TED-Ed lessons & TED-Ed clubs: Educational activities to amplify students' voices
Villias, Georgios
2017-04-01
TED-Ed lessons and TED-Ed clubs are two powerful educational tools that can be used in today's school classrooms in order to create an educational environment that is engaging for the students and favors their active participation, created and fostered by TED-Ed. TED-Ed is TED's educational initiative, committed to create lessons worth sharing and amplify the voices and ideas of teachers and students around the world. TED-Ed animated lessons are fully organized lessons structured around an animated video that introduces new topics to learners in an exciting, thought-provoking way. These lessons have been created as a result of the cooperation between expert educators and animators and have been uploaded at the TED-Ed platform (http://ed.ted.com). On the other hand, TED-Ed Clubs are also an interesting way to offer students the chance, the voice and the opportunity to express their thoughts, engage actively on these matters and connect with each other, both at a local, as well as at an international level (http://ed.ted.com/clubs). By developing new TED-Ed lessons or by customizing appropriately existing animated TED-Ed lessons (translating, modifying the questions asked, introducing new discussion topics), I have created and implemented in my student-centered, didactic approach, a series of TED-ED animated lessons directly connected with the Greek national science syllabus that were used to spark students curiosity and initiate a further analytical discussion or introduce other relevant educational activities (http://gvillias.wixsite.com/education). Furthermore, at my school, we established Varvakeio TED-Ed Club, an environment that supports and empowers our students to research, develop and disseminate their own personal ideas that worth spreading. During the year, our members were inspired by watching TED talks presented by experts on their field on various different areas, including social, economical, environmental and technological-scientific issues. Our aim
Evans, Paula
2009-01-01
The author never worked "with" a boss before working with Ted at Brown University. She had always known of Ted--he was Dean at Harvard Graduate School of Education when she was a student there, just beginning her teaching career. Ted arrived at Brown University in September 1984. She was working at Brown in President Howard Swearer's…
Energy Technology Data Exchange (ETDEWEB)
NONE
2004-07-01
Cegibat, the information-recommendation agency of Gaz de France for building engineering professionals, has organized this third conference about the Dolce Vita products and services offer, created by Gaz de France for the residential sector with the aim to promote the use of natural gas for a better comfort and lower energy consumptions. This third meeting makes a status of the development of the Dolce Vita offer and of its evolutions: step status of the evolution of the Dolce Vita offer, experience feedback from professionals, partnerships and marketing tools, combined solar-gas solutions and condensation boilers: implementation in the Dolce Vita offer. (J.S.)
Baldwin, A; Wiley, E
2001-04-01
VitaResc (formerly Apex) is developing PHP-HT, pyridoxalated hemoglobin polyoxyethylene conjugate, for the potential treatment of nitric oxide-induced shock (characterized by hypotension), associated with various etiologies, initially in septic shock. A phase I safety study and an initial phase I/II patient trial for NO-induced shock have been completed, and VitaResc has enrolled patients in three of five planned cohorts in a continuation of these trials to include a protocol of continuous infusion and dose escalation [330680,349187,390918]. The results from the dose escalation trials are expected to provide the basis for a randomized, controlled phase II/III pivotal trial of PHP-HT [390918]. VitaResc has licensed PHP-HT exclusively from Ajinomoto for all indications, worldwide, except Japan [275263]. Ajinomoto originally developed the human derived and chemically modified hemoglobin preparation as a blood substitute, but no development has been reported by the company since 1997 [275277,303577]. The other potential indications of PHP-HT include shock associated with burns, pancreatitis, hemodialysis and cytokine therapies [275277]. VitaResc expects the annual market potential of PHP-HT to exceed 1 billion dollars [330680].
A Day in the Life at DaVita Academy
Weinstein, Margery
2010-01-01
When a company name means "giving life," the bar for learning and development programs is held high. In this article, the author describes what it takes to graduate from DaVita Academy, the soft skills training program dialysis services company DaVita offers all its employees. DaVita's chief executive officer, Kent Thiry, states that the Academy…
Brese, Falk, Ed.
2012-01-01
The Teacher Education Study in Mathematics (TEDS-M) International Database includes data for all questionnaires administered as part of the TEDS-M study. These consisted of questionnaires administered to future teachers, educators, and institutions with teacher preparation programs. This supplement contains the international version of the TEDS-M…
Brese, Falk, Ed.
2012-01-01
This supplement contains all adaptations made by countries to the international version of the TEDS-M questionnaires under careful supervision of and approval by the TEDS-M International Study Center at Michigan State University. This information provides users of the TEDS-M International Database with a guide to evaluate the availability of…
Exploring TED Talks as Linked Data for Education
Taibi, Davide; Chawla, Saniya; Dietze, Stefan; Marenzi, Ivana; Fetahu, Besnik
2015-01-01
In this paper, we present the TED Talks dataset which exposes all metadata and the actual transcripts of available TED talks as structured Linked Data. The TED talks collection is composed of more than 1800 talks, along with 35?000 transcripts in over 30 languages, related to a wide range of topics. In this regard, TED talks metadata available in…
A Fuzzy Control Course on the TED Server
DEFF Research Database (Denmark)
Dotoli, Mariagrazia; Jantzen, Jan
1999-01-01
, an educational server that serves as a learning central for students and professionals working with fuzzy logic. Through the server, TED offers an online course on fuzzy control. The course concerns automatic control of an inverted pendulum, with a focus on rule based control by means of fuzzy logic. A ball......The Training and Education Committee (TED) is a committee under ERUDIT, a Network of Excellence for fuzzy technology and uncertainty in Europe. The main objective of TED is to improve the training and educational possibilities for the nodes of ERUDIT. Since early 1999, TED has set up the TED server...
TED Talks as an Emergent Genre
Ludewig, Julia
2017-01-01
In her article "TED Talks as an Emergent Genre" Julia Ludewig analyzes TED talks—short, informational, and entertaining presentations that are given during TED conferences in North America and abroad—as a hybrid and emerging genre. Based on a qualitative interpretation of 14 such talks, she offers a list of recurring thematic, argumentative, and rhetorical features, which she aligns with three parent genres—the sales pitch, the memoir, and the academic lecture. Comparing recent versions of TE...
Energy Technology Data Exchange (ETDEWEB)
LITTENBERG, L.; RUBINSTEIN, R.; SAMIOS, N.; LI, K.; GIACOMELLI, G.; MOCKETT, P.; CARROLL, A.; JOHNSON, R.; BRYMAN, D.; TIPPENS, B.
2000-05-19
On the afternoon of May 19 2000, a Memorial Seminar was held in the BNL physics Large Seminar Room to honor the memory of Ted Kyeia, a prominent particle physicist who had been a member of the BNL staff for 40 years. Although it was understandably a somewhat sad occasion because Ted was no longer with us, nevertheless there was much for his colleagues and friends to celebrate in recalling the outstanding contributions that he had made in those four decades. The Seminar speakers were all people who had worked with Ted during that period; each discussed one aspect of his career, but also included anecdotes and personal reminiscences. This booklet contains the Seminar program, listing the speakers, and also copies of transparencies of the talks (and one paper which was a later expansion of a talk); sadly, not all of the personal remarks appeared on the transparencies.
International Nuclear Information System (INIS)
LITTENBERG, L.; RUBINSTEIN, R.; SAMIOS, N.; LI, K.; GIACOMELLI, G.; MOCKETT, P.; CARROLL, A.; JOHNSON, R.; BRYMAN, D.; TIPPENS, B.
2000-01-01
On the afternoon of May 19 2000, a Memorial Seminar was held in the BNL physics Large Seminar Room to honor the memory of Ted Kyeia, a prominent particle physicist who had been a member of the BNL staff for 40 years. Although it was understandably a somewhat sad occasion because Ted was no longer with us, nevertheless there was much for his colleagues and friends to celebrate in recalling the outstanding contributions that he had made in those four decades. The Seminar speakers were all people who had worked with Ted during that period; each discussed one aspect of his career, but also included anecdotes and personal reminiscences. This booklet contains the Seminar program, listing the speakers, and also copies of transparencies of the talks (and one paper which was a later expansion of a talk); sadly, not all of the personal remarks appeared on the transparencies
Speculations regarding the history of Donum Vitae.
Harvey, J C
1989-10-01
In March 1987, the Vatican published Instruction on Respect for Human Life in its Origin and on the Dignity of Procreation, also known as Donum Vitae. Prepared by the Roman Catholic Church's Congregation for the Doctrine of the Faith (CDF), Donum Vitae is intended as a magisterial teaching document that invites further reflection on the relationship between natural moral law and reproductive technologies such as in vitro fertilization. To aid it in its work, the CDF consulted anonymous religious and lay experts in the fields of moral theology, genetics, biology, medicine, and physiology. Harvey speculates on the history of Donum Vitae's preparation, particularly as to the identities of the individuals whom the CDF consulted. He raises the possibility of a biased consultation process, one that called upon moral theologians whose views would be known to support pre-established conclusions.
TED Talks and Leadership Education: Ideas Worth Sharing
Raffo, Deana M.
2016-01-01
TED Talks are short videos of experts talking about a variety of topics. This paper outlines six TED Talks that connect with the leadership literature and topics commonly taught with an explanation of how they enhance teaching about a corresponding leadership topic. The researcher shares how introducing TED talks related to leadership can…
Forcing gravitas / Vita Terauda
Terauda, Vita
2008-01-01
Läti Avaliku Poliitika Keskuse direktor Vita Terauda leiab, et Läti riigieelarve kulude vähendamine avalikus sektoris on pikaajalise mõjuga ning poliitikud ei tohiks otsuseid kulude vähendamise kohta vastu võtta nende tagajärgedele mõtlemata
[Do you know "Humanae Vitae"?].
Gakwaya, D
1993-04-01
This work, appearing on the 25th anniversary of "Humanae Vitae," describes the contents of the encyclical on family planning, summarizes reactions to it from western church leaders, and reflects on its relevance to modern societies. "Humanae Vitae" begins with a statement acknowledging the problems posed by population growth to societies and to individual families. Deteriorating conditions of housing and employment and increasing economic and educational inadequacies often make it difficult to raise large families in the modern world. Views of the role of women in society and of the value of marital love and the significance of the sex act in relation to marital love have undergone change. The document raised the question of whether it is time to entrust to couples greater responsibility in regulating their fertility. The document referred to the reasons why the Pope and the Church have the authority to answer such a question and described the care with which the document was prepared before moving to the second major part of the article, that concerning doctrinal principles. After remarking on the respect due to nature, to the purposes of the conjugal act which were identified as union and procreation, and to faithfulness to God's design, the Pope moved on to condemn means of birth regulation termed illicit, which include abortion and direct sterilization as well as contraception. 2 exceptions were recognized, therapeutic sterilization and recourse to infertile periods for couples who for serious reasons wished to avoid pregnancy. The third section instructed priests, couples, bishops, and others in their duties in relation to the contents of Humanae Vitae. The encyclical was praised by some church leaders but also questioned. The fact that the work was not presented as infallible and possible conflicts with the duty of men affirmed in Vatican II not to act against their consciences were noted. When Humanae Vitae was published, the world population was 3.6 billion
Magnetic Properties of Porous Metal-Organic Frameworks: Ni2(BODC)2(TED) and Ni2(BDC)2(TED)
Hamida, Youcef; Danilovic, Dusan; Lin, Chyan; Yuen, Tan; Li, Kunhao; Padmanabhan, Moothetty; Li, Jing
2010-03-01
Results of χ(T), M(H), and heat capacity C(T) measurements on two Ni dimer based porous materials Ni2(BODC)2(TED) and Ni2(BDC)2(TED) are reported. These materials form a tetragonal crystal structure of space group P4/ncc with a=b = 14.9 å and c = 19.4 å and Ni-Ni separation of 2.61å within the dimer. Magnetic data of Ni2(BODC)2(TED) revealed a ferromagnetic-like transition at about 17 K with θ = 8 K, and a coercivity field of 1700 G was observed in the hysteresis curve. Though isostructural to Ni2(BODC)2(TED), χ(T) and M(H) results of Ni2(BDC)2(TED) showed an antiferromagnetic transition at 10 K with θ = - 132 K, and no hysteresis was observed. Although specific heat data C(T) showed no clear transition in both compounds, nonlinear behavior is clearly seen in C/T vs. T plots, and a fit to the electron and phonon contributions to C(T) gives a large heavy-fermion-like γ in both cases. A model for the magnetic interactions is proposed and a comparison to the Cu and Co analogues is also made.
Professor Adler-Nissen om TED-Talks i Kristeligt Dagblad
DEFF Research Database (Denmark)
Adler-Nissen, Rebecca
2017-01-01
Professor Rebecca Adler-Nissen var den 10. juni 2017 i Kristeligt Dagblad i forbindelse med hendes TED Talk på TED konferencen i Danmark. Her talte Adler-Nissen om international diplomati. Adler-Nissen ser TED formatet som en måde at øge kendskabet til emnet international diplomati, da formatet...
Energy Technology Data Exchange (ETDEWEB)
NONE
2004-07-01
Cegibat, the information-recommendation agency of Gaz de France for building engineering professionals, has organized this second conference about the Dolce Vita products and services offer, created by Gaz de France for the residential sector with the aim to promote the use of natural gas for a better comfort and lower energy consumptions. This second meeting makes a first status of the implementation of the Dolce Vita offer: qualitative and quantitative status, communication and marketing tools, two testimonies in individual houses, two testimonies in social buildings, two testimonies of private property developers, synthesis and perspectives. (J.S.)
Scientists Popularizing Science: Characteristics and Impact of TED Talk Presenters
Sugimoto, Cassidy R.; Thelwall, Mike; Larivi?re, Vincent; Tsou, Andrew; Mongeon, Philippe; Macaluso, Benoit
2013-01-01
The TED (Technology, Entertainment, Design) conference and associated website of recorded conference presentations (TED Talks) is a highly successful disseminator of science-related videos, claiming over a billion online views. Although hundreds of scientists have presented at TED, little information is available regarding the presenters, their academic credentials, and the impact of TED Talks on the general population. This article uses bibliometric and webometric techniques to gather data o...
Treatment Episode Data Set: Discharges (TEDS-D-2011)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
Treatment Episode Data Set: Discharges (TEDS-D-2008)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
Treatment Episode Data Set: Discharges (TEDS-D-2010)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
Treatment Episode Data Set: Discharges (TEDS-D-2007)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
Treatment Episode Data Set: Discharges (TEDS-D-2006)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
Treatment Episode Data Set: Discharges (TEDS-D-2009)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
Treatment Episode Data Set: Admissions (TEDS-A-2002)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1994)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2008)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2003)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2006)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2011)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1999)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1997)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2000)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2009)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2010)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1998)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2007)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1993)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1995)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1996)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2005)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-1992)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2001)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2004)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2013)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Treatment Episode Data Set: Admissions (TEDS-A-2012)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Admissions (TEDS-A) is a national census data system of annual admissions to substance abuse treatment facilities. TEDS-A provides...
Application of VitaVallis dressing for infected wounds
International Nuclear Information System (INIS)
Kirilova, N. V.; Fomenko, A. N.; Korovin, M. S.
2015-01-01
Today there is a growing demand for safe and efficient antimicrobial dressings for infected wound treatment. The antimicrobial sorption material for VitaVallis dressings was produced by one-stage oxidation of aluminum nanopowder in water in the presence of fibrous acetylcellulose matrix. Scanning electron microscopy revealed that the material is made up of fibers of diameter 1.5–3.0 µm with adhered agglomerated alumina nanosheets. An antimicrobial study revealed a high inhibitory effect of VitaVallis against the growth of gram-negative (E.coli, P. aeruginosa) and gram-positive (S. aureus) strains. The antimicrobial activity of the dressing against microbial pathogens on the wound surface was demonstrated in in vivo experiments on male rats. The dressing was also tested on volunteer patients. The testing showed reduction of the wound healing period, accelerated cleaning of the infected wound and enhanced tissue regeneration in the wound. The results demonstrate that the VitaVallis dressing can be used for the treatment of deep infected wounds
Application of VitaVallis dressing for infected wounds
Energy Technology Data Exchange (ETDEWEB)
Kirilova, N. V., E-mail: n.kirilova@vitavallis.com; Fomenko, A. N., E-mail: alserova@ispms.tsc.ru; Korovin, M. S., E-mail: msk@ispms.tsc.ru [Institute of Strength Physics and Materials Science SB RAS, 2/4 Akademicheskii pr., Tomsk, 634055 (Russian Federation)
2015-11-17
Today there is a growing demand for safe and efficient antimicrobial dressings for infected wound treatment. The antimicrobial sorption material for VitaVallis dressings was produced by one-stage oxidation of aluminum nanopowder in water in the presence of fibrous acetylcellulose matrix. Scanning electron microscopy revealed that the material is made up of fibers of diameter 1.5–3.0 µm with adhered agglomerated alumina nanosheets. An antimicrobial study revealed a high inhibitory effect of VitaVallis against the growth of gram-negative (E.coli, P. aeruginosa) and gram-positive (S. aureus) strains. The antimicrobial activity of the dressing against microbial pathogens on the wound surface was demonstrated in in vivo experiments on male rats. The dressing was also tested on volunteer patients. The testing showed reduction of the wound healing period, accelerated cleaning of the infected wound and enhanced tissue regeneration in the wound. The results demonstrate that the VitaVallis dressing can be used for the treatment of deep infected wounds.
Scientists popularizing science: characteristics and impact of TED talk presenters.
Directory of Open Access Journals (Sweden)
Cassidy R Sugimoto
Full Text Available The TED (Technology, Entertainment, Design conference and associated website of recorded conference presentations (TED Talks is a highly successful disseminator of science-related videos, claiming over a billion online views. Although hundreds of scientists have presented at TED, little information is available regarding the presenters, their academic credentials, and the impact of TED Talks on the general population. This article uses bibliometric and webometric techniques to gather data on the characteristics of TED presenters and videos and analyze the relationship between these characteristics and the subsequent impact of the videos. The results show that the presenters were predominately male and non-academics. Male-authored videos were more popular and more liked when viewed on YouTube. Videos by academic presenters were more commented on than videos by others and were more liked on YouTube, although there was little difference in how frequently they were viewed. The majority of academic presenters were senior faculty, males, from United States-based institutions, were visible online, and were cited more frequently than average for their field. However, giving a TED presentation appeared to have no impact on the number of citations subsequently received by an academic, suggesting that although TED popularizes research, it may not promote the work of scientists within the academic community.
Scientists popularizing science: characteristics and impact of TED talk presenters.
Sugimoto, Cassidy R; Thelwall, Mike; Larivière, Vincent; Tsou, Andrew; Mongeon, Philippe; Macaluso, Benoit
2013-01-01
The TED (Technology, Entertainment, Design) conference and associated website of recorded conference presentations (TED Talks) is a highly successful disseminator of science-related videos, claiming over a billion online views. Although hundreds of scientists have presented at TED, little information is available regarding the presenters, their academic credentials, and the impact of TED Talks on the general population. This article uses bibliometric and webometric techniques to gather data on the characteristics of TED presenters and videos and analyze the relationship between these characteristics and the subsequent impact of the videos. The results show that the presenters were predominately male and non-academics. Male-authored videos were more popular and more liked when viewed on YouTube. Videos by academic presenters were more commented on than videos by others and were more liked on YouTube, although there was little difference in how frequently they were viewed. The majority of academic presenters were senior faculty, males, from United States-based institutions, were visible online, and were cited more frequently than average for their field. However, giving a TED presentation appeared to have no impact on the number of citations subsequently received by an academic, suggesting that although TED popularizes research, it may not promote the work of scientists within the academic community.
Scientists Popularizing Science: Characteristics and Impact of TED Talk Presenters
Sugimoto, Cassidy R.; Thelwall, Mike; Larivière, Vincent; Tsou, Andrew; Mongeon, Philippe; Macaluso, Benoit
2013-01-01
The TED (Technology, Entertainment, Design) conference and associated website of recorded conference presentations (TED Talks) is a highly successful disseminator of science-related videos, claiming over a billion online views. Although hundreds of scientists have presented at TED, little information is available regarding the presenters, their academic credentials, and the impact of TED Talks on the general population. This article uses bibliometric and webometric techniques to gather data on the characteristics of TED presenters and videos and analyze the relationship between these characteristics and the subsequent impact of the videos. The results show that the presenters were predominately male and non-academics. Male-authored videos were more popular and more liked when viewed on YouTube. Videos by academic presenters were more commented on than videos by others and were more liked on YouTube, although there was little difference in how frequently they were viewed. The majority of academic presenters were senior faculty, males, from United States-based institutions, were visible online, and were cited more frequently than average for their field. However, giving a TED presentation appeared to have no impact on the number of citations subsequently received by an academic, suggesting that although TED popularizes research, it may not promote the work of scientists within the academic community. PMID:23638069
Dyson, Freeman
1987-01-01
Spirito, irrequieto, eccezionalmente colto, Freeman Dyson è lontanissimo dallo stereotipo dello scienziato chiuso nella torre d'avorio della propria specializzazione. In questo saggio egli prende la parola, lui fisico teorico ed esperto di problemi degli armamenti, nel dibattito sull'origine della vita. Un tema che, fino a ieri oggetto di esercitazioni teoriche a sfondo filosofico, comincia ad acquistare una dimensione concreta grazie alle possibilità di verifica sperimentale consentite dai progressi della biologia molecolare e dalle tecniche di simulazione al calcolatore.
