGP, PhD; A Ugoagwu,1 MB ChB, MMed; C Vos,1 MB ChB, MMed; M Rensburg,2 .... Data were entered into an Excel (Microsoft, USA) spreadsheet.
Langmuir and Langmuir–Blodgett films of capsules of haemoglobin ...

Indian Academy of Sciences (India)

Dynamic surface tension and the associated dilational and shear ... logy of the protein films spread in a Langmuir trough. In ..... ing effect of the lateral electrostatic repulsions, such ... formation did not alter the conformation of the protein.

Glycosylated haemoglobin is markedly elevated in new and known ...

African Journals Online (AJOL)

Mean HbA1c in known Type 1, known Type 2 and newly diagnosed diabetes patients were similarly ... of diabetes such as retinopathy, nephropathy and neuropathy [3]. ..... dilemma of HbA1c detection in presence of a haemoglobinopathy: A ...
WAJM 30 (1) 2011.CORRECTED Final.pmd

African Journals Online (AJOL)

user1

The complications reported during procedure and pregnancy was also reviewed. .... threatened abortion and parental haemoglobin .... shown to have a better outcome com- pared with the .... complicated by intrauterine growth retardation.
Digestive system complications among hospitalized children with ...

African Journals Online (AJOL)

USER

least common complication, occurring in one (3.3%) of the cases studied. Conclusion: Acute ... Keywords: Acute abdominal crisis, children, haemoglobin, hospitalization, multi-systemic ... improvement of the management of such children.
Multiple causes of anaemia amongst children living near a lead smelter in Brazil

Energy Technology Data Exchange (ETDEWEB)

Carvalho, F M; Barreto, M L; Silvany-Neto, A M; Waldron, H A; Tavares, T M

1984-04-05

A prevalence study of anaemia was carried out amongst children, aged one to nine years, living near a lead smelter in Santo Amaro City, Northeast Brazil. It was found that the variation in haemoglobin levels was significantly associated with malnutrition and with the interaction between malnutrition and iron deficiency, but not with lead poisoning, iron deficiency, or hookworm infection, having allowed for the effects of age, area of residence, family per capita income and race. The effect of the interaction between malnutrition and iron deficiency on haemoglobin levels was most prominent amongst children aged one year and amongst those living in the most deprived area. The lack of demonstrable interaction between lead poisoning and iron deficiency in the causation of anaemia amongst these children is discussed.
issue 1 2009.indb

African Journals Online (AJOL)

2009-03-18

Mar 18, 2009 ... on praziquantel cure rate, Schistosoma haematobium reinfection, and haematological ... by DBL-Institute for Health Research and Development,. Denmark. .... finger for haemoglobin analysis by the study nurse using a.
Research

African Journals Online (AJOL)

ebutamanya

2016-05-27

May 27, 2016 ... &Corresponding author: Freda Dzifa Intiful, Department of Nutrition and ... Haemoglobin levels, malaria infection and the practice of pica were assessed. .... regarding patient's background including ages, level of education,.
Synergistic effect of aqueous extract of Telfaria occidentalis on the ...

African Journals Online (AJOL)

EB

haematological parameters: haemoglobin level, red blood cells and white blood cells and packed cell volume were monitored ..... of potential drug-dietary supplement interactions in primary ... between Khaya grandifolia (WELW) CDC stem.
On characteristics of hematological indices of reptiles (Reptilia

Directory of Open Access Journals (Sweden)

V. Y. Gasso

2006-08-01

Full Text Available Content of the haemoglobin, erythrocytes, leucocytes and leukogram pattern in six reptile species of the central steppeDnieperregion are studied. Morphological features of the blood cells are described.
Dietary effect of rice milling waste and supplementary enzyme on ...

African Journals Online (AJOL)

USER

2013-08-21

Aug 21, 2013 ... Haematological values such as Haemoglobin concentration (Hb), mean cellular ... broiler starter diet without any adverse effect on growth performance of birds. ... Animal Science Teaching and Research Farm, University of.
Changes in haematology, plasma biochemistry and erythrocyte ...