Li, Yingxia; Gao, Ying; Zhang, Dongyu
2016-01-01
This paper intends to investigate the effectiveness of a new course pattern--TED-motivated English Public Speaking Course in EFL teaching in China. This class framework adopts TED videos as the learning materials to stimulate students to be a better speaker. Meanwhile, it aims to examine to what extent the five aspects of language skills are…
Treatment Episode Data Set: Discharges (TEDS-D-2006-2011)
U.S. Department of Health & Human Services — The Treatment Episode Data Set -- Discharges (TEDS-D) is a national census data system of annual discharges from substance abuse treatment facilities. TEDS-D...
New trends in knowledge dissemination: TED Talks
Directory of Open Access Journals (Sweden)
Giuseppina Scotto di Carlo
2014-05-01
Full Text Available This paper investigates the key elements of ethos, pathos and logos linguistic strategies as some main features of TED (Technology, Entertainment, Design Talks, popularizing speeches aiming at Knowledge Dissemination. Through a comparison between the TED Talk ‘HIV - How to fight an epidemic of bad laws’, by Shereen El-Feki (2012a, and another speech held by the same author at the 2012 Symposia The Global Commission on HIV and the Law, addressed to specialists, the paper analyses TED Talks as an innovative tool of popularization, which breaches the typical triangularisation ‘scientist-mediator-audience’, bringing scientists directly into contact with their audiences. Drawing upon Aristotle’s three pillars of rhetoric, the paper analyses the strategies used to establish the ethos of the speech, by proposing a topic as morally worth of spreading; pathos, by creating a direct contact with the public; and logos, investigated through an analysis of the elements used to recontextualise scientific discourses into popularized speeches. The analysis suggests that TED Talks are a recodification, not a mere translation of texts; they are a means to disseminate knowledge reducing the asymmetry between audiences and scientists.
TED analysis of the Si(113) surface structure
Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.
1999-09-01
We carried out a TED (transmission electron diffraction) analysis of the Si(113) surface structure. The TED patterns taken at room temperature showed reflections due to the 3×2 reconstructed structure. The TED pattern indicated that a glide plane parallel to the direction suggested in some models is excluded. We calculated the R-factors (reliability factors) for six surface structure models proposed previously. All structure models with energy-optimized atomic positions have large R-factors. After revision of the atomic positions, the R-factors of all the structure models decreased below 0.3, and the revised version of Dabrowski's 3×2 model has the smallest R-factor of 0.17.
Momenti nella vita di uno scienziato
Rossi, Bruno
1987-01-01
Nel giro di pochi decenni, la nostra visione del mondo fisico, dal mond subatomico al mondo del cosmo, ha subito una profonda evoluzione. In questo libro, uno degli scienziati che hanno contribuito a tale sviluppo narra la storia della sua vita e del suo lavoro.
77 FR 6863 - Proposed Collection; Comment Request for VITA/TCE Program Forms
2012-02-09
.../TCE Program Forms AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for... VITA/TCE Program Forms 14310, 8653, 8654, and 14024. DATES: Written comments should be received on or... . SUPPLEMENTARY INFORMATION: Title: VITA/TCE Program Forms. OMB Number: 1545-2222. Form Number: Forms 14310, 8653...
Ted Wilson passes on the torch
2003-01-01
As part of the Laboratory's outreach programme, the CERN Accelerator School (CAS) brings together students and experienced physicists from all over the world with the aim of promoting the understanding of accelerator physics. As head of the School for 11 years, Ted Wilson became a CERN ambassador to the outside community. He retired in March, handing over the reigns of the CAS to Daniel Brandt. Ted Wilson and his assistant, Suzanne von Wartburg, during an EPAC meeting in 1994.The accelerator schools allowed some time for relaxation in the local surrounding for students as well as for the director of CAS.As a boy, Ted Wilson could have embarked on a career in pop music rather than physics, rubbing shoulders at secondary school in Liverpool with two of the future Beatles. But prefering classical music and answering the call of science, he took the more serious of the two paths, studying physics first at Oxford University then at the Rutherford Laboratory. After a year at CERN and four years at the Rutherford La...
Harma, Eero
2010-01-01
UniTed on Teddy boy- tyylistä inspiroitunut kevät/kesä mallisto naisille.Mallistossa yhdistyy perinteinen teddy boy- vaatetus ja klassinen feminiinisyys, sekä menneisyys ja nykyisyys. Suunnittelun lähtökohtia olivat naisellisuus, tyylikkyys ja pyrkimys luoda nykyaikaista suunnittelua menneisyydestä lainaillen. United is a teddy boy- style inspired spring/summer collection for women. The collection combines traditional Teddy boy style with classical feminity and past with the present. The b...
A Pharmacy Elective Course on Creative Thinking, Innovation, and TED Talks.
Cain, Jeff
2016-12-25
Objective. To implement and assess an elective course designed to enhance student creative thinking and presentation skills. Design. A two-credit elective course was developed that incorporated creative-thinking exercises, article discussions pertaining to creativity, TED Talk (TED Conferences, New York, NY) analyses, and presentation design and delivery exercises. Assessment. Assessment instruments included pre- and post-course Torrance Tests of Creative Thinking (TTCT). A scoring rubric was developed and used to evaluate a final mock TED Talk presented to faculty and students. Course evaluations were also used to assess student experiences in the course. Students' TTCT verbal creativity scores increased significantly ( p <0.05) during the course and their mock TED Talk mean scores (135±6.4) out of 150 were rated highly. Conclusion. The outcomes from this elective course confirmed that pharmacy students could develop and present an original "idea worth sharing" using the TED Talk format.
Un manoscritto smarrito della «Vita nuova»
Directory of Open Access Journals (Sweden)
Marzia Festa
2015-12-01
Full Text Available L’articolo si concentra sul codice di Pesaro della Vita nuova, di cui Donato Pirovano ha recentemente constatato lo smarrimento. Di fronte a tale perdita, non sappiamo se temporanea o permanente, ci siamo posti alcuni interrogativi. Con l’obiettivo di rispondere a questa serie di domande, è stata presa in esame una l’edizione pesarese (1829, esemplata sul codice disperso. Al fine di accertare se l’edizione sia considerabile sostitutiva di P, abbiamo svolto una collazione tra questa e il manoscritto, servendoci dei dati del codice tramandatici da Michele Barbi nella sua edizione della Vita Nuova del 1932. Il risultato a cui siamo giunti, al termine del confronto, ha decretato che l’edizione pesarese non può essere ritenuta una copia perfetta di questo prezioso testimone, perché troppe sono le discordanze tra i due testi, ma è pur vero che, data la sua stretta affinità con il codice, ne rimane una ricca e importante testimonianza.This paper addresses the recent disappearance of the Pesaro codex of the Vita nuova, as lately ascertained by Donato Pirovano. Without knowing if this loss is temporary or permanent, some questions concerning its possible recovery through a copy of the original manuscript need to be asked. The object of his study is to answer these questions through the analysis of a potential descriptus. Only the 1829 Pesaro edition, copied from the missing manuscript, seemed to be eligible for this role. To ascertain whether this edition was asuitable substitute for thr Pesaro codex, I collated it with passages copied directly from the manuscript by Michele Barbi in his 1932 edition of the Vita Nuova. Even though the great number of discordances suggests that the former cannot be considered a copy of the original, its value as testimony still holds true.
A Pharmacy Elective Course on Creative Thinking, Innovation, and TED Talks
2016-01-01
Objective. To implement and assess an elective course designed to enhance student creative thinking and presentation skills. Design. A two-credit elective course was developed that incorporated creative-thinking exercises, article discussions pertaining to creativity, TED Talk (TED Conferences, New York, NY) analyses, and presentation design and delivery exercises. Assessment. Assessment instruments included pre- and post-course Torrance Tests of Creative Thinking (TTCT). A scoring rubric was developed and used to evaluate a final mock TED Talk presented to faculty and students. Course evaluations were also used to assess student experiences in the course. Students’ TTCT verbal creativity scores increased significantly (p<0.05) during the course and their mock TED Talk mean scores (135±6.4) out of 150 were rated highly. Conclusion. The outcomes from this elective course confirmed that pharmacy students could develop and present an original “idea worth sharing” using the TED Talk format. PMID:28179719
TED: A Tolerant Edit Distance for segmentation evaluation.
Funke, Jan; Klein, Jonas; Moreno-Noguer, Francesc; Cardona, Albert; Cook, Matthew
2017-02-15
In this paper, we present a novel error measure to compare a computer-generated segmentation of images or volumes against ground truth. This measure, which we call Tolerant Edit Distance (TED), is motivated by two observations that we usually encounter in biomedical image processing: (1) Some errors, like small boundary shifts, are tolerable in practice. Which errors are tolerable is application dependent and should be explicitly expressible in the measure. (2) Non-tolerable errors have to be corrected manually. The effort needed to do so should be reflected by the error measure. Our measure is the minimal weighted sum of split and merge operations to apply to one segmentation such that it resembles another segmentation within specified tolerance bounds. This is in contrast to other commonly used measures like Rand index or variation of information, which integrate small, but tolerable, differences. Additionally, the TED provides intuitive numbers and allows the localization and classification of errors in images or volumes. We demonstrate the applicability of the TED on 3D segmentations of neurons in electron microscopy images where topological correctness is arguable more important than exact boundary locations. Furthermore, we show that the TED is not just limited to evaluation tasks. We use it as the loss function in a max-margin learning framework to find parameters of an automatic neuron segmentation algorithm. We show that training to minimize the TED, i.e., to minimize crucial errors, leads to higher segmentation accuracy compared to other learning methods. Copyright © 2016. Published by Elsevier Inc.
Lexical Coverage of TED Talks: Implications for Vocabulary Instruction
Nurmukhamedov, Ulugbek
2017-01-01
Teachers of English are often in search of authentic audio and video materials that promote learners' listening comprehension and vocabulary development. TED Talks, a set of freely available web presentations, could be a useful resource to promote vocabulary instruction. The present replication study examines the lexical coverage of TED Talks by…
The Pathophysiology of Thyroid Eye Disease (TED): Implications for Immunotherapy
Gupta, Shivani; Douglas, Raymond
2012-01-01
Purpose of Review Thyroid eye disease (TED) is a poorly understood autoimmune manifestation most commonly associated with Graves’ disease. Current nonspecific treatment paradigms offer symptomatic improvement but fail to target the underlying pathogenic mechanisms and thus, do not significantly alter the long-term disease outcome. The purpose of this review is to provide an update of the current understanding of the immunopathogenesis of TED and explore these implications for targeted immunotherapy. Recent Findings Orbital fibroblasts are integral to the pathogenesis of TED and may modulate immune responses by production of cytokines and hyaluronan in response to activation of shared autoantigens including thyrotropin receptor (TSHR) and insulin-like growth factor-1 receptor (IGF-R1). Fibrocytes share many of these phenotypic and functional features, suggesting a link between systemic and site-specific disease. Use of targeted immunotherapies in TED is limited, though data from the use Rituximab (RTX), a B cell depleting agent, are encouraging. Sustained clinical response has been seen with RTX in several reports, despite return of peripheral B cell levels to pretreatment levels. Additionally, this response appears to be independent to cytokine and antibody production, suggesting possible modulation of antigen presentation as a mechanism of its effect. Summary Progressive advances in the understanding of the immunopathogenesis of TED continue to spur clinical trials utilizing targeted immune therapies. Continued understanding of the molecular mechanisms of disease will expand potential treatments for TED patients and obviate the need for reconstructive surgical therapies. PMID:21730841
Cushman, Kathleen
2009-01-01
In a roomful of people, Ted Sizer always went right to the kids. With merry eyes and delighted smile, he would adjust his tall frame so he could speak directly with the young one. Then he would ask just the right question about what this interesting person was thinking and doing. One could tell that the conversation engaged Sizer completely. He…
Ted Geballe: A lifetime of contributions to superconductivity
Stewart, G. R.
2015-07-01
The editors have dedicated this special issue on superconducting materials "to Ted Geballe in honor of his numerous seminal contributions to the field of superconducting materials over more than 60 years, on the year of his 95th birthday." Here, as an executive summary, are just a few highlights of his research in superconductivity, leavened with some anecdotes, and ending with some of Ted's general insights and words of wisdom.
Evaluation of thyroid eye disease: quality-of-life questionnaire (TED-QOL) in Korean patients.
Son, Byeong Jae; Lee, Sang Yeul; Yoon, Jin Sook
2014-04-01
To assess impaired quality of life (QOL) of Korean patients with thyroid eye disease (TED) using the TED-QOL questionnaire, to evaluate the adaptability of the questionnaire, and to assess the correlation between TED-QOL and scales of disease severity. Prospective, cross-sectional study. Total of 90 consecutive adult patients with TED and Graves' disease were included in this study. TED-QOL was translated into Korean and administered to the patients. The results were compared with clinical severity scores (clinical activity score, VISA (vision loss (optic neuropathy); inflammation; strabismus/motility; appearance/exposure) classification, modified NOSPECS (no signs or symptoms; only signs; soft tissue; proptosis; extraocular muscle; cornea; sight loss) score, Gorman diplopia scale, and European Group of Graves' Orbitopathy Classification). Clinical scores indicating inflammation and strabismus in patients with TED were positively correlated with overall and visual function-related QOL (Spearman coefficient 0.21-0.38, p < 0.05). Clinical scores associated with appearance were positively correlated with appearance-related QOL (Spearman coefficient 0.26-0.27, p < 0.05). In multivariate analysis, age, soft-tissue inflammation, motility disorder of modified NOSPECS, and motility disorder of VISA classification had positive correlation with overall and function-related QOL. Sex, soft-tissue inflammation, proptosis of modified NOSPECS, and appearance of VISA classification had correlation with appearance-related QOL. In addition, validity of TED-QOL was proved sufficient based on the outcomes of patient interviews and correlation between the subscales of TED-QOL. TED-QOL showed significant correlations with various objective clinical parameters of TED. TED-QOL was a simple and useful tool for rapid evaluation of QOL in daily outpatient clinics, which could be readily translated into different languages to be widely applicable to various populations. Copyright © 2014
Talk like TED the 9 public-speaking secrets of the world's top minds
Gallo, Carmine
2014-01-01
Ideas are the currency of the twenty-first century. In order to succeed, you need to be able to sell your ideas persuasively. This ability is the single greatest skill that will help you accomplish your dreams. TED Talks have redefined the elements of a successful presentation and become the gold standard for public speaking. TED--which stands for technology, entertainment, and design--brings together the world's leading thinkers. These are the presentations that set the world on fire, and the techniques that top TED speakers use will make any presentation more dynamic, fire up any team, and give anyone the confidence to overcome their fear of public speaking. Public speaking coach and bestselling author Carmine Gallo has broken down hundreds of TED talks and interviewed the most popular TED presenters, as well as the top researchers in the fields of psychology, communications, and neuroscience to reveal the nine secrets of all successful TED presentations. Gallo's step-by-step method makes it possible for ...
50 CFR Figure 4 to Part 223 - Georgia TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Georgia TED 4 Figure 4 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 4 Figure 4 to Part 223—Georgia TED EC01JY91.048 [52 FR...
50 CFR Figure 10 to Part 223 - Flounder TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Flounder TED 10 Figure 10 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 10 Figure 10 to Part 223—Flounder TED EC01JY91.056 [5...
50 CFR Figure 3 to Part 223 - Matagorda TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Matagorda TED 3 Figure 3 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 3 Figure 3 to Part 223—Matagorda TED EC01JY91.047 [52...
Dispositivi formativi e forme di vita
Directory of Open Access Journals (Sweden)
Francesco Cappa
2016-02-01
Full Text Available Il dibattito pedagogico che ha caratterizzato gli ultimi anni ha spesso insistito sull’importanza del nesso tra sviluppo tecnologico e modelli formativi. Questa relazione, però, troppo spesso non valorizza i modi in cui l’esperienza educativa e formativa dovrebbe essere sempre più accuratamente pensata, progettata e predisposta se vista dalla prospettiva delle buone pratiche tecnologiche. Tale valorizzazione dell’istanza formativa deve prendere avvio da una riflessione critica e approfondita sui modelli impliciti ed espliciti che caratterizzano le pratiche educative e formative, valorizzando l’uso e l’interpretazione che i soggetti rendono attuali.Per consentire tale riflessione è necessario pensare un dispositivo pedagogico che non perda di vista la complessità delle dimensioni che agiscono nell’accadere educativo, capace di creare nuovi percorsi di sperimentazione delle conoscenze e nuove ipotesi di formazione di sé e degli altri. La formazione interpretata alla luce dei dispositivi pedagogici può offrire un valido strumento teorico e pratico per immaginare, progettare e valutare gli effetti che ogni azione formativa produce legati alla trasformazione dei saperi, alla vita delle forme e alle forme di vita contemporanee.
Honing EAP Learners' Public Speaking Skills by Analyzing TED Talks
Leopold, Lisa
2016-01-01
Despite the importance of public speaking skills for English for Academic Purposes (EAP) students' academic and professional success, few EAP textbooks incorporate authentic, professional speech models. Thus, many EAP instructors have turned to TED talks for dynamic speech models. Yet a single TED talk may be too long for viewing in class and may…
Infrared and near infrared emission spectra of TeH and TeD
Yu, Shanshan; Shayesteh, Alireza; Fu, Dejian; Bernath, Peter F.
2005-04-01
The vibration-rotation emission spectra for the X2Π ground state and the near infrared emission spectra of the X2Π 1/2- X2Π 3/2 system of the TeH and TeD free radicals have been measured at high resolution using a Fourier transform spectrometer. TeH and TeD were generated in a tube furnace with a DC discharge of a flowing mixture of argon, hydrogen (or deuterium), and tellurium vapor. In the infrared region, for the X2Π 3/2 spin component we observed the 1-0, 2-1, and 3-2 vibrational bands for most of the eight isotopologues of TeH and the 1-0 and 2-1 bands for three isotopologues of TeD. For the X2Π 1/2- X2Π 3/2 transition, we observed the 0-0 and 1-1 bands for TeH and the 0-0, 1-1, and 2-2 bands for TeD. Except for a few lines, the tellurium isotopic shift was not resolved for the X2Π 1/2- X2Π 3/2 transitions of TeH and TeD. Local perturbations with Δ v = 2 between the two spin components of the X2Π state of TeH were found: X2Π 1/2, v = 0 with X2Π 3/2, v = 2; X2Π 1/2, v = 1 with X2Π 3/2, v = 3. The new data were combined with the previous data from the literature and two kinds of fits (Hund's case (a) and Hund's case (c)) were carried out for each of the 10 observed isotopologues: 130TeD, 128TeD, 126TeD, 130TeH, 128TeH, 126TeH, 125TeH, 124TeH, 123TeH, and 122TeH.
Fayers, Tessa; Fayers, Peter M; Dolman, Peter J
2016-12-01
We tested the sensitivity and responsiveness of the TED-QOL to rehabilitative surgery in thyroid eye disease (TED). The 3-item TED-QOL and 16-item GO-QOL, which assess quality of life (QoL) in TED, were administered to consecutive patients undergoing rehabilitative surgery. The questionnaires were completed pre-and post-operatively to assess sensitivity (ability to discriminate between different surgical groups) and responsiveness (ability to detect within patient changes over time).56 patients underwent 69 procedures for TED (29 orbital decompressions, 15 strabismus operations, 25 eyelid procedures). The differences in scores between the three types of surgery (a measure of sensitivity) were statistically significant at the 5% level pre-operatively and post-operatively for all 3 TED-QOL scales and for both GO-QOL scales, but much more so for the TED-QOL scales in each case. The within-patient changes between the pre- and post-operative scores for the same subjects (a measure of responsiveness) were statistically very highly significant for the TED-QOL overall and appearance scales for each of the surgeries. The pre- and post-operative difference for the TED-QOL functioning scale was highly statistically significant for strabismus surgery but not for decompression or lid surgery. The change between the pre- and post-operative scores for the GO-QOL was significant for the functioning scale with strabismus and lid surgery, and was highly significant for the appearance scale with lid surgery but not for strabismus surgery or decompression. The 3-item TED-QOL is sensitive and responsive to rehabilitative surgery in TED and compares favorably with the lengthier GO-QOL for these parameters.
Directory of Open Access Journals (Sweden)
Amit Kumar Tyagi
2013-01-01
Full Text Available The chemical composition of Porella arboris-vitae extracts was determined by solid phase microextraction, gas chromatography-mass spectrometry (SPME GC-MS, and 66 constituents were identified. The dominant compounds in methanol extract of P. arboris-vitae were β-caryophyllene (14.7%, α-gurjunene (10.9%, α-selinene (10.8%, β-elemene (5.6%, γ-muurolene (4.6%, and allo-aromadendrene (4.3% and in ethanol extract, β-caryophyllene (11.8%, α-selinene (9.6%, α-gurjunene (9.4%, isopentyl alcohol (8.8%, 2-hexanol (3.7%, β-elemene (3.7%, allo-aromadendrene (3.7%, and γ-muurolene (3.3% were the major components. In ethyl acetate extract of P. arboris-vitae, undecane (11.3%, β-caryophyllene (8.4%, dodecane (6.4%, α-gurjunene (6%, 2-methyldecane (5.1%, hemimellitene (4.9%, and D-limonene (3.9% were major components. The antimicrobial activity of different P. arboris-vitae extracts was evaluated against selected food spoilage microorganisms using microbroth dilution method. The Minimal Inhibitory Concentration (MIC varied from 0.5 to 1.5 mg/mL and 1.25 to 2 mg/mL for yeast and bacterial strains, respectively. Significant morphological and ultrastructural alterations due to the effect of methanolic and ethanolic P. arboris-vitae extracts on S. Enteritidis have also been observed by scanning electron microscope and transmission electron microscope, respectively. The results provide the evidence of antimicrobial potential of P. arboris-vitae extracts and suggest its potential as natural antimicrobial agents for food preservation.
Bertrand, P.H.E.
2006-01-01
The Life of Antony, translated by Evagrius of Antioch: Reception, Manuscript Tradition, Edition. With special emphasis on Vitas Patrum Tradition The Life of Antony is the first and one of the most famous saints’ lives that has ever been written. Shortly after the death of the desertfather
Obituary: Edward R. (Ted) Harrison, 1919-2007
Irvine, William M.; Arny, Thomas T.; Trimble, Virginia
2007-12-01
Cosmologist Edward R. (Ted) Harrison, emeritus Distinguished University Professor of Physics and Astronomy at the University of Massachusetts Amherst, died on 29 January 2007 in his retirement city of Tucson, Arizona, where he was adjunct professor at the Steward Observatory, University of Arizona. The cause of death was colon cancer. He is survived by a sister, brother, and daughter. (A son died in 2000.) Perhaps best known for his work on the growth of fluctuations in the expanding universe and his books on cosmology for the dedicated layperson, Ted had extremely broad interests, and he published more than 200 papers in space sciences, plasma physics, high-energy physics, physical chemistry, and, principally, many aspects of astrophysics. He was a Fellow of the American Physical Society, the American Association for the Advancement of Science, the Royal Astronomical Society, and the Institute of Physics (UK). Ted Harrison was born 8 January 1919 in London, England. His parents were Robert Harrison and Daisy Harrison (nee White). His education at Sir John Cass College, London University, was interrupted by the Second World War, during which he served for six years with the British Army in various campaigns, ultimately acting as Radar Adviser to the Northern Area of the Egyptian Army. It was during the latter service that he met his wife Photeni (nee Marangas). Following the War, Ted became a British Civil Servant, at first with the Atomic Energy Research Establishment in Harwell and then at the Rutherford High Energy Laboratory. During this period he acquired the equivalent of university degrees, becoming a graduate, then an Associate, and finally a Fellow of the Institute of Physics. His somewhat unorthodox education may have contributed to his broad interests and his very intuitive and physical approach to scientific problems. The latter became the bane of generations of graduate students, who might find themselves asked on their physics qualifying exams to
R. E. (Ted) Munn — Founding editor; a mini-biography
Taylor, Peter; Thomas, Morley; Truhlar, Ed; Whelpdale, Doug
1996-02-01
Ted Munn founded Boundary-Layer Meteorology in 1970 and served as Editor for 75 volumes over a 25 year period. This short article briefly reviews Ted's scientific career with the Atmospheric Environment Service (of Canada), the International Institute for Applied Systems Analysis in Austria and with the Institute of Environmental Studies at the University of Toronto, and as editor of this journal.
International Nuclear Information System (INIS)
Li Qing; Feng Zheng
2005-01-01
Objective: To investigate the changes of serum contents of LPO, SOD and therapeutic efficacy after treatment with Vita. E-C complex in patients with liver spot. Methods: Serum LPO and SOD contents were measured both before and after treatment with Vita E-C complex (Vita. E l00mg, Vita. C 200mg x 3/d for 3 months) in 30 patients with liver spot as well as in 10 controls. Results: Before treatment, the serum LPO contents in the patients were significantly higher than those in controls. After treatment, the LPO contents dropped markedly, being significantly lower than the values before treatment. However, the SOD contents were about the same as those in controls and changes little after treatment. Conclusion: Vita. E-C complex was of definite therapeutic value for the treatment of liver spot. (authors)
VITA-6.2: Advanced visual tool for information management
International Nuclear Information System (INIS)
Jacobson, Z.; Truong, Q.S.; Houston, B.; Taylor, V.; Herber, N.; El Gebaly, A.
2007-01-01
Visual Interface for Text Analysis (VITA), our combined user interface and meta-search engine software application, improves the quality and speed at which intelligence analysts can explore novel massive text corpora via innovations that facilitate user contextual awareness. (author)
Loya, Melody Aye; Klemm, Terri
2016-01-01
Focusing on TED Talks (online videos) as a resource for social work educators, this teaching note shares our ideas regarding the use of the online videos as an avenue for reaching students and encouraging discussions in the social work classroom. The article first explores the TED platform and then discusses using TED as a teaching tool. Finally,…
Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.
A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.
Borgman, Christine L.
2014-01-01
Ted Nelson coined the term “hypertext” and developed Xanadu in a universe parallel to the one in which librarians, archivists, and documentalists were creating metadata to establish cross-connections among the myriad topics of this world. When these universes collided, comets exploded as ontologies proliferated. Black holes were formed as data disappeared through lack of description. Today these universes coexist, each informing the other, if not always happily: the formal rules of metadata, ...
Pastoral Conventions in Martino Filetico’s De Vita Theocriti
DEFF Research Database (Denmark)
Hass, Trine Arlund
2015-01-01
Martino Filetico (1430–1490) recounts the life of Theocritus in De Vita Theocriti, a brief text of thirty verses. In the traditional description of Renaissance pastoral poetry, Virgil is considered the primary model and the best example, and the authoritative commentators praise his qualities...
Roy, Sharmili; Brown, Michael S; Shih, George L
2014-02-01
This paper introduces a software framework called Visual Interpretation with Three-Dimensional Annotations (VITA) that is able to automatically generate three-dimensional (3D) visual summaries based on radiological annotations made during routine exam reporting. VITA summaries are in the form of rotating 3D volumes where radiological annotations are highlighted to place important clinical observations into a 3D context. The rendered volume is produced as a Digital Imaging and Communications in Medicine (DICOM) object and is automatically added to the study for archival in Picture Archiving and Communication System (PACS). In addition, a video summary (e.g., MPEG4) can be generated for sharing with patients and for situations where DICOM viewers are not readily available to referring physicians. The current version of VITA is compatible with ClearCanvas; however, VITA can work with any PACS workstation that has a structured annotation implementation (e.g., Extendible Markup Language, Health Level 7, Annotation and Image Markup) and is able to seamlessly integrate into the existing reporting workflow. In a survey with referring physicians, the vast majority strongly agreed that 3D visual summaries improve the communication of the radiologists' reports and aid communication with patients.
50 CFR 223.207 - Approved TEDs.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Approved TEDs. 223.207 Section 223.207 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Restrictions Applicable to Threatened Marine and Anadromous Specie...
Representasi Kriminalitas Dalam Film “Ted” Dan “Ted 2”
WIlona, Merrie
2015-01-01
Penelitian ini bertujuan untuk melihat representasi kriminalitas dalam film “Ted” dan “Ted 2”. Bentuk-bentuk tindakan kriminalitas adalah pencurian, penyalahgunaan narkoba, tindakan asusila, pencopetan, penjambretan, penodongan senjata tajam/api, kekerasan fisik, penganiayaan, Perusakan barang orang lain, pembunuhan, penipuan dan korupsi. Film “Ted” dan “Ted 2” dipilih karena menampilkan tokoh utama “Teddy Bear yang identik dengan anak-anak, namun banyak menuai kontroversi. Peneliti ini mengg...
A community of curious souls: an analysis of commenting behavior on TED talks videos.
Tsou, Andrew; Thelwall, Mike; Mongeon, Philippe; Sugimoto, Cassidy R
2014-01-01
The TED (Technology, Entertainment, Design) Talks website hosts video recordings of various experts, celebrities, academics, and others who discuss their topics of expertise. Funded by advertising and members but provided free online, TED Talks have been viewed over a billion times and are a science communication phenomenon. Although the organization has been derided for its populist slant and emphasis on entertainment value, no previous research has assessed audience reactions in order to determine the degree to which presenter characteristics and platform affect the reception of a video. This article addresses this issue via a content analysis of comments left on both the TED website and the YouTube platform (on which TED Talks videos are also posted). It was found that commenters were more likely to discuss the characteristics of a presenter on YouTube, whereas commenters tended to engage with the talk content on the TED website. In addition, people tended to be more emotional when the speaker was a woman (by leaving comments that were either positive or negative). The results can inform future efforts to popularize science amongst the public, as well as to provide insights for those looking to disseminate information via Internet videos.
The significance of the second cave episode in Jerome’s Vita Malchi
Directory of Open Access Journals (Sweden)
Jacobus P. Kritzinger
2014-02-01
Full Text Available The authors argue that the second cave episode in Jerome’s Vita Malchi Monachi Captivi should, in view of the similarities with the first cave episode and the high incidence of literary devices employed in it, be recognised for its value in the interpretation of this vita. The book was intended as a defence of, and an exhortation to a life of celibacy and this dual purpose is clearly demonstrated in both episodes in which a cave is used as the setting. The second cave episode has been neglected in the scholarly debate about the purpose of the book and this article attempts to set the record straight.
Expressing epistemic stance in University lectures and TED talks: a contrastive corpu-based analysis
Directory of Open Access Journals (Sweden)
Giuditta Caliendo
2014-07-01
Full Text Available Abstract – This study explores the web-mediated genre of TED (Technology, Entertainment, Design talks, speech events whereby experts in their field disseminate knowledge from different domains (e.g. science, technology, design, global issues addressing an audience of both co-present participants and web-users all over the world. The aim of this study is to investigate the way academics convey epistemic stance (Conrad, Biber 2000 and build up their image as experts on the TED stage. To this purpose, a contrastive analysis was carried out comparing two corpora of spoken discourse, i.e. a corpus of TED talks and a corpus of MICASE university lectures from different disciplines. Although in both genres the speaker is an academic, both the communicative purpose and audience expectations differ substantially in the two contexts under scrutiny. This comparison highlights some distinguishing traits of TED talks and provides a better insight into this genre. Adopting a corpus-based approach, attention is first paid to the most recurrent epistemic lexical verbs (ELVs and to the use of first and second person pronouns in the two corpora. The qualitative analysis then focuses on similarities and differences in the discourse functions of the four most frequent ELVs (see, show, know, think and of their clusters when they combine with first and second person pronouns in the two corpora. Previous studies in the field of English for Academic Purposes (Rounds 1987; Fortanet 2004; Walsh 2004; Artiga León 2006; Bamford 2009 are referred to as a starting point to investigate a novel, unexplored pragmatic space (i.e. that of TED wherein academics accomplish purposes other than merely disseminating knowledge and training students, such as promoting their research and building up their image as experts. Keywords: Languages for Special Purposes, popularization, web-mediated genres, evidentiality, epistemic stance Abstract – I generi mediati dalla rete svolgono un
VITA Experiential, Service-Learning, Learned Competencies, and Changed Mindsets
Boneck, Robin; Barnes, Jeffrey N.; Stillman, Tyler F.
2014-01-01
The authors describe how Southern Utah University has integrated the U.S. Internal Revenue Service (IRS) Voluntary Income Tax Assistance (VITA) program as an experiential servicelearning activity for over a decade and a half. First, we describe the value of experiential servicelearning. Second, we detail the program, its oversight, its student…
Directory of Open Access Journals (Sweden)
DWI SURYANTO
2001-01-01
Full Text Available Three anoxygenic photosyn thetic bacter ia, DS-1, DS-4 and Cas-13, have been exam in ated for their morphological and physiolog ical propert ies. All s trains were rod-sh ape ce lls with a swollen terminal end, Gram nega tive , motile, non-hal ophilic, non-alkal ophilic a n d non- acid ophilic , a nd capable of utilizing benzoate aerobically and photo-anaerobically. Sequ ence analysis of part of 16S rRNA genes showed that DS-1 and Cas- 13 we re cl osel y relate d to Rhodopseudomonas palustris Stra in 7 w ith a simila ri ty of 97%, where a s DS-4 ma y not be c losel y rela te d t o the former t wo str ai ns wit h a si milarit y of 78% based on t he constr ucte d phyloge nic tree . Sp ec tral anal ys is ind ica te d that the thr ee ba cter ia ha d ba cter io ch lorophyl a and norm al sp ir il loxa nthi n ser ies. Growth in med ium enriched with vitamin and supplemen ted with ben zoa te as their s ole C-s ources wa s bette r t han in me di um witho ut vita min. Benz oate deg ra dati on in me di u m with vita min was ac ce lerated. The ab ility to grow on benzoate withou t added vitam ins ind icated that the bacteria were able to s ynthesize th eir own vitamins.
Kwon, Jeong Eun; Lee, Jin Woo; Park, Yuna; Sohn, Eun-Hwa; Choung, Eui Su; Jang, Seon-A; Kim, Inhye; Lee, Da Eun; Koo, Hyun Jung; Bak, Jong Phil; Lee, Sung Ryul; Kang, Se Chan
2018-01-28
Isoflavone itself is less available in the body without the aid of intestinal bacteria. In this study, we searched for isoflavone-transforming bacteria from human fecal specimens ( n = 14) using differential selection media. Isoflavone-transforming activity as the production of dihydrogenistein and dihydrodaidzein was assessed by high-performance liquid chromatography and we found Lactobacillus rhamnosus , named L. rhamnosus vitaP1, through 16S rDNA sequence analysis. Extract from Pueraria lobata (EPL) and soy hypocotyl extract were fermented with L. rhamnosus vitaP1 for 24 and 48 h at 37°C. Fermented EPL (FEPL) showed enhanced anti-tyrosinase activity and antioxidant capacities, important suppressors of the pigmentation process, compared with that of EPL ( p Lactobacillus rhamnosus vitaP1 was found to be able to biotransform isoflavones in EPL. FEPL showed augmented anti-melanogenic potential.
Roy, Sharmili; Brown, Michael S.; Shih, George L.
2013-01-01
This paper introduces a software framework called Visual Interpretation with Three-Dimensional Annotations (VITA) that is able to automatically generate three-dimensional (3D) visual summaries based on radiological annotations made during routine exam reporting. VITA summaries are in the form of rotating 3D volumes where radiological annotations are highlighted to place important clinical observations into a 3D context. The rendered volume is produced as a Digital Imaging and Communications i...
Dr. Ted Trimble: Why I Do Cancer Research
In a video, Dr. Ted Trimble talks about the importance of cancer research. World Cancer Research Day commemorates the important role research and cancer researchers play in reducing the global burden of cancer.
A community of curious souls: an analysis of commenting behavior on TED talks videos.
Directory of Open Access Journals (Sweden)
Andrew Tsou
Full Text Available The TED (Technology, Entertainment, Design Talks website hosts video recordings of various experts, celebrities, academics, and others who discuss their topics of expertise. Funded by advertising and members but provided free online, TED Talks have been viewed over a billion times and are a science communication phenomenon. Although the organization has been derided for its populist slant and emphasis on entertainment value, no previous research has assessed audience reactions in order to determine the degree to which presenter characteristics and platform affect the reception of a video. This article addresses this issue via a content analysis of comments left on both the TED website and the YouTube platform (on which TED Talks videos are also posted. It was found that commenters were more likely to discuss the characteristics of a presenter on YouTube, whereas commenters tended to engage with the talk content on the TED website. In addition, people tended to be more emotional when the speaker was a woman (by leaving comments that were either positive or negative. The results can inform future efforts to popularize science amongst the public, as well as to provide insights for those looking to disseminate information via Internet videos.
50 CFR Figure 6 to Part 223 - TED Extension in Summer Flounder Trawl
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false TED Extension in Summer Flounder Trawl 6 Figure 6 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 6 Figure 6 to Part 223—TED...
Directory of Open Access Journals (Sweden)
Rania Abutarboush
2014-11-01
Full Text Available The use of hemoglobin-based oxygen carriers (HBOC as oxygen delivering therapies during hypoxic states has been hindered by vasoconstrictive side effects caused by depletion of nitric oxide (NO. OxyVita C is a promising oxygen-carrying solution that consists of a zero-linked hemoglobin polymer with a high molecular weight (~17 MDa. The large molecular weight is believed to prevent extravasation and limit NO scavenging and vasoconstriction. The aim of this study was to assess vasoactive effects of OxyVita C on systemic blood pressures and cerebral pial arteriole diameters. Anesthetized healthy rats received four intravenous (IV infusions of an increasing dose of OxyVita C (2, 25, 50, 100 mg/kg and hemodynamic parameters and pial arteriolar diameters were measured pre- and post-infusion. Normal saline was used as a volume-matched control. Systemic blood pressures increased (P ≤ 0.05 with increasing doses of OxyVita C, but not with saline. There was no vasoconstriction in small (<50 µm and medium-sized (50–100 µm pial arterioles in the OxyVita C group. In contrast, small and medium-sized pial arterioles vasoconstricted in the control group. Compared to saline, OxyVita C showed no cerebral vasoconstriction after any of the four doses evaluated in this rat model despite increases in blood pressure.
Murukarthick, Jayakodi; Sampath, Perumal; Lee, Sang Choon; Choi, Beom-Soon; Senthil, Natesan; Liu, Shengyi; Yang, Tae-Jin
2014-06-20
MITE, TRIM and SINEs are miniature form transposable elements (mTEs) that are ubiquitous and dispersed throughout entire plant genomes. Tens of thousands of members cause insertion polymorphism at both the inter- and intra- species level. Therefore, mTEs are valuable targets and resources for development of markers that can be utilized for breeding, genetic diversity and genome evolution studies. Taking advantage of the completely sequenced genomes of Brassica rapa and B. oleracea, characterization of mTEs and building a curated database are prerequisite to extending their utilization for genomics and applied fields in Brassica crops. We have developed BrassicaTED as a unique web portal containing detailed characterization information for mTEs of Brassica species. At present, BrassicaTED has datasets for 41 mTE families, including 5894 and 6026 members from 20 MITE families, 1393 and 1639 members from 5 TRIM families, 1270 and 2364 members from 16 SINE families in B. rapa and B. oleracea, respectively. BrassicaTED offers different sections to browse structural and positional characteristics for every mTE family. In addition, we have added data on 289 MITE insertion polymorphisms from a survey of seven Brassica relatives. Genes with internal mTE insertions are shown with detailed gene annotation and microarray-based comparative gene expression data in comparison with their paralogs in the triplicated B. rapa genome. This database also includes a novel tool, K BLAST (Karyotype BLAST), for clear visualization of the locations for each member in the B. rapa and B. oleracea pseudo-genome sequences. BrassicaTED is a newly developed database of information regarding the characteristics and potential utility of mTEs including MITE, TRIM and SINEs in B. rapa and B. oleracea. The database will promote the development of desirable mTE-based markers, which can be utilized for genomics and breeding in Brassica species. BrassicaTED will be a valuable repository for scientists
Near-infrared emission bands of TeH and TeD
Fink, E. H.; Setzer, K. D.; Ramsay, D. A.; Vervloet, M.
1989-11-01
High-resolution emission spectra of TeH and TeD have been obtained in the region 4200 to 3600 cm -1 using a Bomem DA3.002 Fourier transform spectrometer. Analyses are given for the 0-0 and 1-1 bands of the X 22Π{1}/{2}-X 12Π{3}/{2} system of TeH and for the 0-0 band of TeD. In addition the 2-0 vibrational overtone bands of 130TeH, 128TeH, and 126TeH are observed and analyzed. Accurate molecular constants are given for the first time.
Historiography and biography genre in the Vita Caligulae from Suetonius - some impressions
Directory of Open Access Journals (Sweden)
Danielle Lima
2010-06-01
Full Text Available This paper presents the reflections and the results of the Scientific Initiation Research about Vita Caligulae (Life of Caligula, from Suetonius (69/70 - 130? a.C. and his relation to the roman historiography. In our study, we start from the biography of Caligula emperor, named De Vita Caligulae, to analyze those generic aspects of the biography in the way to notice its features and how this biography is inserted in the historiographical roman tradition, to be known, as a way to write history or as a different genre. During the research, besides the translation of the biography, we realized a brief study about the roman historiography, as well as some considerations about the textual and stylish aspects of Suetonius.
Acute thyroid eye disease (TED): principles of medical and surgical management.
Verity, D H; Rose, G E
2013-03-01
The active inflammatory phase of thyroid eye disease (TED) is mediated by the innate immune system, and management is aimed at aborting this self-limited period of autoimmune activity. In most patients with TED, ocular and adnexal changes are mild and management involves controlling thyroid dysfunction, cessation of smoking, and addressing ocular surface inflammation and exposure. In patients with acute moderate disease, this being sufficient to impair orbital functions, immunosuppression reduces the long-term sequelae of acute inflammation, and adjunctive fractionated low-dose orbital radiotherapy is used as a steroid-sparing measure. Elective surgery is often required following moderate TED, be it for proptosis, diplopia, lid retraction, or to debulk the eyelid, and this should be delayed until the disease is quiescent, with the patient stable and weaned off all immunosuppression. Thus, surgical intervention during the active phase of moderate disease is rarely indicated, although clinical experience suggests that, where there is significant orbital congestion, early orbital decompression can limit progression to more severe disease. Acute severe TED poses a major risk of irreversible loss of vision due to marked exposure keratopathy, 'hydraulic' orbital congestion, or compressive optic neuropathy. If performed promptly, retractor recession with or without a suture tarsorrhaphy protects the ocular surface from severe exposure and, in patients not responding to high-dose corticosteroid treatment, decompression of the deep medial orbital wall and floor can rapidly relieve compressive optic neuropathy, as well as alleviate the inflammatory and congestive features of raised orbital pressure.