African Journals Online (AJOL)

olayemitoyin

anaemia characterized by reduced values for packed cell volume (PCV), red blood cell count (RBC), haemoglobin (Hb) ... total white blood cell count, heterophil, lymphocyte and monocyte counts were ..... Theory, Analysis, and Correlation.
studies on in vitro evaluation of antidiabetic potentials

African Journals Online (AJOL)

userpc

Keywords: fruit peels, antidiabetic activity, α-amylase enzyme, glycosylated haemoglobin. INTRODUCTION ... absorption of starch into the body thereby .... room temperature for 72 hrs (Abirami et al.,. 2014). ... carbohydrate digestion. One of ...
Comprehensive analysis to explain reduced or increased SOD1 enzymatic activity in ALS patients and their relatives.

Science.gov (United States)

Keskin, Isil; Birve, Anna; Berdynski, Mariusz; Hjertkvist, Karin; Rofougaran, Reza; Nilsson, Torbjörn K; Glass, Jonathan D; Marklund, Stefan L; Andersen, Peter M

2017-08-01

To characterise stabilities in erythrocytes of mutant SOD1 proteins, compare SOD1 enzymatic activities between patients with different genetic causes of ALS and search for underlying causes of deviant SOD1 activities in individuals lacking SOD1 mutations. Blood samples from 4072 individuals, ALS patients with or without a SOD1 mutation, family members and controls were studied. Erythrocyte SOD1 enzymatic activities normalised to haemoglobin content were determined, and effects of haemoglobin disorders on dismutation assessed. Coding SOD1 sequences were analysed by Sanger sequencing, exon copy number variations by fragment length analysis and by TaqMan Assay. Of the 44 SOD1 mutations found, 75% caused severe destabilisation of the mutant protein but in 25% it was physically stable. Mutations producing structural changes caused halved erythrocyte SOD1 activities. There were no differences in SOD1 activities between patients without a SOD1 mutation and control individuals or carriers of TBK1 mutations and C9orf72 HRE . In the low and high SOD1 activity groups no deviations were found in exon copy numbers and intron gross structures. Thalassemias and iron deficiency were associated with increased SOD1 activity/haemoglobin ratios. Adjunct erythrocyte SOD1 activity analysis reliably signals destabilising SOD1 mutations including intronic mutations that are missed by exon sequencing.
Haematological parameters and recurrent aphthous stomatitis

International Nuclear Information System (INIS)

Khan, N. F.; Saeed, M.; Chaudhary, S.

2013-01-01

Objective: To find out the relationship between recurrent aphthous stomatitis (RAS) with deficiencies of haemoglobin, haematocrit, serum vitamin B12, serum Ferritin and red blood cells (RBC) Folate level. Study Design: An analytical cross-sectional study. Place and Duration of Study: Department of Oral Health Sciences, Shaikh Zayed Federal Postgraduate Medical Complex, Lahore, from February to July 2008. Methodology: Sixty consecutive subjects with active RAS were taken as the aphthous group; 60 age and gender matched subjects without RAS were as the Non-Aphthous group. Five milliliter blood was taken from both groups to evaluate the levels of serum B12, and RBC Folate through radio immuno assay and serum ferritin with enzyme linked immuno-sorbent assay tests. Complete blood count was carried out to determine the level of haemoglobin and haematocrit in both groups. Proportion of subjects with lower values was compared using 2 text of proportions with significance at p < 0.05. Results: Serum Ferritin (p = 0.001), haematocrit (p < 0.001), RBC Folate (p < 0.001) and serum B12 (p < 0.001) were significantly lower in the RAS group. Combined deficiency state (haemoglobin, serum Ferritin, haematocrit, RBC Folate and serum B12) was identified in 13% (n = 8) RAS patients. Conclusion: Frequency of haematinic deficiencies was high in RAS patients. Serum B12 and RBC Folate were significantly low in aphthous group. (author)
Feeding differently processed soya bean. Part 2. An assessment of haematological responses in the chicken.