Li, Yubin; Harris, Linda; Dooner, Hugo K
2013-09-01
Mutator (Mu) elements, one of the most diverse superfamilies of DNA transposons, are found in all eukaryotic kingdoms, but are particularly numerous in plants. Most of the present knowledge on the transposition behavior of this superfamily comes from studies of the maize (Zea mays) Mu elements, whose transposition is mediated by the autonomous Mutator-Don Robertson (MuDR) element. Here, we describe the maize element TED (for Transposon Ellen Dempsey), an autonomous cousin that differs significantly from MuDR. Element excision and reinsertion appear to require both proteins encoded by MuDR, but only the single protein encoded by TED. Germinal excisions, rare with MuDR, are common with TED, but arise in one of the mitotic divisions of the gametophyte, rather than at meiosis. Instead, transposition-deficient elements arise at meiosis, suggesting that the double-strand breaks produced by element excision are repaired differently in mitosis and meiosis. Unlike MuDR, TED is a very low-copy transposon whose number and activity do not undergo dramatic changes upon inbreeding or outcrossing. Like MuDR, TED transposes mostly to unlinked sites and can form circular transposition products. Sequences closer to TED than to MuDR were detected only in the grasses, suggesting a rather recent evolutionary split from a common ancestor.
New high power CW klystrons at TED
Beunas, A; Marchesin, R
2003-01-01
Thales Electron Devices (TED) has been awarded a contract by CERN to develop and produce 20 units of the klystrons needed to feed the Large Hadrons Collider (LHC). Each of these delivers 300 kW of CW RF power at 400 MHz. Three klystrons have been delivered to CERN up to now.
Patterns of clusivity in TED Talks: When ‘ you ’ and ‘I’ become ‘ we’
Directory of Open Access Journals (Sweden)
Giuseppina Scotto di Carlo
2018-04-01
Full Text Available This paper is a qualitative and quantitative corpus-based study analysing the correlation of clusivity, tense, and modality patterns in TED (Technology, Entertainment, Design talks, which are popularising speeches aiming at knowledge dissemination among laypersons. Using a corpus composed of the TED Talks presented in 2012, the study investigates the ways in which TED speakers use first-person plural and singular pronouns when interacting with their audiences. The patterns of clusivity used in the corpus confirm one of the main characteristics of TED Talks, that is to say, the abolition of the ‘scientistmediator-audience’ triangulation, typical of canonical popularising genres. The inclusive pronouns used in the corpus construct positive politeness, making the audience feel part of the knowledge-spreading experience. The analysis also reveals how TED Talks are actually an ‘innovative’ means of popularisation, in which there is no longer a distinction between ‘I’, the speaker, and ‘you’, the audience. ‘I’ and ‘you’ become ‘we’, in a common project which invites the audience to take on specific attitudes and behaviours and concretely participate in changes.
THE ROLES OF TED TALKS AND VLOG IN ENHANCING STUDENTS‘ ACTIVENESS IN SPEAKING CLASS
Directory of Open Access Journals (Sweden)
Candradewi Wahyu Anggraeni
2017-12-01
Full Text Available The aims of this research are to describe the roles of TED Talks and Vlog in enhancing students‘ activeness in speaking class and to explain the students‘ perspectives toward the use of TED Talks and Vlog in speaking class. The research method used in this research is qualitative research design in the form of case study. The instruments of data collection are documents of students‘ vlog, observation, questionnaire, and interview. The participants of this research are the students of speaking class. This research has three significances which consist of theoretical, practical, and pedagogical significances. The theoretical significance is the research contributes to prove and add the speaking theories, whereas the practical significance is the research can be conducted by teachers, lecturers, or researchers to figure out the roles and the ways to improve students‘ participation in speaking class. In addition, the pedagogical significance shows that this research provides a reference of the use TED Talks and Vlog in enhancing students‘ activeness in speaking class, helps the students to be active in speaking class by following the lecturer‘s instruction toward the speaking activities given, and can be used as the empirical research finding toward students‘ activeness in speaking class. The findings show that TED Talks and Vlog have seven roles in order to help the students to be more active in speaking class and reveal the students‘ perceptions about virtues and hurdles toward the use of TED Talks and Vlog in speaking class.
THE VITA OF LAZAR OF MUROM AS A HISTORICAL SOURCE OF FYODOR GLINKA'S POEM KARELIA
Directory of Open Access Journals (Sweden)
Alexandr Mikhailovich Pashkov
2014-11-01
Full Text Available The article proves that one of the sources of Fyodor Glinka’s poem Karelia was the legend describing The Vita of Lazar of Murom — a Greek monk who founded the Murom Monastery of St. Assumption on the southeastern shore of Onega Lake in the middle of the 14th century. This fact has not been mentioned yet in any of the literature studies devoted to Glinka’s works. It is believed that The Vita of Lazar of Murom was created during the period between the late 14th and early 15th century. At the end of the 18th century this manuscript’s copy belonged to a high rank Petrozavodsk offi cial I. A. Pykhtin. In 1805, he consigned his copy of The Vita of Lazar of Murom to a well-known Petrozavodsk historian T. V. Balandin, who made another copy of it. Soon T.V. Balandin transferred his copy to a famous Orthodox church historian Evgenii (Bolkhovotinov, who in turn published this copy in 1813 in the 5th volume of his work The History of Russian Hierarchy. In 1826–1830, poet Fyodor Glinka was sent to exile in Petrozavodsk for having participated in the Decembrist movement. He met T. V. Balandin, read the text of The Vita of Lazar of Murom and included a story about a monk who had moved from Greece to Russia into his poem Karelia, published in 1830. Besides, the name of Saint Lazar is mentioned in the main text of the poem and twice in its footnotes. Glinka had a great intuitive feel for a language and noticed correlation between style and authenticity of the legend about Lazar’s life. So, The Vita of Lazar of Murom became one of the sources which inspired Fyodor Glinka to create his poem Karelia and to certain extent determined its content.
A tribute to Ted Henty (1915-2002)
Barker, W.R.; Conn, B.J.; Croft, J.R.; Gideon, O.G.
2002-01-01
Ted Henty, noted for his work in the Papua New Guinea National Herbarium (LAE), died aged 86 at East Keilor, near Melbourne on 23 February 2002 after an illness of 6-8 months. Those dealing with New Guinea plants will know of his extensive collections in the NGF and subsequent LAE series from all
Using TED Talks to Inspire Thoughtful Practice
Rubenstein, Lisa DaVia
2012-01-01
How can teacher educators provide relevant and important content in an educational environment that is rapidly evolving? TED.com is a website that provides content that meets these criteria in its mission of promoting "ideas that are worth spreading." Rather than ignoring the incredible access to the world's most innovative and dynamic speakers,…
Li, Yubin; Harris, Linda; Dooner, Hugo K.
2013-01-01
Mutator (Mu) elements, one of the most diverse superfamilies of DNA transposons, are found in all eukaryotic kingdoms, but are particularly numerous in plants. Most of the present knowledge on the transposition behavior of this superfamily comes from studies of the maize (Zea mays) Mu elements, whose transposition is mediated by the autonomous Mutator-Don Robertson (MuDR) element. Here, we describe the maize element TED (for Transposon Ellen Dempsey), an autonomous cousin that differs significantly from MuDR. Element excision and reinsertion appear to require both proteins encoded by MuDR, but only the single protein encoded by TED. Germinal excisions, rare with MuDR, are common with TED, but arise in one of the mitotic divisions of the gametophyte, rather than at meiosis. Instead, transposition-deficient elements arise at meiosis, suggesting that the double-strand breaks produced by element excision are repaired differently in mitosis and meiosis. Unlike MuDR, TED is a very low-copy transposon whose number and activity do not undergo dramatic changes upon inbreeding or outcrossing. Like MuDR, TED transposes mostly to unlinked sites and can form circular transposition products. Sequences closer to TED than to MuDR were detected only in the grasses, suggesting a rather recent evolutionary split from a common ancestor. PMID:24038653
Energy Technology Data Exchange (ETDEWEB)
Riva, A.; D' Angelosante, S.; Trebeschi, C. [Snam SpA, Rome (Italy)
2000-12-01
Life Cycle Assessment is a method aimed at identifying the environmental effects connected with a given product, process or activity during its whole life cycle. The evaluation of published studies and the application of the method to electricity production with fossil fuels, by using data from published databases and data collected by the gas industry, demonstrate the importance and difficulties to have reliable and updated data required for a significant life cycle assessment. The results show that the environmental advantages of natural gas over the other fossil fuels in the final use stage increase still further if the whole life cycle of the fuels, from production to final consumption, is taken into account. [Italian] L'analisi del ciclo di vita e' una metodologia che consente di identificare gli effetti ambientali associati ad un prodotto, processo o attivita' lungo il loro ciclo di vita. La valutazione di studi pubblicati e l'applicazione della metodologia alla produzione di energia elettrica da combustibili fossili, utilizzando dati provenienti da banche dati di letteratura e raccolti dall'industria del gas, dimostrano l'importanza e la difficolta' di avere a disposizione dati affidabili ed aggiornati, necessari per un'analisi significativa del ciclo di vita. I risultati mostrano che i vantaggi ambientali del gas naturale rispetto agli altri combustibili fossili nella fase di utilizzo finale, aumentano ulteriormente se si considera l'intero ciclo di vita dei diversi combustibili, dalla produzione al consumo finale.
Brese, Falk, Ed.
2012-01-01
This supplement contains documentation on all the derived variables contained in the TEDS-M educator and future teacher data files. These derived variables were used to report data in the TEDS-M international reports. The variables that constitute the scales and indices are made available as part of the TEDS-M International Database to be used in…
Per l’eutanasia. Note minime sul diritto a decidere della vita e della salute
Directory of Open Access Journals (Sweden)
Riccardo Conte
2013-02-01
Full Text Available Dopo aver ricordato che secondo recenti sentenze della Corte europea dei diritti dell’uomo «il diritto di un individuo a decidere in quale maniera e in quale momento la sua vita debba essere chiusa, a condizione che egli sia in grado di formare liberamente la sua volontà e il suo proposito d’agire in conseguenza, è uno degli aspetti della sua vita privata ai sensi dell’art. 8 della Convenzione»; e dopo aver illustrato le posizioni nel mondo cristiano di dissenso rispetto al Magistero ecclesiastico sul tema dell’eutanasia, l’Autore si sofferma ad esaminare disegni di legge presentati al Parlamento italiano per disciplinare la materia.
Ted Irving and the Arc of APW Paths
Kent, D. V.
2014-12-01
Ted Irving's last two published papers neatly encapsulate his seminal contributions to the delineation of ever-important apparent polar wander (APW) paths. His final (210th) paper [Creer & Irving, 2012 Earth Sciences History] describes in detail how Ken Creer and he when still graduate students at Cambridge started to generate and assemble paleomagnetic data for the first APW path, for then only the UK; the paper was published 60 years ago and happened to be Ted's first [Creer, Irving & Runcorn, 1954 JGE]. Only 10 years later, there was already a lengthy reference list of paleomagnetic results available from most continents that had been compiled in pole lists he published in GJRAS from 1960 to 1965 and included in an appendix in his landmark book "Paleomagnetism" [Irving, 1964 Wiley] in support of wide ranging discussions of continental drift and related topics in chapters like 'Paleolatitudes and paleomeridians.' A subsequent innovation was calculating running means of poles indexed to a numerical geologic time scale [Irving, 1977 Nature], which with independent tectonic reconstructions as already for Gondwana allowed constructions of more detailed composite APW paths. His 1977 paper also coined Pangea B for an earlier albeit contentious configuration for the supercontinent that refuses to go away. Gliding over much work on APW tracks and hairpins in the Precambrian, we come to Ted's penultimate (209th) paper [Kent & Irving, 2010 JGR] in which individual poles from short-lived large igneous provinces were grouped and most sedimentary poles, many rather venerable, excluded as likely to be biased by variable degrees of inclination error. The leaner composite APW path helped to resurrect the Baja BC scenario of Cordilleran terrane motions virtually stopped in the 1980s by APW path techniques that relied on a few key but alas often badly skewed poles. The new composite APW path also revealed several major features, such as a huge polar shift of 30° in 15 Myr in the
Validation of the VitaBit Sit–Stand Tracker: Detecting Sitting, Standing, and Activity Patterns
Directory of Open Access Journals (Sweden)
Nathalie M. Berninger
2018-03-01
Full Text Available Sedentary behavior (SB has detrimental consequences and cannot be compensated for through moderate-to-vigorous physical activity (PA. In order to understand and mitigate SB, tools for measuring and monitoring SB are essential. While current direct-to-customer wearables focus on PA, the VitaBit validated in this study was developed to focus on SB. It was tested in a laboratory and in a free-living condition, comparing it to direct observation and to a current best-practice device, the ActiGraph, on a minute-by-minute basis. In the laboratory, the VitaBit yielded specificity and negative predictive rates (NPR of above 91.2% for sitting and standing, while sensitivity and precision ranged from 74.6% to 85.7%. For walking, all performance values exceeded 97.3%. In the free-living condition, the device revealed performance of over 72.6% for sitting with the ActiGraph as criterion. While sensitivity and precision for standing and walking ranged from 48.2% to 68.7%, specificity and NPR exceeded 83.9%. According to the laboratory findings, high performance for sitting, standing, and walking makes the VitaBit eligible for SB monitoring. As the results are not transferrable to daily life activities, a direct observation study in a free-living setting is recommended.
2013-06-20
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 14519-000] Ted P. Sorenson; Notice of Preliminary Permit Application Accepted for Filing and Soliciting Comments, Motions To Intervene, and Competing Applications On May 1, 2013, Ted P. Sorenson filed an application for a preliminary permit, pursuant to section 4(f) of the...
Measurement of job motivation in TEDS-M: testing for invariance across countries and cultures
Laschke, Christin; Blömeke, Sigrid
2016-01-01
Abstract The paper presents the challenges of cross-country and cross-cultural research on the motivation to become a mathematics teacher based on data from the “Teacher Education and Development Study in Mathematics (TEDS-M)”. Referring to studies from cross-cultural psychology, measurement invariance (MI) of constructs representing different motivations to become a teacher was examined in confirmatory factor analysis (CFA) across the countries that participated in TEDS-M. The data supported...
International Nuclear Information System (INIS)
Amouyal, Gregory; Thiounn, Nicolas; Pellerin, Olivier; Yen-Ting, Lin; Giudice, Costantino Del; Dean, Carole; Pereira, Helena; Chatellier, Gilles; Sapoval, Marc
2016-01-01
BackgroundProstatic artery embolization (PAE) has been performed for a few years, but there is no report on PAE using the PErFecTED technique outside from the team that initiated this approach.ObjectiveThis single-center retrospective open label study reports our experience and clinical results on patients suffering from symptomatic BPH, who underwent PAE aiming at using the PErFecTED technique.Materials and MethodsWe treated 32 consecutive patients, mean age 65 (52–84 years old) between December 2013 and January 2015. Patients were referred for PAE after failure of medical treatment and refusal or contra-indication to surgery. They were treated using the PErFecTED technique, when feasible, with 300–500 µm calibrated microspheres (two-night hospital stay or outpatient procedure). Follow-up was performed at 3, 6, and 12 months.ResultsWe had a 100 % immediate technical success of embolization (68 % of feasibility of the PErFecTED technique) with no immediate complications. After a mean follow-up of 7.7 months, we observed a 78 % rate of clinical success. Mean IPSS decreased from 15.3 to 4.2 (p = .03), mean QoL from 5.4 to 2 (p = .03), mean Qmax increased from 9.2 to 19.2 (p = .25), mean prostatic volume decreased from 91 to 62 (p = .009) mL. There was no retrograde ejaculation and no major complication.ConclusionPAE using the PErFecTED technique is a safe and efficient technique to treat bothersome LUTS related to BPH. It is of interest to note that the PErFecTED technique cannot be performed in some cases for anatomical reasons
Energy Technology Data Exchange (ETDEWEB)
Amouyal, Gregory, E-mail: gregamouyal@hotmail.com; Thiounn, Nicolas, E-mail: nicolas.thiounn@aphp.fr; Pellerin, Olivier, E-mail: olivier.pellerin@aphp.fr [Université Paris Descartes - Sorbonne - Paris - Cité, Faculté de Médecine (France); Yen-Ting, Lin, E-mail: ymerically@gmail.com [Assistance Publique - Hôpitaux de Paris, Hôpital Européen Georges Pompidou, Interventional Radiology Department (France); Giudice, Costantino Del, E-mail: costantino.delgiudice@aphp.fr [Université Paris Descartes - Sorbonne - Paris - Cité, Faculté de Médecine (France); Dean, Carole, E-mail: carole.dean@aphp.fr [Assistance Publique - Hôpitaux de Paris, Hôpital Européen Georges Pompidou, Interventional Radiology Department (France); Pereira, Helena, E-mail: helena.pereira@aphp.fr [Assistance Publique - Hôpitaux de Paris, Hôpital Européen Georges Pompidou, Clinical Research Unit (France); Chatellier, Gilles, E-mail: gilles.chatellier@aphp.fr; Sapoval, Marc, E-mail: marc.sapoval2@aphp.fr [Université Paris Descartes - Sorbonne - Paris - Cité, Faculté de Médecine (France)
2016-03-15
BackgroundProstatic artery embolization (PAE) has been performed for a few years, but there is no report on PAE using the PErFecTED technique outside from the team that initiated this approach.ObjectiveThis single-center retrospective open label study reports our experience and clinical results on patients suffering from symptomatic BPH, who underwent PAE aiming at using the PErFecTED technique.Materials and MethodsWe treated 32 consecutive patients, mean age 65 (52–84 years old) between December 2013 and January 2015. Patients were referred for PAE after failure of medical treatment and refusal or contra-indication to surgery. They were treated using the PErFecTED technique, when feasible, with 300–500 µm calibrated microspheres (two-night hospital stay or outpatient procedure). Follow-up was performed at 3, 6, and 12 months.ResultsWe had a 100 % immediate technical success of embolization (68 % of feasibility of the PErFecTED technique) with no immediate complications. After a mean follow-up of 7.7 months, we observed a 78 % rate of clinical success. Mean IPSS decreased from 15.3 to 4.2 (p = .03), mean QoL from 5.4 to 2 (p = .03), mean Qmax increased from 9.2 to 19.2 (p = .25), mean prostatic volume decreased from 91 to 62 (p = .009) mL. There was no retrograde ejaculation and no major complication.ConclusionPAE using the PErFecTED technique is a safe and efficient technique to treat bothersome LUTS related to BPH. It is of interest to note that the PErFecTED technique cannot be performed in some cases for anatomical reasons.
In Hac Vita: Increasing Nordic Homeowners' Adaptive Capacity to Climate Change
DEFF Research Database (Denmark)
Neset, Tina; Linnér, Björn-Ola; Navarra, carlo
2013-01-01
The NordForsk funded research project In Hac Vita project is a collaboration between the Nordic insurance companies If, Gjensidige, Trygg-Hansa/ Codan and Tryg Insurance, and the Top-level Research Initiative the Nordic Centre of Excellence NORD-STAR. The project concerns climate change adaptatio...... to adapt to climate change and extreme weather effects....
Ted Hughes: The Development of a Children's Poet
Lockwood, Michael
2009-01-01
This article looks at how Ted Hughes' poetry for children developed over more than 30 years of publication. It traces the movement from his earlier, more conventional rhyming poems, such as "Meet My Folks!" (1961) and "Nessie the Mannerless Monster" (1964), to the mature, free verse "animal poems" for older readers of "Season Songs" (1976c),…
Slovenian diasporic literature in Canada and Ted Kramolc
Directory of Open Access Journals (Sweden)
Igor Maver
2014-12-01
Full Text Available The article analyzes the work and especially the novels by the Canadian writer of Slovenian descent, Ted Kramolc. It places him within the context of other diasporic literary authors in Canada as well as the Slovenian cultural space and discusses the critical response to his work, particularly in the period after Slovenian independence.
Stance in TED talks: Strategic use of subjective adjectives in online popularisation
Directory of Open Access Journals (Sweden)
Giuseppina Scotto di Carlo
2015-04-01
Full Text Available This paper analyses “stance” in TED (Technology, Entertainment, Design talks, which are popularising speeches aiming at knowledge dissemination. Based on a corpus of the TED talks presented between 2006 and 2012, this study focuses on how the speakers express judgments and take up positions through subjective adjectives. Drawing upon Kerbat-Orecchioni (1980 and Felices Lago’s (1997 adjective classifications, the quantitative and qualitative study attempts to analyse the use of axiological evaluative adjectives, which are fully subjective, as they imply a qualitative evaluation adding a judgement to the modified noun. It has been noticed that TEDsters use vivid, descriptive subjective adjectives to establish a connection with the audience, which perceives a sense of similarity with the speaker. Like traditional scientific presentations, TED talks use adjectives conveying the relevance of their findings, while they distinguish themselves for the role given to aesthetic and emotional adjectives, practicality and veracity, also including the moral, political, and economic aspects involved in science. The work suggests that maybe TEDsters’ approach to science might possibly contribute to breach the expert/non expert barrier, considering science not as something distant, but as a human experience for both laypersons and professionals.