Science.gov (United States)

Aletor, V A; Egberongbe, O

1992-01-01

The use of differently processed soya bean as a major source of dietary protein was evaluated in a haematological study using broiler chickens in which groundnut cake (GNC), raw soya bean (RSB), roasted soya bean (RtSB), cooked soya bean (CSB) and soya bean oil cake (SBC) were fed on equi-protein basis. The results showed that: 1. Red blood cell (RBC) count and haemoglobin content of blood significantly (P less than 0.05) increased in chicks fed RSB relative to the other soya bean diets. Feeding differently processed soya bean significantly (P less than 0.05) influenced mean cell haemoglobin (MCH) and mean corpuscular volume (MCV) while the mean corpuscular haemoglobin concentration (MCHC) was not significantly influenced. 2. Both the total white blood cell (WBC) count and the monocytes were significantly (P less than 0.05) influenced by the dietary treatments. Chicks fed processed soya bean generally had higher number of monocytes. 3. Physical properties determined were specific gravity and erythrocyte sedimentation rate. The latter was significantly (P less than 0.05) lower in all the processed soya bean-fed chicks. 4. Minerals determined in blood were Na, K, Ca, Mg, Fe, Cu and P. Of all these, chicks fed RSB had significantly (P less than 0.01) lower levels of blood Mg and marked decrease in Ca.
Scintigraphic follow-up of the effects of therapy with hydroxyurea on splenic function in patients with sickle cell disease

Energy Technology Data Exchange (ETDEWEB)

Santos, Allan [Division of Nuclear Medicine, Department of Radiology, Campinas State University (UNICAMP), Campinas (Brazil); Servico de Medicina Nuclear, Hospital das Clinicas da UNICAMP, Campina (Brazil); Pinheiro, Vitoria; Anjos, Ana Claudia; Brandalise, Silvia [Centro Infantil Domingos A. Boldrini, Campinas (Brazil); Fahel, Fernanda; Lima, Mariana; Etchebehere, Elba; Ramos, Celso; Camargo, Edwaldo E. [Division of Nuclear Medicine, Department of Radiology, Campinas State University (UNICAMP), Campinas (Brazil)

2002-04-01

Patients with sickle cell disease (SCD) may develop functional asplenia as a chronic complication, secondary to repeated episodes of polymerisation of haemoglobin S. It is known that increased plasma concentrations of fetal haemoglobin (HbF) reduce the polymerisation of haemoglobin S. Hydroxyurea is a chemotherapeutic agent capable of increasing HbF levels in the red blood cells and its use has recently been proposed in the treatment of SCD. The objective of this study was to evaluate the effects of long-term therapy with hydroxyurea on recovery of splenic function. Twenty-one patients (aged 3-22 years; 14 with SS haemoglobinopathy, 7 with S{beta}{sup 0} haemoglobinopathy) were studied with liver/spleen scintigraphy before and after 6 and 12 months of treatment. All studies were submitted to visual inspection and semi-quantitative analyses using spleen/liver ratios. Imaging prior to treatment demonstrated functional asplenia in nine SS patients and one S{beta}{sup 0} patient and impaired splenic function in five SS patients and six S{beta}{sup 0} patients. After treatment, splenic function improved in ten patients, remained unchanged in eight and worsened in three. Using liver/spleen imaging, it was possible to demonstrate that hydroxyurea is capable of improving splenic function in some SCD patients. Improvement is not always possible and frequently does not lead to a normal splenic function even after 1 year of treatment. (orig.)
Scintigraphic follow-up of the effects of therapy with hydroxyurea on splenic function in patients with sickle cell disease

International Nuclear Information System (INIS)

Santos, Allan; Pinheiro, Vitoria; Anjos, Ana Claudia; Brandalise, Silvia; Fahel, Fernanda; Lima, Mariana; Etchebehere, Elba; Ramos, Celso; Camargo, Edwaldo E.