TEDS Base Station Power Amplifier using Low-Noise Envelope Tracking Power Supply
DEFF Research Database (Denmark)
Høyerby, Mikkel Christian Wendelboe; Andersen, Michael A. E.
2009-01-01
This paper demonstrates a highly linear and efficient TETRA enhanced data service (TEDS) base-station RF power amplifier (RFPA). Based on the well-known combination of an envelope tracking (ET) power supply and a linear class-A/B RFPA, adequate adjacent channel power ratio (ACPR) and wideband noise...... experimentally with a 9.6-dB peak-to-average 50-kHz 16 quadrature amplitude modulation TEDS carrier, the setup providing 44-dBm (25 W) average RF output power at 400 MHz with 44% dc-to-RF efficiency state-of-the-art ACPR of less than ${-}$67 dBc, switching noise artifacts around ${-}$ 85 dBc, and an overall rms...
Brese, Falk, Ed.
2012-01-01
The goal for selecting the released set of test items was to have approximately 25% of each of the full item sets for mathematics content knowledge (MCK) and mathematics pedagogical content knowledge (MPCK) that would represent the full range of difficulty, content, and item format used in the TEDS-M study. The initial step in the selection was to…
Rogers, Tarsha
2017-01-01
TED Talks has become a worldwide phenomenon attended by many at its conferences, TEDx community-based events, TED.com, and YouTube videos. Previous studies have delved into TED Talks' impact in the educational sector, as it has been used by many educators and students alike in the classroom. Utilizing a qualitative exploratory approach, this study…
Fayers, Tessa; Dolman, Peter J
2011-12-01
To develop and test a user-friendly questionnaire for rapidly assessing quality of life (QOL) in thyroid eye disease (TED). A three-item questionnaire, the TED-QOL, was designed and compared to the 16-item Graves Ophthalmopathy (GO)-QOL and the nine-item GO-Quality of Life Scale (QLS). 100 patients with TED were administered all three questionnaires on two occasions. Results were compared to clinical severity scores (Vision, Inflammation, Strabismus, Appearance (VISA) classification). Main outcomes were construct and criterion validity, test-retest reliability, duration, comprehension and completion rates. TED-QOL correlated strongly with the other questionnaires for corresponding items (Pearson correlation: appearance 0.71, 0.62; functioning 0.69, 0.66; overall QOL 0.53). Test-retest analysis demonstrated good reliability for all three questionnaires (intraclass correlations: TED-QOL 0.81, 0.74, 0.87; GO-QOL 0.81, 0.82; GO-QLS 0.74, 0.86, 0.67). TED-QOL was significantly faster to complete (1.6 min vs GO-QOL 3.1 min, GO-QLS 2.7 min, p<0.0001) and had a higher completion rate (100% vs GO-QOL 78%, GO-QLS 94%). There was only moderate correlation between items on all three questionnaires and VISA scores. The TED-QOL is rapid and easy to complete and analyse and has similar validity and reliability to longer questionnaires. All questionnaires showed only moderate correlation with disease severity, emphasising the discrepancy between objective and subjective assessments and the importance of measuring both.
Combination TLD/TED dose assessment
International Nuclear Information System (INIS)
Parkhurst, M.A.
1992-11-01
During the early 1980s, an appraisal of dosimetry programs at US Department of Energy (DOE) facilities identified a significant weakness in dose assessment in fast neutron environments. Basing neutron dose equivalent on thermoluminescence dosimeters (TLDS) was not entirely satisfactory for environments that had not been well characterized. In most operational situations, the dosimeters overrespond to neutrons, and this overresponse could be further exaggerated with changes in the neutron quality factor (Q). Because TLDs are energy dependent with an excellent response to thermal and low-energy neutrons but a weak response to fast neutrons, calibrating the dosimetry system to account for mixed and moderated neutron energy fields is a difficult and seldom satisfactory exercise. To increase the detection of fast neutrons and help improve the accuracy of dose equivalent determinations, a combination dosimeter was developed using TLDs to detect thermal and low-energy neutrons and a track-etch detector (TED) to detect fast neutrons. By combining the albedo energy response function of the TLDs with the track detector elements, the dosimeter can nearly match the fluence-to-dose equivalent conversion curve. The polymer CR-39 has neutron detection characteristics superior to other materials tested. The CR-39 track detector is beta and gamma insensitive and does not require backscatter (albedo) from the body to detect the exposure. As part of DOE's Personnel Neutron and Upgrade Program, we have been developing a R-39 track detector over the past decade to address detection and measurement of fast neutrons. Using CR-39 TEDs in combination with TLDs will now allow us to detect the wide spectrum of occupational neutron energies and assign dose equivalents much more confidently
The Vita Activa as Compass: Navigating Uncertainty in Teaching with Hannah Arendt
Rogers, Carrie Ann Barnes
2010-01-01
This dissertation is an exploration of stories of uncertainty in the lives of elementary teachers and the value that the ideas of Hannah Arendt lend to the discussion around uncertainty. In "The Human Condition" (1958) Hannah Arendt theorizes the life of action, the "vita activa". Arendtian action is inherently uncertain because to be "capable of…
Locus pietatis et vitae II, Vranov u Brna 20.–22. 9. 2010
Czech Academy of Sciences Publication Activity Database
Freemanová, Michaela
2010-01-01
Roč. 47, č. 4 (2010), s. 407-409 ISSN 0018-7003. [Locus pietatis et vitae II. Vranov u Brna, 20.09.2010–22.09.2010] Institutional research plan: CEZ:AV0Z90580513 Keywords : history * monastic orders * conference Subject RIV: AL - Art, Architecture, Cultural Heritage
Hajek, Kathryn L.; Friesen, Paul D.
1998-01-01
TED (transposable element D) is an env-containing member of the gypsy family of retrotransposons that represents a possible retrovirus of invertebrates. This lepidopteran (moth) retroelement contains gag and pol genes that encode proteins capable of forming viruslike particles (VLP) with reverse transcriptase. Since VLP are likely intermediates in TED transposition, we investigated the roles of gag and pol in TED capsid assembly and maturation. By using constructed baculovirus vectors and TED Gag-specific antiserum, we show that the principal translation product of gag (Pr55gag) is cleaved to produce a single VLP structural protein, p37gag. Replacement of Asp436 within the retrovirus-like active site of the pol-encoded protease (PR) abolished Pr55gag cleavage and demonstrated the requirement for PR in capsid processing. As shown by expression of an in-frame fusion of TED gag and pol, PR is derived from the Gag-Pol polyprotein Pr195gag-pol. The PR cleavage site within Pr55gag was mapped to a position near the junction of a basic, nucleocapsid-like domain and a C-terminal acidic domain. Once released by cleavage, the C-terminal fragment was not detected. This acidic fragment was dispensable for VLP assembly, as demonstrated by the formation of VLP by C-terminal Pr55gag truncation proteins and replacement of the acidic domain with a heterologous protein. In contrast, C-terminal deletions that extended into the adjacent nucleocapsid-like domain of Pr55gag abolished VLP recovery and demonstrated that this central region contributes to VLP assembly or stability, or both. Collectively, these data suggest that the single TED protein p37gag provides both capsid and nucleocapsid functions. TED may therefore use a simple processing strategy for VLP assembly and genome packaging. PMID:9765414
TEDS-M 2008 User Guide for the International Database
Brese, Falk, Ed.
2012-01-01
The Teacher Education Study in Mathematics or TEDS-M is a study conducted under the aegis of the International Association for the Evaluation of Educational Achievement (IEA). The lead research center for the study is the International Study Center at Michigan State University (ISC/MSU). The ISC/MSU worked from 2006 to 2011 with the International…
Tassone, Daniela
2015-01-01
OBIETTIVO: Le fistole retto-vaginali Crohn-relate hanno un impatto significativo sulla qualità della vita. Quando il canale anale è alterato da ulcerazioni e stenosi o in pazienti con difetti estesi del perineo, la chirurgia locale produce risultati insoddisfacenti. Lo scopo di questo studio è quello di valutare l'efficacia della trasposizione del muscolo gracile nelle fistole retto-vaginali Crohn-relate e determinare i suoi effetti sulla qualità della vita. MATERIALI E METODI: Da gennaio...
2010-05-07
... correction to a notice of the Community Volunteer Income Tax Assistance (VITA) Matching Grant Program, which... DEPARTMENT OF THE TREASURY Internal Revenue Service Community Volunteer Income Tax Assistance... notice of the availability of application packages for the 2011 Community Volunteer Income Tax Assistance...
Murgich, Juan; Magaly, Santana R.; Diaz, Olga E.
The 14N NQR spectra of H bonded complexes of 1,4 diazabicyclo [2,2,2] octane, also known as triethylenediamine (TED), with phenol (1:2), p-chlorophenol (1:2), p-nitrophenol (1:2), hydroquinone (1:1), resorcinol (1:1) and thiourea (1:2) were observed at 77 K. The 14N frequency shifts produced by the H bonds in the TED complexes were approximately two times larger than those found for similar complexes of Hexamethylenetetramine (HMT). Such change was explained by the effect on the remaining N atoms of the increase in the number of -CH 2- groups and the decrease in N atoms in passing from HMT to TED. From the above results it seems that the inductive effect plays an important role in the formation of H bonds in tertiary amines like HMT and TED.
Direct Imaging of ER Calcium with Targeted-Esterase Induced Dye Loading (TED)
Samtleben, Samira; Jaepel, Juliane; Fecher, Caroline; Andreska, Thomas; Rehberg, Markus; Blum, Robert
2013-01-01
Visualization of calcium dynamics is important to understand the role of calcium in cell physiology. To examine calcium dynamics, synthetic fluorescent Ca2+ indictors have become popular. Here we demonstrate TED (= targeted-esterase induced dye loading), a method to improve the release of Ca2+ indicator dyes in the ER lumen of different cell types. To date, TED was used in cell lines, glial cells, and neurons in vitro. TED bases on efficient, recombinant targeting of a high carboxylesterase activity to the ER lumen using vector-constructs that express Carboxylesterases (CES). The latest TED vectors contain a core element of CES2 fused to a red fluorescent protein, thus enabling simultaneous two-color imaging. The dynamics of free calcium in the ER are imaged in one color, while the corresponding ER structure appears in red. At the beginning of the procedure, cells are transduced with a lentivirus. Subsequently, the infected cells are seeded on coverslips to finally enable live cell imaging. Then, living cells are incubated with the acetoxymethyl ester (AM-ester) form of low-affinity Ca2+ indicators, for instance Fluo5N-AM, Mag-Fluo4-AM, or Mag-Fura2-AM. The esterase activity in the ER cleaves off hydrophobic side chains from the AM form of the Ca2+ indicator and a hydrophilic fluorescent dye/Ca2+ complex is formed and trapped in the ER lumen. After dye loading, the cells are analyzed at an inverted confocal laser scanning microscope. Cells are continuously perfused with Ringer-like solutions and the ER calcium dynamics are directly visualized by time-lapse imaging. Calcium release from the ER is identified by a decrease in fluorescence intensity in regions of interest, whereas the refilling of the ER calcium store produces an increase in fluorescence intensity. Finally, the change in fluorescent intensity over time is determined by calculation of ΔF/F0. PMID:23685703
Direct imaging of ER calcium with targeted-esterase induced dye loading (TED).
Samtleben, Samira; Jaepel, Juliane; Fecher, Caroline; Andreska, Thomas; Rehberg, Markus; Blum, Robert
2013-05-07
Visualization of calcium dynamics is important to understand the role of calcium in cell physiology. To examine calcium dynamics, synthetic fluorescent Ca(2+) indictors have become popular. Here we demonstrate TED (= targeted-esterase induced dye loading), a method to improve the release of Ca(2+) indicator dyes in the ER lumen of different cell types. To date, TED was used in cell lines, glial cells, and neurons in vitro. TED bases on efficient, recombinant targeting of a high carboxylesterase activity to the ER lumen using vector-constructs that express Carboxylesterases (CES). The latest TED vectors contain a core element of CES2 fused to a red fluorescent protein, thus enabling simultaneous two-color imaging. The dynamics of free calcium in the ER are imaged in one color, while the corresponding ER structure appears in red. At the beginning of the procedure, cells are transduced with a lentivirus. Subsequently, the infected cells are seeded on coverslips to finally enable live cell imaging. Then, living cells are incubated with the acetoxymethyl ester (AM-ester) form of low-affinity Ca(2+) indicators, for instance Fluo5N-AM, Mag-Fluo4-AM, or Mag-Fura2-AM. The esterase activity in the ER cleaves off hydrophobic side chains from the AM form of the Ca(2+) indicator and a hydrophilic fluorescent dye/Ca(2+) complex is formed and trapped in the ER lumen. After dye loading, the cells are analyzed at an inverted confocal laser scanning microscope. Cells are continuously perfused with Ringer-like solutions and the ER calcium dynamics are directly visualized by time-lapse imaging. Calcium release from the ER is identified by a decrease in fluorescence intensity in regions of interest, whereas the refilling of the ER calcium store produces an increase in fluorescence intensity. Finally, the change in fluorescent intensity over time is determined by calculation of ΔF/F0.
L'arte della vita: biotecnologie e bioetica
Directory of Open Access Journals (Sweden)
Rosangela Maria Barcaro
2014-11-01
Full Text Available La bioarte è un’esperienza artistica che pone in relazione arte, scienza e biotecnologie esaminando da un nuovo punto di vista i concetti di vita, evoluzione, natura. L’idea rivoluzionaria alla base di tale esperienza è l’uso della materia organica vivente come mezzo espressivo, o medium, trattata con tecniche rese possibili dalle scoperte scientifico-tecnologiche più recenti.La bioarte si propone di avvicinare l’opinione pubblica alle problematiche generate da attività che plasmano il rapporto dell’uomo con le biotecnologie e di esplorare i timori che tali attività suscitano nella società.L’articolo descrive alcune opere realizzate da bioartisti internazionali, con l’intento di fornire un’analisi bioetica e non estetica di un fenomeno culturale che mostra numerose contraddizioni.
Ted Geballe: A lifetime of contributions to superconductivity
International Nuclear Information System (INIS)
Stewart, G.R.
2015-01-01
The editors have dedicated this special issue on superconducting materials “to Ted Geballe in honor of his numerous seminal contributions to the field of superconducting materials over more than 60 years, on the year of his 95th birthday.” Here, as an executive summary, are just a few highlights of his research in superconductivity, leavened with some anecdotes, and ending with some of Ted’s general insights and words of wisdom
Ted Geballe: A lifetime of contributions to superconductivity
Energy Technology Data Exchange (ETDEWEB)
Stewart, G.R.
2015-07-15
The editors have dedicated this special issue on superconducting materials “to Ted Geballe in honor of his numerous seminal contributions to the field of superconducting materials over more than 60 years, on the year of his 95th birthday.” Here, as an executive summary, are just a few highlights of his research in superconductivity, leavened with some anecdotes, and ending with some of Ted’s general insights and words of wisdom.
Qian, Hong; Youngs, Peter
2016-01-01
This article addresses the problem of how opportunities to learn in teacher education programs influence future elementary mathematics teachers' knowledge. This study used data collected for the Teacher Education and Development Study in Mathematics (TEDS-M). TEDS-M measured the mathematics content knowledge (MCK) and the mathematics pedagogical…
Zhang, Heng; Lan, Fang; Shi, Yupeng; Wan, Zhi-Gang; Yue, Zhen-Feng; Fan, Fang; Lin, Yan-Kui; Tang, Mu-Jin; Lv, Jing-Zhang; Xiao, Tan; Yi, Changqing
2014-06-15
VitaFast(®) test kits designed for the microbiological assay in microtiter plate format can be applied to quantitative determination of B-group water-soluble vitamins such as vitamin B12, folic acid and biotin, et al. Compared to traditional microbiological methods, VitaFast(®) kits significantly reduce sample processing time and provide greater reliability, higher productivity and better accuracy. Recently, simultaneous determination of vitamin B12, folic acid and biotin in one sample is urgently required when evaluating the quality of infant formulae in our practical work. However, the present sample preparation protocols which are developed for individual test systems, are incompatible with simultaneous determination of several analytes. To solve this problem, a novel "three-in-one" sample preparation method is herein developed for simultaneous determination of B-group water-soluble vitamins using VitaFast(®) kits. The performance of this novel "three-in-one" sample preparation method was systematically evaluated through comparing with individual sample preparation protocols. The experimental results of the assays which employed "three-in-one" sample preparation method were in good agreement with those obtained from conventional VitaFast(®) extraction methods, indicating that the proposed "three-in-one" sample preparation method is applicable to the present three VitaFast(®) vitamin test systems, thus offering a promising alternative for the three independent sample preparation methods. The proposed new sample preparation method will significantly improve the efficiency of infant formulae inspection. Copyright © 2013 Elsevier Ltd. All rights reserved.
"Being TED": The University Intellectual as Globalised Neoliberal Consumer Self
Shumar, Wesley
2016-01-01
This article focuses on the ways that modern American universities are engaged in the process of articulating new producing and consuming subjects. It argues that the image of the engaged "media celebrity" intellectual, as presented in the TED Talk model, has become a cultural ideal that reconciles a deeper contradiction in the academy.…
Parrhesia e forma-di-vita. Soggettivazione e desoggettivazione in Michel Foucault e Giorgio Agamben
Directory of Open Access Journals (Sweden)
Stefano Marchesoni
2013-04-01
Full Text Available Nei suoi libri recenti sotto il titolo principale "Homo sacer", Agamben si concentra sul concetto di forma-di-vita. Con questo articolo vorrei fornire una spiegazione del significato di questo concetto, sostenendo che le sue origini si possono far risalire alle "Vite degli uomini infami" di Foucault.
Corcodel, N; Rammelsberg, P; Jakstat, H; Moldovan, O; Schwarz, S; Hassel, A J
2010-11-01
Visual tooth colour assessment by use of the Vita 3D-Master(®) (3D; Vita Zahnfabrik, Bad Säckingen, Germany) is well documented. To improve handling, a new linear arrangement of the shade tabs has been introduced (LG; Linearguide 3D-Master(®) ). The purpose of this study was to investigate whether the linear design has an effect on shade matching. Fifty-six students underwent identical, theoretical and practical training, by use of an Internet learning module [Toothguide Training Software(®) (TT)] and a standardised training programme [Toothguide Training Box(®) (TTB)]. Each student then matched 30 randomly chosen shade tabs presented in an intra-oral setting by a standardised device [Toothguide Check Box(®) (TCB)]; 15 matches were made using the 3D and 15 using the LG shade guide system, under a daylight lamp (840 matches for each guide). It was recorded to what extent the presented and selected shade tabs, or the lightness group of the tabs, matched, also the needed time for colour matching. The results showed that 35% of perfect matches were observed for the 3D and 32% for the LG. The lightness group was correct in 59% of cases for 3D and 56% for LG. Mean time needed for matching of tabs and lightness group was no different between groups (no significant difference for any assessment). Within the limitations of the study design, the colour assessment with regard to performance and time needed in shade matching was not different with the LG or the 3D. Therefore, the user should choose which shade tab arrangement is more applicable. © 2010 Blackwell Publishing Ltd.
[Tracheotomy-endoscop for dilatational percutaneous tracheotomy (TED)].
Klemm, Eckart
2006-09-01
While surgical tracheotomies are currently performed using state-of-the-art operative techniques, percutaneous dilatational tracheostomy (PDT) is in a rapidly evolving state with regard to its technology and the number of techniques available. This has resulted in a range of new complications that are difficult to quantify on a scientific basis, given the fact that more than half of the patients who are tracheotomized in intensive care units die from their underlying disease. The new Tracheotomy Endoscope (TED) is designed to help prevent serious complications in dilatational tracheotomies and facilitate their management. The endoscope has been specifically adapted to meet the require-ments of percutaneous dilatational tracheotomies. It is fully compatible with all current techniques of PDT. The method is easy to learn. The percutaneous dilatational tracheotomy with the Tracheotomy Endoscope is a seven-step procedure: Advantages of the Tracheotomy Endoscope: Injuries to the posterior tracheal wall ar impossible (tracheoesophageal fistulas, pneumothorax). Minor bleeding sites on the tracheal mucosa can be controlled with a specially curved suction-coagulation tube introudeced through the Tracheotomy Endoscope. In cases with heavy bleeding and a risk of aspiration, the rigid indwelling Tracheotomy Endoscope provides a secure route for reintubating the patient with a cuffed endotracheal tube. It also allows for rapid conversion to an open surgical procedure if necessary. All the parts are easy to clean and are autoclavable. This type of endoscopically guided PDT creates an optimal link between the specialties of intensive care medicine and otorhinolaryngology. The Tracheotomy Endoscope (TED) increases the standard of safety in PDT.
Kühbeck, Felizian; Engelhardt, Stefan; Sarikas, Antonio
2014-01-01
Audience response (AR) systems are increasingly used in undergraduate medical education. However, high costs and complexity of conventional AR systems often limit their use. Here we present a novel AR system that is platform independent and does not require hardware clickers or additional software to be installed. "OnlineTED" was developed at Technische Universität München (TUM) based on Hypertext Preprocessor (PHP) with a My Structured Query Language (MySQL)-database as server- and Javascript as client-side programming languages. "OnlineTED" enables lecturers to create and manage question sets online and start polls in-class via a web-browser. Students can participate in the polls with any internet-enabled device (smartphones, tablet-PCs or laptops). A paper-based survey was conducted with undergraduate medical students and lecturers at TUM to compare "OnlineTED" with conventional AR systems using clickers. "OnlineTED" received above-average evaluation results by both students and lecturers at TUM and was seen on par or superior to conventional AR systems. The survey results indicated that up to 80% of students at TUM own an internet-enabled device (smartphone or tablet-PC) for participation in web-based AR technologies. "OnlineTED" is a novel web-based and platform-independent AR system for higher education that was well received by students and lecturers. As a non-commercial alternative to conventional AR systems it may foster interactive teaching in undergraduate education, in particular with large audiences.