2002-01-01

Patients with sickle cell disease (SCD) may develop functional asplenia as a chronic complication, secondary to repeated episodes of polymerisation of haemoglobin S. It is known that increased plasma concentrations of fetal haemoglobin (HbF) reduce the polymerisation of haemoglobin S. Hydroxyurea is a chemotherapeutic agent capable of increasing HbF levels in the red blood cells and its use has recently been proposed in the treatment of SCD. The objective of this study was to evaluate the effects of long-term therapy with hydroxyurea on recovery of splenic function. Twenty-one patients (aged 3-22 years; 14 with SS haemoglobinopathy, 7 with Sβ 0 haemoglobinopathy) were studied with liver/spleen scintigraphy before and after 6 and 12 months of treatment. All studies were submitted to visual inspection and semi-quantitative analyses using spleen/liver ratios. Imaging prior to treatment demonstrated functional asplenia in nine SS patients and one Sβ 0 patient and impaired splenic function in five SS patients and six Sβ 0 patients. After treatment, splenic function improved in ten patients, remained unchanged in eight and worsened in three. Using liver/spleen imaging, it was possible to demonstrate that hydroxyurea is capable of improving splenic function in some SCD patients. Improvement is not always possible and frequently does not lead to a normal splenic function even after 1 year of treatment. (orig.)
Haematological parameters in different african populations: an experience from united nations level 3 hospital

International Nuclear Information System (INIS)

Iftikhar, R.; Khan, N.U.; Iqbal, Z.; Anwar, M.I.

2017-01-01

To evaluate hematological parameters in African population to estimate normal reference intervals for these tests. Study Design: Cross sectional observational study. Place and Duration of Study: Department of Pathology, United Nations level 3 hospital, Nyala, Darfur from 1st Mar to 30th Dec 2014. Material and Methods: There were 396 healthy African male and female volunteers selected between 18-65 years of age, belonging to different countries. Fresh whole blood was used to measure haemoglobin (Hb) concentration, haematocrit (Hct), total red blood cell (TRBC) count, mean corpuscular volume (MCV), mean corpuscular haemoglobin (MCH), mean corpuscular haemoglobin concentration (MCHC), platelet count, total leucocyte count (TLC) and differential white blood cells count. Data were analysed using SPSS version 19. Results: Mean Hb of study group was 13.81 +- 1.99 g/dl. Mean TLC was 5.50 +- 1.96 x 103/ul. Mean lymphocyte count was 2.58 +- 0.95. Mean platelet count was 234 +- 92 x103 /ul. Mean values for Hb Concentration, TRBC, Hct Ratio, MCV, MCH and MCHC were all higher for African Males than Females; this difference was statistically significant (p<0.05). Conclusion: This multi-national African population based study confirms the variations in haematological parameters previously described in single nation African studies. The commonly observed variations in normal adults are low RBC indices, relative neutropenia and lymphocytosis. (author)
Candida spp. and gingivitis in children with nephrotic syndrome or type 1 diabetes.

Science.gov (United States)

Olczak-Kowalczyk, Dorota; Pyrżak, Beata; Dąbkowska, Maria; Pańczyk-Tomaszewska, Małgorzata; Miszkurka, Grażyna; Rogozińska, Izabela; Swoboda-Kopeć, Ewa; Gozdowski, Dariusz; Kalińska, Angelika; Piróg, Anna; Mizerska-Wasiak, Małgorzata; Roszkowska-Blaim, Maria