Directory of Open Access Journals (Sweden)
Ghahramanloo A.
2004-06-01
Full Text Available Statement of Problem: Dental porcelain is one of the best materials ever used in dentistry. Excellent tissue"ncompatibility, esthetics, very low solubility in oral fluids, high compressive strength, and the lowest bacterial"nplaque accumulation on the glazed porcelain are some of its advantages. Porcelain brittleness due to its low"ntensile strength, impact strength and the occlusal attrition of opposing teeth enamel are some of its"ndisadvantages. The most important mechanical properties of dental porcelains are their flexural strength that is"nthe ability of a porcelain to resist fracture when loaded from above. Different ways have been proposed to"neliminate porcelain brittleness and develop its flexural strength, among which baking porcelain on a metal"nframework is more commonly used."nPurpose: Considering that restoration and replacement of teeth by porcelain fused to metal restorations is still"nthe most commonly used technique, the aim of the present study was to measure the flexural strength of a"nporcelain bonded to metal powder, D4 Dentin, and to compare it with Vita Dentin powder."nMaterials and Methods: In this experimental study, a stainless steel box, 25x5x2mm was made according to"nISO 6872: 1995 (E Standard and filled with D4 Dentin powder and Vita Dentin (VMK 68N and baked in"nVita furnace. Then 10 blocks of D^ Dentin and 10 of Vita Dentin were made. Samples were placed on the"nthree point bending test machine and force was applied the middle of each block. To analyze the data, t-"nstudent test and co-variance analysis were used."nResults: Mean flexural strength of D4 Dentin was 53.40±1.35 MPa and that of Vita Dentin was 53.86+7.38"nMPa. The difference was not statistically significant."nConclusion: According to ISO 6872: 1995 (E standard, the flexural strength of all D4 Dentin samples were"ngreater than 50 Mpa.
An update on TED gunshot detection system development status
Tidhar, Gil A.; Aphek, Ori; Gurovich, Martin
2009-05-01
In recent years the TED system has been under development, starting from new SWIR sensor technology, optics and real-time sensor technologies and following with complete system architecture as a soldier mounted optical gun shot detection system with high precision and imaging means. For the first time, the modules and the concept of operation of the system will be explained, with emphasis on new sensor-to-shooter capabilities. Actual field trial results will be shown.
Investigating Student Choices in Performing Higher-Level Comprehension Tasks Using TED
Bianchi, Francesca; Marenzi, Ivana
2016-01-01
The current paper describes a first experiment in the use of TED talks and open tagging exercises to train higher-level comprehension skills, and of automatic logging of the student's actions to investigate the student choices while performing analytical tasks. The experiment took advantage of an interactive learning platform--LearnWeb--that…
76 FR 56455 - DaVita, Inc.; Analysis of Agreement Containing Consent Orders To Aid Public Comment
2011-09-13
... personal information, like anyone's Social Security number, date of birth, driver's license number or other... include competitively sensitive information such as costs, sales statistics, inventories, formulas... competition between DaVita and DSI when negotiating rates charged by dialysis providers. As a result, the...
CURRICULUM VITAE: A DISCOURSE OF CELEBRATION WITH NARCISSISTIC ALLUSIONS
Directory of Open Access Journals (Sweden)
Yazid Basthomi
2012-01-01
Full Text Available The present study, a part of a larger project, deals with the under-researched (sub genre of curriculum vitae (CV of theses written in English by Indonesian students of English as a foreign language (EFL. The corpus was composed of CV of 40 theses obtainable from the Graduate Library, Graduate Program, Universitas Negeri Malang (State University of Malang, Indonesia. In a categorical structure, the CVs exhibit four main issues: personal information about age and familial origin, academic information pertaining to educational backgrounds, work information, and another piece of personal information, i.e., family. Central to the findings is that the CVs allude to the notion of celebration with narcissistic expressions.
Ingvarson, Lawrence; Schwille, John; Tatto, Maria Teresa; Rowley, Glenn; Peck, Ray; Senk, Sharon L.
2013-01-01
The Teacher Education and Development Study (TEDS-M) is the first crossnational study to examine the mathematics preparation of future teachers for both primary and secondary school levels. The study, conducted under the auspices of the International Association for the Evaluation of Educational Achievement (IEA), collected data from…
Directory of Open Access Journals (Sweden)
Jon Magne Vestøl
2016-04-01
Full Text Available Artikkelen tar utgangspunkt i utviklingsarbeid i ProTed, Senter for fremragende lærerutdanning, og bidrar til å belyse tre begreper av sentral betydning for utforming, utvikling og evaluering av lærerutdanning. Basert på teoriseminarer, strukturerte rapporter og annet empirisk materiale fra ProTeds utviklingsprosjekter presenterer artikkelen tre hovedbegrep: design, integrasjon og kvalitet. Design presenteres som en virksomhet, en dynamisk kompetanseutvikling hvor undervisning transformeres til læring. Kunnskapsintegrasjon forstås som et kjerne-element i et slikt design, og artikkelen utforsker ulike former for integrasjon. Artikkelen presenterer også et perspektiv på kvalitetsvurdering som legger vekt på performative og transformative aspekt ved den kompetanseutviklingen som genereres gjennom design-virksomheten.Nøkkelord: lærerutdanning, design, integrasjon, kvalitet, ProTedAbstractDrawing on the developmental work of ProTed, a Norwegian Centre of Excellence in Education, this article contributes to the understanding of three concepts of central importance for the construction, development and evaluation of teacher education. Based on material from theory seminars, structured reports and other data from ProTed’s development projects, the article presents an understanding of the concepts design, integration and quality. Design is presented as an activity, a dynamic competence development where teaching is transformed into learning. Knowledge integration is understood as a core element of this design, and different forms and aspects of integration are explored. An understanding of quality evaluation is presented that emphasises performative and transformative aspects of the competence development that is generated through the design activity.Keywords: teacher education, design, integration, quality, ProTed
Verhoye, Jean-Philippe; Belhaj Soulami, Reda; Fouquet, Olivier; Ruggieri, Vito Giovanni; Kaladji, Adrien; Tomasi, Jacques; Sellin, Michel; Farhat, Fadi; Anselmi, Amedeo
2017-10-01
Our goal was to evaluate the operative outcomes of the frozen elephant trunk technique using the E-Vita Open Plus® hybrid prosthesis in chronic aortic arch diseases and report clinical and radiological outcomes at the 1-year follow-up. As determined from a prospective multicentre registry, 94 patients underwent frozen elephant trunk procedures using the E-Vita Open Plus hybrid device for the treatment of chronic aortic conditions, including 50% chronic aortic dissections, 40% degenerative aneurysms and 10% miscellaneous indications. Fifty percent of the cases were reoperations. The perioperative mortality rate was 11.7%. Spinal cord ischaemia and stroke rates were 4% and 9.6%, respectively. The mean cardiopulmonary bypass time was 252 ± 97 min, cardiac ischaemia time was 152 ± 53 min and cerebral perfusion time was 82 ± 22 min. Concomitant procedures were observed in 15% of patients. Among the 83 surviving patients, the survival rate after the 1-year follow-up was 98%. Eleven percent of patients underwent endovascular completion, whereas 4% of patients required aortic reintervention at 1 year. The E-Vita Open Plus hybrid device confirms the favourable short- and mid-term outcomes offered by its predecessor in frozen elephant trunk procedures in patients with chronic aortic arch disease. Implantation of the E-Vita Open Plus is associated with good 1-year survival rates, good rates of favourable aortic remodelling in both chronic dissection and degenerative aneurysms and a reproducible technique in a multicentre registry. Continued follow-up is required due to the risk of evolution at the downstream aorta. © The Author 2017. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.
Magnetic properties of a metal-organic porous network [Ni2(BODC)2(TED)
Yuen, Tan; Danilovic, D.; Li, Kunhao; Li, Jing
2008-04-01
A new material [Ni2(BODC)2(TED)], (BODC =4,4'-bicyclo[2.2.2]octane dicarboxylate and TED =triethylene-4,4'-diamine), which is a guest-free, porous metal-organic coordination network, has been successfully synthesized. The crystal structure of this compound is tetragonal with the space group P4/mmm. It is a three-dimensional network that can be deconstructed into rectangular gridlike layers along ab planes. These planes are formed by BODC and Zn2O4 paddle-wheel-like clusters, and the TED ligands from the axial directions of the paddle-wheels connect the layers into a three-dimesional structure. There are no guest molecules found in the pores. The shortest Ni-Ni distance within the paddle wheel is found to be 2.613Å. Magnetic susceptibility χ(T )=M(T)/H and isothermal magnetization M(H ) measurements have been measured on powder samples of this compound. The results of χ(T ) show that there is a rapid increase in the susceptibility below 20K due to a spontaneous ordering of the Ni2+ moments. The effective moment μeff of Ni2+ is about 2.20μB at room temperature. The M(H ) result at 1.8K shows a clear hysteresis with a coercivity of Hcoe≈1700G. The behavior of this compound is discussed in terms of Ni-Ni coupling within the Ni dimers and dimer chains.
Substance Abuse Treatment Admissions Aged 12 to 14. The TEDS Report
Substance Abuse and Mental Health Services Administration, 2011
2011-01-01
This report uses data from the Treatment Episode Data Set (TEDS) for 2008 to provide information on the characteristics of youths aged 12 to 14 admitted to substance abuse treatment. In 2008, approximately 23,770 substance abuse treatment admissions were adolescents aged 12 to 14. The two most frequently reported primary substances of abuse among…
Normet, Sirje
2006-01-01
Kanada heliloojast Ted Dawsonist, sidemetsest Eestiga, tema vokaaltsükli "Andres Ehin Cycle" esiettekandest Pärnu orelifestivalil ja klaverikontserdi "Wisteria" Euroopa esiettekandest Vilniuses toimunud ning 28. augustil lõppenud kirikumuusika festivali "St Christophoruse Festival" lõppkontserdil. Klaverikontserdi esitasid Aleksandra Juozapenaite-Eesmaa ja festivali kammerorkester Donatas Katkuse juhatusel
Naser, Belal; Bodinet, Cornelia; Tegtmeier, Martin; Lindequist, Ulrike
2005-01-01
Arbor vitae (Thuja occidentalis L.) is a native European tree widely used in homeopathy and evidence-based phytotherapy. Many reviews and monographs have been published on the herbal substance's description, mode of action and clinical use. However, no comprehensive evidence-based review is available. Therefore, our aim was to search MEDLINE databases and survey manufacturers for further details or unpublished data. This review presents the botany, ethnobotany and phytochemistry, especial...
Directory of Open Access Journals (Sweden)
Manuela Ladogana
2007-03-01
Full Text Available Il volume, denso di contenuti e ricco di riferimenti teorici, traccia con chiarezza le sue linee di sviluppo ed apre alla riflessione, anche pedagogica, sull’esigenza di recuperare la dimensione narrativa e autobiografica per la realizzazione di una pratica orientativa che guidi e sostenga il soggetto in orientamento verso la riscoperta e ricostruzione del proprio progetto di vita.
Directory of Open Access Journals (Sweden)
Lyla Anggerwina Kusuma
2017-10-01
Full Text Available In applying communicative competence that became the utmost teaching method in teaching English program, the lecturers found the fact that the Islamic communication students are apparently reluctant to speak and communicate their ideas confidently. It happens because they thought that they do not know what they are going to say and how they are going to say their ideas. By knowing these problems the lecturers then tried to analyze the sequences of Islamic-content-TED and integrate those public speaking sequences from TED talks to STID Al-Hadid’s students to give an understanding and also to improve the confidence and quality in delivering public speaking speech for the sophomore students who are majoring Islamic Communication & Broadcasting. For further, in order to master this skill, students are also expected to find noble ideas to be shared in their personal public speaking. This action research study then found out that having sharing the sequences of TED talks, the student’s public speaking productions are more organized and powerful moreover; the fluency and also the student’s accuracy of the students could be controlled well.
Schwille, John, Ed.; Ingvarson, Lawrence, Ed.; Holdgreve-Resendez, Richard, Ed.
2013-01-01
The IEA Teacher Education and Development Study in Mathematics (TEDS-M) is the first large-scale international study of the preparation of primary and lower-secondary teachers. The study investigated the pedagogical and subject-specific knowledge that future primary and lower secondary school teachers acquire during their mathematics teacher…
TED runu video vidusskolēnu prezentācijas prasmju uzlabošanai angļu valodas stundās
Ozoliņa, Inga
2013-01-01
Diplomdarba mērķis bija noskaidrot, kā uzlabot prezentācijas prasmes, pielietojot TED runu video analīzi. Izvēlētā pētījuma metode bija gadījuma analīze Rīgas Angļu Ģimnāzijas 11. klasē. Datu vākšanas metodes bija skolēnu veidotie kritēriju saraksti, prezentācijas vērtēšanas lapa, intervija ar skolotāju un aptauja 11. klases skolēniem. Pētījuma rezultāti parādīja, ka lielākā daļa skolēnu izbaudīja darbu ar TED runām. Skolotāja atzina, ka ,skatoties un analizējot TED runas, ir iespējams...
Using the Curriculum Vita To Study the Career Paths of Scientists and Engineers: An Assessment.
Lane, Eliesh O'Neil; Dietz, James S.; Chompalov, Ivan; Bozeman, Barry; Park, Jongwon
The usefulness of the curriculum vita (CV) as a data source for examining the career paths of scientists and engineers was studied. CVs were obtained in response to an e-mail message sent to researchers working in the area of biotechnology who were funded by the National Science Foundation (55 responses) or listed as authors (industry only) in the…
Ted Madden's Network Methods: Applications to the Earth's Schumann Resonances
Williams, E. R.; Yu, H.
2014-12-01
Ted Madden made clever use of electrical circuit concepts throughout his long career in geophysical research: induced polarization, DC resistivity, magnetotellurics, Schumann resonances, the transport properties of rocks and even elasticity and the brittle failure of stressed rocks. The general methods on network analogies were presented in a terse monograph (Madden, 1972) which came to be called "The Grey Peril" by his students, named more for the challenge of deciphering the material as for the color of its cover. This talk will focus on Ted's first major use of the transmission line analogy in treating the Earth's Schumann resonances. This approach in Madden and Thompson (1965) provided a greatly simplified two-dimensional treatment of an electromagnetic problem with a notable three-dimensional structure. This skillful treatment that included the role of the Earth's magnetic field also led to predictions that the Schumann resonance energy would leak into space, predictions that have been verified nearly 50 years later in satellite observations. An extension of the network analogy by Nelson (1967) using Green's function methods provides a means to treat the inverse problem for the background Schumann resonances for the global lightning activity. The development of Madden's methods will be discussed along with concrete results based on them for the monitoring of global lightning.
Xu, William W.; Pramanik, Sanhita; Zhang, Zhijuan; Emge, Thomas J.; Li, Jing
2013-04-01
Carbon dioxide is a greenhouse gas that is a major contributor to global warming. Developing methods that can effectively capture CO2 is the key to reduce its emission to the atmosphere. Recent research shows that microporous metal organic frameworks (MOFs) are emerging as a promising family of adsorbents that may be promising for use in adsorption based capture and separation of CO2 from power plant waste gases. In this work we report the synthesis, crystal structure analysis and pore characterization of two microporous MOF structures, [M2(hfipbb)2(ted)] (M=Zn (1), Co (2); H2hfipbb=4,4-(hexafluoroisopropylidene)-bis(benzoic acid); ted=triethylenediamine). The CO2 and N2 adsorption experiments and IAST calculations are carried out on [Zn2(hfipbb)2(ted)] under conditions that mimic post-combustion flue gas mixtures emitted from power plants. The results show that the framework interacts with CO2 strongly, giving rise to relatively high isosteric heats of adsorption (up to 28 kJ/mol), and high adsorption selectivity for CO2 over N2, making it promising for capturing and separating CO2 from CO2/N2 mixtures.
Non-surgical treatment for eyelid retraction in thyroid eye disease (TED).
Grisolia, Ana Beatriz Diniz; Couso, Ricardo Christopher; Matayoshi, Suzana; Douglas, Raymond S; Briceño, César Augusto
2017-08-09
Thyroid eye disease (TED) is an autoimmune condition with an unpredictable course that may lead to permanent facial disfigurement. Eyelid retraction is one of the most common findings, and frequently demands attention due to ocular exposure and impaired cosmesis. Surgical treatment remains the most effective option, but there is a role for temporary corrections during the active phase of the disease, as well as in patients who are poor surgical candidates. The aim of this review is to describe the non-surgical modalities currently available for treatment of eyelid malposition in TED. The authors have focused on the use of hyaluronic acid, triamcinolone injections and botulinum toxin type A as non-surgical treatment alternatives, paying special attention to dosing, technique, efficacy and duration of effect. Non-surgical treatment modalities may represent viable in cases where surgical correction is not an option. Although temporary, these modalities appear to be beneficial for ocular exposure remediation, improving quality of life and broadening our therapeutic arsenal. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
50 CFR Figure 15 to Part 223 - Weedless TED Brace Bar Description
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Weedless TED Brace Bar Description 15 Figure 15 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 15 Figure 15 to Part 223...
La vita di un economista. (The life of an economist
Directory of Open Access Journals (Sweden)
C.P. KINDLEBERGER
2013-12-01
Full Text Available Il documento è un contributo ad una serie di ricordi e riflessioni sulle esperienze professionali di illustri economisti per Banca Nazionale del Lavoro Quarterly Review iniziate nel 1979. In esso Charles P. Kindleberger riflette sulla sua vita e la sua carriera , dai suoi anni formativi a sua esperienze nel mondo accademico .The paper is a contribution to a series of recollections and reflections on the professional experiences of distinguished economists which the Banca Nazionale del Lavoro Quarterly Review started in 1979. In it Charles P. Kindleberger reflects on his life and career, from his formative years to his experiences in academia.JEL: B31, A20
Lohmann, Gabriele; Stelzer, Johannes; Zuber, Verena; Buschmann, Tilo; Margulies, Daniel; Bartels, Andreas; Scheffler, Klaus
2016-01-01
The formation of transient networks in response to external stimuli or as a reflection of internal cognitive processes is a hallmark of human brain function. However, its identification in fMRI data of the human brain is notoriously difficult. Here we propose a new method of fMRI data analysis that tackles this problem by considering large-scale, task-related synchronisation networks. Networks consist of nodes and edges connecting them, where nodes correspond to voxels in fMRI data, and the weight of an edge is determined via task-related changes in dynamic synchronisation between their respective times series. Based on these definitions, we developed a new data analysis algorithm that identifies edges that show differing levels of synchrony between two distinct task conditions and that occur in dense packs with similar characteristics. Hence, we call this approach "Task-related Edge Density" (TED). TED proved to be a very strong marker for dynamic network formation that easily lends itself to statistical analysis using large scale statistical inference. A major advantage of TED compared to other methods is that it does not depend on any specific hemodynamic response model, and it also does not require a presegmentation of the data for dimensionality reduction as it can handle large networks consisting of tens of thousands of voxels. We applied TED to fMRI data of a fingertapping and an emotion processing task provided by the Human Connectome Project. TED revealed network-based involvement of a large number of brain areas that evaded detection using traditional GLM-based analysis. We show that our proposed method provides an entirely new window into the immense complexity of human brain function.
Directory of Open Access Journals (Sweden)
Gabriele Lohmann
Full Text Available The formation of transient networks in response to external stimuli or as a reflection of internal cognitive processes is a hallmark of human brain function. However, its identification in fMRI data of the human brain is notoriously difficult. Here we propose a new method of fMRI data analysis that tackles this problem by considering large-scale, task-related synchronisation networks. Networks consist of nodes and edges connecting them, where nodes correspond to voxels in fMRI data, and the weight of an edge is determined via task-related changes in dynamic synchronisation between their respective times series. Based on these definitions, we developed a new data analysis algorithm that identifies edges that show differing levels of synchrony between two distinct task conditions and that occur in dense packs with similar characteristics. Hence, we call this approach "Task-related Edge Density" (TED. TED proved to be a very strong marker for dynamic network formation that easily lends itself to statistical analysis using large scale statistical inference. A major advantage of TED compared to other methods is that it does not depend on any specific hemodynamic response model, and it also does not require a presegmentation of the data for dimensionality reduction as it can handle large networks consisting of tens of thousands of voxels. We applied TED to fMRI data of a fingertapping and an emotion processing task provided by the Human Connectome Project. TED revealed network-based involvement of a large number of brain areas that evaded detection using traditional GLM-based analysis. We show that our proposed method provides an entirely new window into the immense complexity of human brain function.
The Help-line "Invito alla Vita": a new project for suicide prevention in Trentino region.
Di Napoli, Wilma; Andreatta, Olaf
2014-11-01
"Invito alla Vita" is a community-based suicide prevention project that officially started in Trentino in late 2008. The project was promoted by the local Health Services, trying from the beginning to involve other community subjects, and has been working over five years and a half in different directions, particularly promoting a phone help-line. The aims of the Invito alla Vita (IaV) Help Line have been clear from the beginning: decrease the sense of loneliness, offer encouragement and support, promote engagement with health services, reduce stigma and prejudice. Contrary to popular misconceptions, talking with people about suicide will not increase suicide risk, neither will it induce patients to commit suicide.The volunteers involved in the IaV help-line offer people empathic listening without judgment and easy tips, to reduce loneliness, sadness and supply reassurance that other people care. In this study we tried to deepen our knowledges about the volunteers' motivations and necessities to use them for creating a better system of support: we realized indeed that continuous training and supervision, along with official awards given by community institutions, are basic factors to sustain the volunteers' motives to cooperate with the help line.
Assessment of Color Changes in Vita 3D-Master Shade Guide after Sterilization and Disinfection
Directory of Open Access Journals (Sweden)
Hossein Dashti
2017-06-01
Full Text Available Purpose:Dental shade guides are commonly used for color determination and should be disinfected and sterilized. The purpose of this study was to evaluate the color change of Vita 3D Master shade tabs after disinfection and sterilization. Material and methods:Overall, 98 samples (shade tabs were randomly selected from 14 new, unused Vita 3D sets, including the following shades: 2M1, 3L1.5, 3M1, 3M2, 3M3, 3R1.5 and 4M1. In each set, values of 2, 3 and 4, chroma of 1, 2 and 3 and hue were selected for the comparison of different shades. All tabs were measured using the Vita Easyshade device at baseline. The first group was disinfected with Deconex and the second group was sterilized by autoclaving in a simulated annual application. All the tabs were measured again using the same device. This process was repeated to simulate 2 and 3 years of usage. Statistical analysis was conducted by repeated measures analysis of variance (ANOVA and independent t-test and paired sample t-test. Results:In the disinfected group, we observed significant differences in value and chroma in all periods (p˂0.001. However, hue showed no significant difference after the first year of simulated treatment (p=0.527, though it was significantly different in the second and third simulations (p˂0.001. In the sterilized group, all variables showed a significant difference for each year (p˂0.05. Considering total color difference (ΔE, there was a significant difference between the two groups in the first, second and third simulated years; ΔE increased in the sterilized group more than in the disinfected samples (p˂0.001. Conclusions: The color change of shade tabs was significant both after disinfection by a chemical solution and by sterilization through autoclaving. However, although disinfectants may not have a clinically important effect, sterilization should be considered as an interfering factor during color-matching procedure.
Endo, Satoshi; Iwamoto, Kuninori; Fukuda, Hiroo
2018-02-01
Tissue-specific overexpression of useful genes, which we can design according to their cause-and-effect relationships, often gives valuable gain-of-function phenotypes. To develop genetic tools in woody biomass engineering, we produced a collection of Arabidopsis lines that possess chimeric genes of a promoter of an early xylem differentiation stage-specific gene, Arabidopsis Tracheary Element Differentiation-related 4 (AtTED4) and late xylem development-associated genes, many of which are uncharacterized. The AtTED4 promoter directed the expected expression of transgenes in developing vascular tissues from young to mature stage. Of T2 lines examined, 42%, 49% and 9% were judged as lines with the nonrepeat type insertion, the simple repeat type insertion and the other repeat type insertion of transgenes. In 174 T3 lines, overexpression lines were confirmed for 37 genes, whereas only cosuppression lines were produced for eight genes. The AtTED4 promoter activity was high enough to overexpress a wide range of genes over wild-type expression levels, even though the wild-type expression is much higher than AtTED4 expression for several genes. As a typical example, we investigated phenotypes of pAtTED4::At5g60490 plants, in which both overexpression and cosuppression lines were included. Overexpression but not cosuppression lines showed accelerated xylem development, suggesting the positive role of At5g60490 in xylem development. Taken together, this study provides valuable results about behaviours of various genes expressed under an early xylem-specific promoter and about usefulness of their lines as genetic tools in woody biomass engineering. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
Lohmann, Gabriele; Stelzer, Johannes; Zuber, Verena; Buschmann, Tilo; Margulies, Daniel; Bartels, Andreas; Scheffler, Klaus
2016-01-01
The formation of transient networks in response to external stimuli or as a reflection of internal cognitive processes is a hallmark of human brain function. However, its identification in fMRI data of the human brain is notoriously difficult. Here we propose a new method of fMRI data analysis that tackles this problem by considering large-scale, task-related synchronisation networks. Networks consist of nodes and edges connecting them, where nodes correspond to voxels in fMRI data, and the weight of an edge is determined via task-related changes in dynamic synchronisation between their respective times series. Based on these definitions, we developed a new data analysis algorithm that identifies edges that show differing levels of synchrony between two distinct task conditions and that occur in dense packs with similar characteristics. Hence, we call this approach “Task-related Edge Density” (TED). TED proved to be a very strong marker for dynamic network formation that easily lends itself to statistical analysis using large scale statistical inference. A major advantage of TED compared to other methods is that it does not depend on any specific hemodynamic response model, and it also does not require a presegmentation of the data for dimensionality reduction as it can handle large networks consisting of tens of thousands of voxels. We applied TED to fMRI data of a fingertapping and an emotion processing task provided by the Human Connectome Project. TED revealed network-based involvement of a large number of brain areas that evaded detection using traditional GLM-based analysis. We show that our proposed method provides an entirely new window into the immense complexity of human brain function. PMID:27341204
Measurement of Job Motivation in TEDS-M: Testing for Invariance across Countries and Cultures
Laschke, Christin; Blömeke, Sigrid
2016-01-01
The paper presents the challenges of cross-country and cross-cultural research on the motivation to become a mathematics teacher based on data from the "Teacher Education and Development Study in Mathematics" ("TEDS-M"). Referring to studies from cross-cultural psychology, measurement invariance (MI) of constructs representing…
Measurement of job motivation in TEDS-M: testing for invariance across countries and cultures
Directory of Open Access Journals (Sweden)
Christin Laschke
2016-09-01
Full Text Available Abstract The paper presents the challenges of cross-country and cross-cultural research on the motivation to become a mathematics teacher based on data from the “Teacher Education and Development Study in Mathematics (TEDS-M”. Referring to studies from cross-cultural psychology, measurement invariance (MI of constructs representing different motivations to become a teacher was examined in confirmatory factor analysis (CFA across the countries that participated in TEDS-M. The data supported metric invariance which means that comparing relationships between motivation and other constructs across countries is permitted, with the exception of extrinsic motivation in Taiwan. Scalar invariance was not supported by the data across countries but across cultures: Scale means can be compared between Germany, Switzerland and (with regard to intrinsic motivation Norway and Poland as well as between Singapore and Taiwan (with regard to the intrinsic motivation and Malaysia, Philippines and Thailand (again regarding intrinsic motivation.
Leveraging Automatic Speech Recognition Errors to Detect Challenging Speech Segments in TED Talks
Mirzaei, Maryam Sadat; Meshgi, Kourosh; Kawahara, Tatsuya
2016-01-01
This study investigates the use of Automatic Speech Recognition (ASR) systems to epitomize second language (L2) listeners' problems in perception of TED talks. ASR-generated transcripts of videos often involve recognition errors, which may indicate difficult segments for L2 listeners. This paper aims to discover the root-causes of the ASR errors…
International Nuclear Information System (INIS)
Baraboj, V.A.; Lobasyuk, B.O.; Oleksyijenko, N.O.; Kujev, V.L.; Goncharov, M.Yi.; Smul's'kij, S.P.; Kolker, Yi.A.; Babov, K.D.
1996-01-01
The study involved four groups of female Wistar rats. Protective anti radiation action of 'Vin-Vita' food additive solution in 'Kuyalnik' mineral water especially in the concentration of 500 mg/l has been revealed, which was proved by hemoglobin, hematocrit, ESR, white blood parameters and animal behaviour
Laban-Gučeva, Nevenka; Antova, Magdalena; Bogoev, Milco
2007-01-01
TED is a severe eye disease leading in rare cases to decrease of sight, optic nerve compression and blindness. Recently, significant progresses in understanding the disease have been done. Nevertheless, the treatment of the disease, especially in its severe form remains challenging. Glucocorticoids (GC) have been the basis of the treatment for a long time. Orbital irradiation (OI) and optical decompression (OD) are also used in managing the severe forms of TED. Somatostatin, intravenous immunoglobulin have been also used, with conflicting results. Regarding the potential for the treatment of TED with cytokine antagonists, controlled clinical studies are not available. Since cytokines play an important role in the pathogenesis of the TED, they seemed to be logical choice for modern TED treatment. It has been shown that both Th1 (interleukin-2, tumor necrosis factor γ, interleukin γ) and Th2 (interleukin-4,-5-,-10) profile T cells are activated in the TED. We therefore measured interleukin-γ, IF-γ and interleukin -10 (IL-10)(Th1 and Th2 pattern) to assess its relationship to the course of the disease. This paper shows that both Th1 (Il-2) and Th2 (If-γ) pathways represented by those two cytokines are not involved (Il-10 before 2,29±5,23 and after treatment 3,77±8,44; IF γ before 0,50±0,24 and after treatment 0,35±0,19). No relationship to the response to treatment was found. GC resulted in positive response in 8/22 patients, OI (12 patients) given after CS therapy, resulted in a response in all patients. Increase in proptosis, loss of visual acuity is spite of CS treatment prompted OD in two patients, who both recovered visual acuity and proptosis fell under 25mm Hertel. PMID:18039196
Laban-Guceva, Nevenka; Antova, Magdalena; Bogoev, Milco
2007-11-01
TED is a severe eye disease leading in rare cases to decrease of sight, optic nerve compression and blindness. Recently, significant progresses in understanding the disease have been done. Nevertheless, the treatment of the disease, especially in its severe form remains challenging. Glucocorticoids (GC) have been the basis of the treatment for a long time. Orbital irradiation (OI) and optical decompression (OD) are also used in managing the severe forms of TED. Somatostatin, intravenous immunoglobulin have been also used, with conflicting results. Regarding the potential for the treatment of TED with cytokine antagonists, controlled clinical studies are not available. Since cytokines play an important role in the pathogenesis of the TED, they seemed to be logical choice for modern TED treatment. It has been shown that both Th1 (interleukin-2, tumor necrosis factor gamma, interleukin gamma) and Th2 (interleukin -4, -5, -10) profile T cells are activated in the TED. We therefore measured interleukin-gamma, IF-gamma and interleukin -10 (IL-10)(Th1 and Th2 pattern) to assess its relationship to the course of the disease. This paper shows that both Th1 (IL-2) and Th2 (IF-gamma) pathways represented by those two cytokines are not involved (IL-10 before 2.29+/-5.23 and after treatment 3.77+/-8.44; IF gamma before 0.50+/-0.24 and after treatment 0.35+/-0.19). No relationship to the response to treatment was found. GC resulted in positive response in 8/22 patients, OI (12 patients) given after CS therapy, resulted in a response in all patients. Increase in proptosis, loss of visual acuity is spite of CS treatment prompted OD in two patients, who both recovered visual acuity and proptosis fell under 25 mm Hertel.
Directory of Open Access Journals (Sweden)
Nevenka Laban-Gučeva
2008-11-01
Full Text Available TED is a severe eye disease leading in rare cases to decrease of sight, optic nerve compression and blindness. Recently, significant progresses in understanding the disease have been done. Nevertheless, the treatment of the disease, especially in its severe form remains challenging. Glucocorticoids (GC have been the basis of the treatment for a long time. Orbital irradiation (OI and optical decompression (OD are also used in managing the severe forms of TED. Somatostatin, intravenous immunoglobulin have been also used, with conflicting results. Regarding the potential for the treatment of TED with cytokine antagonists, controlled clinical studies are not available. Since cytokines play an important role in the pathogenesis of the TED, they seemed to be logical choice for modern TED treatment. It has been shown that both Th1 (interleukin-2, tumor necrosis factor γ, interleukin γ and Th2 (interleukin-4,-5-,-10 profile T cells are activated in the TED. We therefore measured interleukin-γ, IF-γ and interleukin -10 (IL-10(Th1 and Th2 pattern to assess its relationship to the course of the disease. This paper shows that both Th1 (Il-2 and Th2 (If-γ pathways represented by those two cytokines are not involved (Il-10 before 2,29±5,23 and after treatment 3,77±8,44; IF γ before 0,50±0,24 and after treatment 0,35±0,19. No relationship to the response to treatment was found. GC resulted in positive response in 8/22 patients, OI (12 patients given after CS therapy, resulted in a response in all patients. Increase in proptosis, loss of visual acuity is spite of CS treatment prompted OD in two patients, who both recovered visual acuity and proptosis fell under 25mm Hertel.
Conciencia hispana y tradición monástica en la Vita Fructuosi
Directory of Open Access Journals (Sweden)
Rodríguez de la Peña, Alejandro
2007-12-01
Full Text Available The author of Vita Fructuosi, probably a monk follower of Saint Fructuosus of Braga in the area of Gallaecia, shows in this biography an evident sense of rooting in the monastic Tradition, specially in the Egyptianeastern one, and also he declares a strong Roman-Catholic and Hispanic conscience. As the highest expression of it, he presents Saint Fructuosus with the same merits of the Egyptian monks and, joined to Saint Isidorus of Seville, as a light for Spain, for the Western and for the whole Catholic Church: they both are two causes of glory for a Visigothic Spain which fells herself as Roman and Catholic.El autor de la Vita Fructuosi, al parecer un monje discípulo de San Fructuoso de Braga en el área de Gallaecia, muestra en esta biografía un claro sentido de arraigo en la Tradición monástica, especialmente egipcio-oriental, y manifiesta una fuerte conciencia romano-católica e hispana. Como máxima expresión de todo ello, presenta a San Fructuoso a la altura de los méritos de los monjes egipcios y, junto con San Isidoro de Sevilla, como una lumbrera de Hispania, del Occidente y de toda la Iglesia Católica: ambos son dos motivos de gloria de la Hispania visigótica que se siente romana y católica.
50 CFR Figure 13 to Part 223 - Single Grid Hard TED Escape Opening
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Single Grid Hard TED Escape Opening 13 Figure 13 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 13 Figure 13 to Part 223—Singl...
TED 2013: The Young. The Wise. The Undiscovered.
2013-01-01
Select live sessions of Disrupt! and Dream! from TED 2013 (Technology, Education, Design) taking place in Long Beach, Florida will be screened in CERN’s Main Auditorium on 27 February, at 17:30 and 20:00. The event, organised by TEDxCERN, is a curtain raiser for the TEDxCERN talks scheduled for 3 May on the theme "Multiplying Dimensions". The TEDxCERN May event reaches beyond particle physics to provide a stage for the expression of science in multiple dimensions and disciplines, unveiling a world in which physics intersects with other multi-dimensional disciplines and thought. TEDxCERN team is looking for volunteers. If you are interested, please e-mail us at info@tedxcern.com.
Narrare la guerra: da Vita e destino a Le Benevole
Directory of Open Access Journals (Sweden)
Camilla Panichi
2014-05-01
Full Text Available Questo saggio si concentra su due romanzi storici che hanno per argomento la Seconda guerra mon- diale e lo sterminio degli ebrei d’Europa: Vita e destino di Vasilij Grossman (1980 e Le Benevole di Jonathan Littell (2006. La scelta è determinata sia dal rapporto esistente tra i due romanzi, sia dalla convinzione che essi rappresentino, per forma e contenuti, due diversi paradigmi attraverso i quali l’immaginario collettivo ha costruito la narrazione dell’evento guerra. Inoltre si tratta di opere che hanno, in tempi diversi, creato un caso letterario: Le Benevole ha sollevato molti problemi orientando il dibattito su temi etici piuttosto che estetici; Vita e destino ha subito la censura in Unione Sovietica. In questa sede si è scelto di analizzare i romanzi da una prospettiva strettamente letteraria, attraverso due argomenti: la legittimità della costruzione finzionale in rapporto al punto di vista dell’autore (testimone dei fatti narrati nel caso di Grossman, post-testimone nel caso di Littell e l’analisi degli elementi romanzeschi di tradizione ottocentesca e modernista. This paper focuses on two novels narrating the Second World War and the extermination of the Jews of Europe: Life and Fate, by Vasily Grossman (1980, and The Kindly Ones by Jonathan Littell (2006. These books have been chosen because they are closely related to each other and because they embody two different paradigms through which the Second World War has been represented. Moreover both Life and Fate and The Kindly Ones have been literary events: the first was censored in the Soviet Union, the second gave rise to a wide-ranging debate on ethical and aesthetical problems. The following paper analyzes these novels from a strictly literary perspective, focusing on two issues: the legitimacy of fiction (Grossman narrates the war from the standpoint of a witness, Littell, born in 1967, is in the position of the historian and the relationship of these texts with the
Manley, Geoffrey T; MacDonald, Christine L; Markowitz, Amy; Stephenson, Diane; Robbins, Ann; Gardner, Raquel C; Winkler, Ethan A; Bodien, Yelena; Taylor, Sabrina; Yue, John K; Kannan, Lakshmi; Kumar, Allison; McCrea, Michael; Wang, Kevin K W
2017-03-31
The Traumatic Brain Injury Endpoints Development (TED) Initiative is a 5-year, Department of Defense (DoD) funded project that is working toward the ultimate goal of developing better designed clinical trials, leading to more precise diagnosis, and effective treatments for traumatic brain injury (TBI). TED is comprised of leading academic clinician-scientists, along with innovative industry leaders in biotechnology and imaging technology, patient advocacy organizations, and philanthropists, working collaboratively with regulatory authorities, specifically the US Food and Drug Administration (FDA). The goals of the TED Initiative are to gain consensus and validation of TBI clinical outcome assessment measures and biomarkers for endorsement by global regulatory agencies for use in drug and device development processes. This manuscript summarizes the Initiative's Stage 1 progress over the first 18 months, including intensive engagement with a number of FDA divisions responsible for review and validation of biomarkers and clinical outcome assessments, progression into the prequalification phase of FDA's Medical Device Development Tool program for a candidate set of neuroimaging biomarkers, and receipt of FDA's Recognition of Research Importance Letter regarding TBI. Other signal achievements relate to the creation of the TED Metadataset, harmonizing study measures across eight major TBI studies, and the leadership role played by TED investigators in the conversion of the NINDS TBI Common Data Elements (CDEs) to Clinical Data Interchange Standards Consortium (CDISC) standards. This paper frames both the near-term expectations and the Initiative's long-term vision to accelerate approval of treatments for patients affected by TBI in urgent need of effective therapies.
Curriculum vitae method in science policy and research evaluation: the state-of-the-art
Carolina Cañibano; Barry Bozeman
2009-01-01
This is a state-of-the-art assessment for a small but burgeoning research approach, use of curricula vitae in research evaluation. The accumulated research remains sufficiently modest for us to consider nearly all published studies and the full range of research purposes to which CV analysis has been applied. CV analysis has been theory-driven, and theory and tools have increasingly converged. Advances in method and technique have been abetted especially by the push for a scientific and techn...
TED-Time and life saving External Defibrillator for home-use.
Weiss, Teddy A; Rosenheck, Shimon; Gorni, Shraga; Katz, Ioni; Mendelbaum, Mendel; Gilon, Dan
2014-06-01
Sudden Cardiac Death--SCD --is a major unmet health problem that needs urgent and prompt solution. AICDs are very expensive, risky and indicated for a small group of patients, at the highest risk. AEDs--Automatic External Defibrillators--are designed for public places and although safe, cannot enter the home-market due to their cost and need for constant, high-cost maintenance. We developed TED, a low-cost AED that derives its energy off the mains, designed for home-use, to save SCD victims' lives. Copyright © 2014 Elsevier Inc. All rights reserved.
Douglas, Raymond S.; Tsirbas, Angelo; Gordon, Mark; Lee, Diana; Khadavi, Nicole; Garneau, Helene Chokron; Goldberg, Robert A.; Cahill, Kenneth; Dolman, Peter J.; Elner, Victor; Feldon, Steve; Lucarelli, Mark; Uddin, Jimmy; Kazim, Michael; Smith, Terry J.; Khanna, Dinesh
2014-01-01
To identify components of a provisional clinical response index for thyroid eye disease (CRI-TED) using a modified Delphi technique. The International Thyroid Eye Disease Society (ITEDS) conducted a structured, 3-round Delphi exercise establishing consensus for a core set of measures for clinical trials in TED. The steering committee discussed the results in a face-to-face meeting (nominal group technique) and evaluated each criterion with respect to its feasibility, reliability, redundancy, and validity. Redundant measures were consolidated or excluded. Criteria were parsed into 11 domains for the Delphi surveys. Eighty four respondents participated in the Delphi-1 survey, providing 220 unique items. Ninety- two members (100% of the respondents from Delphi 1 plus eight new participants) responded in Delphi-2 and rated the same 220 items. Sixty-four members (76% of participants) rated 153 criteria in Delphi-3 (67 criteria were excluded due to redundancy). Criteria with a mean greater than 6 (1 least appropriate to 9 most appropriate) were further evaluated by the nominal group technique and provisional core measures were chosen. Using a Delphi exercise, we developed provisional core measures for assessing disease activity and severity in clinical trials of therapies for TED. These measures will be iteratively refined for use in multicenter clinical trials. PMID:19752424
Practicioner Profile: An Interview with Ted Klontz, Ph.D.