2015-05-08

Diabetes and Nephrotic syndrome (NS) promote plaque-related gingivitis and yeast-like fungal infections. The study assesses the impact of Candida spp. and general disease- or treatment-related factors on plaque-related gingivitis severity in children and adolescents with Nephrotic syndrome /diabetes. Body mass index (BMI), BMI standard deviation score, and oral cavity (Plaque Index--PLI, Gingival Index--GI, mucosa status, presence and Candida enzymatic activity) were assessed in 96 patients (32 with NS: 30- immunosuppressive treatment, 35--type 1 diabetes, and 29 generally healthy), aged; 3-18 years. Laboratory included cholesterol and triglyceride measurements; in diabetic subjects- glycated haemoglobin, in NS: total protein, albumin, creatinine, haemoglobin, haematocrit, white cell count, urinary protein excretion. Medical records supplied information on disease duration and treatment. A statistical analysis was performed; Kendall Tau coefficient, chi-square test, t-test, and multiple regression analysis ( P Gingivitis occurred more frequently in patients with NS/diabetes. Gingivitis severity was correlated with PLI, age, and yeast enzyme activity in NS--to with immunosuppressive treatment with >1 drug, drug doses, treatment duration, lipid disorders, and BMI; in diabetes, with blood glucose and glycated haemoglobin >8%. Poor hygiene control is the main cause of gingivitis. Gingivitis severity is most likely related to age, lipid disorders and increase in body mass. Candida spp., in uncompensated diabetes and in those using immunosuppressive treatment, might intensify plaque-related gingivitis.
Tissue oxygenation and haemodynamics measurement with spatially resolved NIRS

Science.gov (United States)

Zhang, Y.; Scopesi, F.; Serra, G.; Sun, J. W.; Rolfe, P.

2010-08-01

We describe the use of Near Infrared Spectroscopy (NIRS) for the non-invasive investigation of changes in haemodynamics and oxygenation of human peripheral tissues. The goal was to measure spatial variations of tissue NIRS oxygenation variables, namely deoxy-haemoglobin (HHb), oxy-haemoglobin (HbO2), total haemoglobin (HbT), and thereby to evaluate the responses of the peripheral circulation to imposed physiological challenges. We present a skinfat- muscle heterogeneous tissue model with varying fat thickness up to 15mm and a Monte Carlo simulation of photon transport within this model. The mean partial path length and the mean photon visit depth in the muscle layer were derived for different source-detector spacing. We constructed NIRS instrumentation comprising of light-emitting diodes (LED) as light sources at four wavelengths, 735nm, 760nm, 810nm and 850nm and sensitive photodiodes (PD) as the detectors. Source-detector spacing was varied to perform measurements at different depths within forearm tissue. Changes in chromophore concentration in response to venous and arterial occlusion were calculated using the modified Lambert-Beer Law. Studies in fat and thin volunteers indicated greater sensitivity in the thinner subjects for the tissue oxygenation measurement in the muscle layer. These results were consistent with those found using Monte Carlo simulation. Overall, the results of this investigation demonstrate the usefulness of the NIRS instrument for deriving spatial information from biological tissues.
THE EFFECT OF SINGLE NICKEL AND COMBINED NICKEL AND ZINC PERORAL ADMINISTRATION ON HAEMATOLOGICAL PARAMETERS IN RABBITS

Directory of Open Access Journals (Sweden)

Jana Emrichová

2013-06-01

Full Text Available The aim of this study was to determine the effect of single nickel (NiCl2 and nickel in combination with zinc (ZnCl2 on selected haematological parameters of rabbits: white blood cell, red blood cell, haemoglobin, haematocrit, mean corpuscular volume, mean corpuscular haemoglobin, mean corpuscular haemoglobin concentration, platelets, mean platelet volume, red cell distribution width, lymphocytes, monocytes, eosinophils, neutrophils, basophils. Twenty rabbits of broiler line Californian were used in this experiment. The animals were divided into the five groups, four animals in each ones (control group K and experimental groups E1, E2, E3 and E4. Animals were fed ad libitum using KKV1 feeding mixture (FM with or without nickel and zinc addition for 90 days follows: group E1 received 17.5 g of NiCl2.100 kg-1 FM; group E2 35 g NiCl2.100 kg-1 FM; group E3 17.5 g NiCl2 + 30 g ZnCl2.100 kg-1 FM and group E4 35 g NiCl2 + 30 g ZnCl2.100 kg-1 FM. The parameters were analysed using Advia – 120. Blood was collected into tubes containing anticoagulant agents K – EDTA. Statistical analyse showed a significant changes (P 0.05. Nickel has negative effect on some haematological parameters, but zinc can eliminates its influence.

Some links on this page may take you to non-federal websites. Their policies may differ from this site.