Directory of Open Access Journals (Sweden)
2010-10-01
Full Text Available Dr. Ted Klontz is generally considered to be one the leading pioneers in the field of financial therapy. He defines his role as a consultant, but this simple term masks the important role he has played in changing the attitudes and behaviors of clients worldwide. His innovative work has been cited in the Wall Street Journal, the New York Times, and ABC’s 20/20 to name a few. Dr. Klontz currently serves on the Board of Directors of the Financial Therapy Association. In this interview the editors of the Journal of Financial Therapy ask questions related to what drives Dr. Klontz as a consultant/therapist.
The Dating and Authorship of the Poem Vita Mahumeti, Attributed to Embrico of Mainz
Directory of Open Access Journals (Sweden)
Fernando González Muñoz
2017-12-01
Full Text Available The aim of this paper is to review the problems with the date of writing and the authorship of one of the first legendary accounts of the Prophet Muhammad written in Central Europe: the Vita Mahumeti, attributed to Embrico of Mainz. After presenting the available evidence and the conjectures of different scholars, a new hypothesis about the identity of the author is put forward, which at the same time enables us to clarify the dating of the work, its possible sources and meaning.
Uses and Misuses of Ted Kaczynski's MMPI.
Ben-Porath, Yossef S
2018-05-22
Although case studies can be a helpful didactic aid when teaching personality assessment and illustrating use of a test, they can, of course, not be used as "evidence" that a test "works" or does not work. This article, however, reviews and discusses the far more problematic uses instantiated in a case study of Ted Kaczynski's Minnesota Multiphasic Personality Inventory (MMPI). A series of errors of omission and commission are identified in Butcher, Hass, Greene, and Nelson's ( 2015 ) effort to criticize the MMPI-2-RF. These include not disclosing that Butcher's interpretive Minnesota Report for Forensic Settings indicates that the protocol is invalid, not including most of the MMPI-2 and MMPI-2-RF scores that contradict the authors' assertions, and mischaracterizing the MMPI-2-RF findings. Proper use of a case study is then illustrated by a discussion of diagnostic considerations indicated by the MMPI-2-RF findings.
Concept City: Roma ri-vista e vissuta ne La dolce vita e La grande bellezza
Martini, Alessia
2015-01-01
A partire dagli anni del neorealismo, Roma è stata una location particolarmente amata dai registi italiani che hanno utilizzato con finalità simboliche diversi luoghi della città—dalle borgate ai monumenti del centro—al fine di raccontare un preciso momento storico e una precisa situazione sociale. In questo articolo prenderò in considerazione due film ambientati a Roma, La dolce vita di Federico Fellini (1960) e La grande bellezza di Paolo Sorrentino (2013), per analizzare le valenze che la ...
Laban-Guceva, Nevenka; Bogoev, Milko; Antova, Magdalena
2007-01-01
Serum proinflamatory cytokines were found to be altered in Graves disease (GD) and in TED. Serum values of IL1alpha, IL-1beta, IL-6, TNF-alpha were assessed in 22 patients with TED before and after treatment (aged 46.82 +/- 12.47, M:F=16:6). Free thyroxin was high, TSH low, thyroid ultrasound showed diffuse thyroid enlargement, treatment with antithyroid drugs propylthyouracil (PTU) or methymasol (MMI) resulted in clinical and hormonal remission. Several months after the initiation of the signs of hyperthyroidism, a progression in the ophthalmopathy was observed (Hertel up to 25 mm: normal 15-17 mm) while patients were clinically and hormonally euthyroid. Blood was collected in euthyroid state (with TED signs present, before corticosteroid therapy (CS) treatment) and after 3 months of treatment (patients without TED and without TED treatment). CS resulted in response of 8/22 patients. Ophthalmic irradiation (01) given with CS therapy, resulted in a response in twelve patients (12/12). Lack of response to CS treatment, with rapid increase in proptosis, and loss of visual acuity prompted ophthalmic decompression (OD) in two patients. Both recovered visual acuity, while proptosis fell under 25 mm Hertel. The control group had 29 persons (aged 51.86 +/-10.52, M:F = 16:13). A significant difference was found in the serum levels of IL-1alpha between the groups of controls (0.74+/-0.55 pg/ml) and patients before treatment (1.85 +/- 1.85 pg/ml; p TED treatment its concentration raised to 2.07 +/- 1.82 pg/ml (higher than the pretreatment; NS). For patients with low Clinical Activity Score (CAS) scores (1-5) there was no change in IL-6 concentrations before (1.03+/-o.64 pg/ml) and after treatment (1.07 +/- 0.63 pg/ml). Patients with higher CAS scores (6-10) had a change in IL-6 levels (from 1.32+/-1.00 to 2.67 +/- 4.84; p > 0.05). In addition, patients with pathological VEP had no changes in IL-6 (from 0.93 +/- 0.53 to 0.97 +/- 0.32 pg/ml), while patients with normal VEP had
Elements of the universe in Philo’s De Vita Mosis: Cosmological theology or theological cosmology?
Directory of Open Access Journals (Sweden)
Gert J. Steyn
2013-11-01
Full Text Available It is the intention of this article to investigate how Philo’s understanding of the universe, and particularly its four basic elements as taught by the Greek philosophers, influenced his description of the God of Israel’s world in which the Moses narrative unfolds. Given the fact that Philo was a theologian par excellence, the question can be asked whether Philo’s approach is closer to what one might call ‘theological cosmology’ or rather closer to ‘cosmological theology’? After a brief survey of Philo’s inclination to interpret Jewish history in the light of Greek cosmology, the study proceeds with his universe as symbolised in the high priest’s vestments. The τετρακτύς with its 10 points of harmony is a key to Philo’s symbolism and numerology. The article concludes that Philo is not writing cosmology per se in his De Vita Mosis, but he is rather writing a theology that sketches the cosmic superiority and involvement of Israel’s God against the backdrop of Greek cosmology as it was influenced by Pythagoras’ geometry and numerology as well as by Plato’s philosophy. In this sense his account in the De Vita Mosis is closer to a cosmological theology. He utilises the cosmological picture of the Greco-Hellenistic world in order to introduce and present the powerful nature and qualities of Israel’s God. Hierdie artikel het ten doel om ondersoek in te stel na Philo se begrip van die heelal en veral die vier basiese elemente soos dit deur die Griekse filosowe geleer is. Dit het verder ten doel om vas te stel tot watter mate hierdie denke sy beskrywing van die God van Israel se wêreld, waarbinne die Moses-vertelling ontvou, beïnvloed het. Gegewe die feit dat Philo ’n teoloog par excellence is, kan die vraag gevra word of Philo se benadering nader is aan wat ’n mens ’n ‘teologiese kosmologie’ kan noem, of eerder nader aan ’n ‘kosmologiese teologie’ is? Na ’n kort oorsig oor Philo se neiging om die
TED: a novel man portable infrared detection and situation awareness system
Tidhar, Gil; Manor, Ran
2007-04-01
Infrared Search and Track (IRST) and threat warning systems are used in vehicle mounted or in fixed land positions. Migration of this technology to the man portable applications proves to be difficult due to the tight constraints of power consumption, dimensions, weight and due to the high video rate requirements. In this report we provide design details of a novel transient event detection (TED) system, capable of detection of blasts and gun shot events in a very wide field of view, while used by an operator in motion
50 CFR Figure 12 to Part 223 - Escape Opening & Cover Dimensions for 71-inch TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Escape Opening & Cover Dimensions for 71-inch TED 12 Figure 12 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 12 Figure 12 to...
International Nuclear Information System (INIS)
Lampin, E.; Cristiano, F.; Lamrani, Y.; Colombeau, B.
2004-01-01
We present simulations of B TED based on a complete calculation of the extended defect growth/shrinkage during annealing. The Si self-interstitial supersaturation calculated at the extended defect depth is coupled to the set of equations for the B kick-out diffusion through a generation/recombination term in the diffusion equation of the Si self-interstitials. The simulations are compared to the measurements performed on a Si wafer containing several B marker layers, where the amount of TED varies from one peak to the other. The good agreement obtained on this experiment is very promising for the application of these calculations to the case of ultra-shallow B + implants
Elements of the universe in Philo’s De Vita Mosis: Cosmological theology or theological cosmology?
Directory of Open Access Journals (Sweden)
Gert J. Steyn
2013-11-01
Full Text Available It is the intention of this article to investigate how Philo’s understanding of the universe, and particularly its four basic elements as taught by the Greek philosophers, influenced his description of the God of Israel’s world in which the Moses narrative unfolds. Given the fact that Philo was a theologian par excellence, the question can be asked whether Philo’s approach is closer to what one might call ‘theological cosmology’ or rather closer to ‘cosmological theology’? After a brief survey of Philo’s inclination to interpret Jewish history in the light of Greek cosmology, the study proceeds with his universe as symbolised in the high priest’s vestments. The τετρακτύςwith its 10 points of harmony is a key to Philo’s symbolism and numerology. The article concludes that Philo is not writing cosmology per se in his De Vita Mosis, but he is rather writing a theology that sketches the cosmic superiority and involvement of Israel’s God against the backdrop of Greek cosmology as it was influenced by Pythagoras’ geometry and numerology as well as by Plato’s philosophy. In this sense his account in the De Vita Mosisis closer to a cosmological theology. He utilises the cosmological picture of the Greco-Hellenistic world in order to introduce and present the powerful nature and qualities of Israel’s God.
The “Enemy” of the Saint in the Vita Fulgentii
Directory of Open Access Journals (Sweden)
Isabella D'Auria
2015-06-01
Full Text Available This paper aims to analyze the traits that characterize the “enemy” of the saint in the Vita Fulgentii. The work tells in twenty-nine chapters the life of the bishop of Ruspe Fulgentius, troubled by exile and persecutions both in the monastic phase and in the episcopal one, in the context of the vandalic invasion in Africa between 5th and 6th century. The “enemy”, that identifies, in the most cases, with the invader of arian faith, presents a stereotyped nature, summarizing the tipical characteristics of barbarian and the ones specific to the heterodox. In order to achieve the goal of the reader’s moral edification, the text presents antithetical models, the saint ant his opposer, and all the account revolves around this dialectic; so it is worthy of interest to pick out the elements that define, throught a relationship of opposition, the collective identities, that in this text are represented by Catholics invaded and by barbarian and heretic invaders.
Nowak, Andreas; Langebach, Robin; Klemm, Eckart; Heller, Winfried
2012-04-01
We describe an innovative computer-based method for the analysis of gas flow using a modified airway management technique to perform percutaneous dilatational tracheotomy (PDT) with a rigid tracheotomy endoscope (TED). A test lung was connected via an artificial trachea with the tracheotomy endoscope and ventilated using superimposed high-frequency jet ventilation. Red packed cells were instilled during the puncture phase of a simulated percutaneous tracheotomy in a trachea model and migration of the red packed cells during breathing was continuously measured. Simultaneously, the calculation of the gas-flow within the endoscope was numerically simulated. In the experimental study, no backflow of blood occurred during the use of superimposed high-frequency jet ventilation (SHFJV) from the trachea into the endoscope nor did any transportation of blood into the lower respiratory tract occur. In parallel, the numerical simulations of the openings of TED show almost positive volume flows. Under the conditions investigated there is no risk of blood aspiration during PDT using the TED and simultaneous ventilation with SHFJV. In addition, no risk of impairment of endoscopic visibility exists through a backflow of blood into the TED. The method of numerical simulation offers excellent insight into the fluid flow even under highly transient conditions like jet ventilation.
Energy Technology Data Exchange (ETDEWEB)
Carnevale, Francisco C., E-mail: fcarnevale@uol.com.br [University of Sao Paulo Medical School, Interventional Radiology Unit (Brazil); Iscaife, Alexandre, E-mail: iscaifeboni@yahoo.com.br; Yoshinaga, Eduardo M., E-mail: dumuracca@ig.com.br [University of Sao Paulo Medical School, Division of Urology (Brazil); Moreira, Airton Mota, E-mail: motamoreira@gmail.com [University of Sao Paulo Medical School, Interventional Radiology Unit (Brazil); Antunes, Alberto A., E-mail: antunesuro@uol.com.br; Srougi, Miguel, E-mail: srougi@uol.com.br [University of Sao Paulo Medical School, Division of Urology (Brazil)
2016-01-15
PurposeTo compare clinical and urodynamic results of transurethral resection of the prostate (TURP) to original and PErFecTED prostate artery embolization (PAE) methods for benign prostatic hyperplasia.MethodsWe prospectively randomized 30 patients to receive TURP or original PAE (oPAE) and compared them to a cohort of patients treated by PErFecTED PAE, with a minimum of 1-year follow-up. Patients were assessed for urodynamic parameters, prostate volume, international prostate symptom score (IPSS), and quality of life (QoL).ResultsAll groups were comparable for all pre-treatment parameters except bladder contractility and peak urine flow rate (Q{sub max}), both of which were significantly better in the TURP group, and IIEF score, which was significantly higher among PErFecTED PAE patients than TURP patients. All groups experienced significant improvement in IPSS, QoL, prostate volume, and Q{sub max}. TURP and PErFecTED PAE both resulted in significantly lower IPSS than oPAE but were not significantly different from one another. TURP resulted in significantly higher Q{sub max} and significantly smaller prostate volume than either original or PErFecTED PAE but required spinal anesthesia and hospitalization. Two patients in the oPAE group with hypocontractile bladders experienced recurrence of symptoms and were treated with TURP. In the TURP group, urinary incontinence occurred in 4/15 patients (26.7 %), rupture of the prostatic capsule in 1/15 (6.7 %), retrograde ejaculation in all patients (100 %), and one patient was readmitted for temporary bladder irrigation due to hematuria.ConclusionsTURP and PAE are both safe and effective treatments. TURP and PErFecTED PAE yield similar symptom improvement, but TURP is associated with both better urodynamic results and more adverse events.
Nakamura, K.; Naito, Y.; Onishi, K.; Kawakatsu, H.
2012-12-01
In industrial applications of a micromechanical silicon resonator as a physical sensor, a high-quality factor Q and a low-temperature coefficient of Q (TCQ) are required for high sensitivity in a wide temperature range. Although the newly developed thin film encapsulation technique enables a beam to operate with low viscous damping in a vacuum cavity, the Q of a flexural vibration mode is limited by thermo-elastic damping (TED). We proposed a torsional beam resonator which features both a high Q and a low TCQ because theoretically the torsional vibration mode does not suffer from TED. From experiments, Q of 267 000 and TCQ of 1.4 for the 20 MHz torsional vibration mode were observed which were superior to those of the flexural mode. The pressure of the residual gas in the cavity of only 20 pl volume, which is one of the energy loss factors limiting the Q, was successfully estimated to be 1-14 Pa. Finally, the possibilities of improving the Q and the difference of the measured TCQ from a theoretical value were discussed.
IL MERAVIGLIOSO PRIMO ANNO DI VITA. THE WONDERFUL FIRST YEAR OF LIFE
Directory of Open Access Journals (Sweden)
Ongari, Barbara
2013-12-01
Full Text Available Le immense potenzialità del primo anno di vita ed il loro essere a fondamento dello sviluppo della personalità vengono discusse qui in una prospettiva relazionale, evidenziando il significato fondamentale della qualità delle interazioni precoci, verbali e non verbali, tra il bambino ed i suoi caregiver. Viene sottolineato anche il ruolo-chiave delle emozioni e dei vissuti interpersonali nella costruzione dell’architettura della mente infantile. The extraordinary potentialities during the first year of life and the fact that they are at the basis of the development of personality are proposed here using a relational prospective. The fundamental significance connected to the quality of the precocious verbal and non–verbal interactions between infants and their caregiver is evidenced as well. The key-role of the interpersonal emotions and feelings inside the construction of the infants’ mind architecture is highlighted.
Ghanem, Henry; Afrashtehfar, Kelvin Ian; Abi-Nader, Samer; Tamimi, Faleh
2015-12-01
A survey was conducted to assess the impact of a TED-like educational session on participants' willingness to accept dental implant therapy. Volunteers interested in having information about dental implant therapies were recruited and asked to complete a two-part survey before and after an educational session. The initial survey elicited demographic information, self-perceived knowledge on dental implants and willingness to this kind of treatment. A "TED-style" presentation that provided information about dental implant treatments was conducted before asking the participants to complete a second set of questions assessing the impact of the session. The survey was completed by 104 individuals, 78.8% were women and the mean age was 66.5±10.8. Before the educational session, 76.0% of the participants refused dental implants mainly due to lack of knowledge. After the educational session, the rejection of dental implants decreased by almost four folds to 20.2%. This study proved that an educational intervention can significantly increase willingness to accept treatment with dental implants in a segment of the population who is interested in having information about dental implant therapy. Furthermore, educational interventions, such as TED-like talks, might be useful to increase popular awareness on dental implant therapy.
Ghanem, Henry; Abi-Nader, Samer
2015-01-01
PURPOSE A survey was conducted to assess the impact of a TED-like educational session on participants' willingness to accept dental implant therapy. MATERIALS AND METHODS Volunteers interested in having information about dental implant therapies were recruited and asked to complete a two-part survey before and after an educational session. The initial survey elicited demographic information, self-perceived knowledge on dental implants and willingness to this kind of treatment. A "TED-style" presentation that provided information about dental implant treatments was conducted before asking the participants to complete a second set of questions assessing the impact of the session. RESULTS The survey was completed by 104 individuals, 78.8% were women and the mean age was 66.5±10.8. Before the educational session, 76.0% of the participants refused dental implants mainly due to lack of knowledge. After the educational session, the rejection of dental implants decreased by almost four folds to 20.2%. CONCLUSION This study proved that an educational intervention can significantly increase willingness to accept treatment with dental implants in a segment of the population who is interested in having information about dental implant therapy. Furthermore, educational interventions, such as TED-like talks, might be useful to increase popular awareness on dental implant therapy. PMID:26816573
Magrini, James M.
2015-01-01
The argumentation in this paper is grounded in a critical and conceptual analysis of Ted Aoki's phenomenology, wherein curriculum is read as "phenomenological text." The problem explored emerges from Aoki's critique of the Tyler rationale for curriculum design, implementation and evaluation as it is conceived and practised in…
50 CFR Figure 16 to Part 223 - Escape Opening and Flap Dimensions for the Double Cover Flap TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Escape Opening and Flap Dimensions for the Double Cover Flap TED 16 Figure 16 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 1...
Blanco-Pérez, Marta; Pérez-Cañamás, Miryam; Ruiz, Leticia; Hernández, Carmen
2016-01-01
Cap-independent translational enhancers (CITEs) have been identified at the 3´-terminal regions of distinct plant positive-strand RNA viruses belonging to families Tombusviridae and Luteoviridae. On the bases of their structural and/or functional requirements, at least six classes of CITEs have been defined whose distribution does not correlate with taxonomy. The so-called TED class has been relatively under-studied and its functionality only confirmed in the case of Satellite tobacco necrosis virus, a parasitic subviral agent. The 3´-untranslated region of the monopartite genome of Pelargonium line pattern virus (PLPV), the recommended type member of a tentative new genus (Pelarspovirus) in the family Tombusviridae, was predicted to contain a TED-like CITE. Similar CITEs can be anticipated in some other related viruses though none has been experimentally verified. Here, in the first place, we have performed a reassessment of the structure of the putative PLPV-TED through in silico predictions and in vitro SHAPE analysis with the full-length PLPV genome, which has indicated that the presumed TED element is larger than previously proposed. The extended conformation of the TED is strongly supported by the pattern of natural sequence variation, thus providing comparative structural evidence in support of the structural data obtained by in silico and in vitro approaches. Next, we have obtained experimental evidence demonstrating the in vivo activity of the PLPV-TED in the genomic (g) RNA, and also in the subgenomic (sg) RNA that the virus produces to express 3´-proximal genes. Besides other structural features, the results have highlighted the key role of long-distance kissing-loop interactions between the 3´-CITE and 5´-proximal hairpins for gRNA and sgRNA translation. Bioassays of CITE mutants have confirmed the importance of the identified 5´-3´ RNA communication for viral infectivity and, moreover, have underlined the strong evolutionary constraints that may
Directory of Open Access Journals (Sweden)
Marta Blanco-Pérez
Full Text Available Cap-independent translational enhancers (CITEs have been identified at the 3´-terminal regions of distinct plant positive-strand RNA viruses belonging to families Tombusviridae and Luteoviridae. On the bases of their structural and/or functional requirements, at least six classes of CITEs have been defined whose distribution does not correlate with taxonomy. The so-called TED class has been relatively under-studied and its functionality only confirmed in the case of Satellite tobacco necrosis virus, a parasitic subviral agent. The 3´-untranslated region of the monopartite genome of Pelargonium line pattern virus (PLPV, the recommended type member of a tentative new genus (Pelarspovirus in the family Tombusviridae, was predicted to contain a TED-like CITE. Similar CITEs can be anticipated in some other related viruses though none has been experimentally verified. Here, in the first place, we have performed a reassessment of the structure of the putative PLPV-TED through in silico predictions and in vitro SHAPE analysis with the full-length PLPV genome, which has indicated that the presumed TED element is larger than previously proposed. The extended conformation of the TED is strongly supported by the pattern of natural sequence variation, thus providing comparative structural evidence in support of the structural data obtained by in silico and in vitro approaches. Next, we have obtained experimental evidence demonstrating the in vivo activity of the PLPV-TED in the genomic (g RNA, and also in the subgenomic (sg RNA that the virus produces to express 3´-proximal genes. Besides other structural features, the results have highlighted the key role of long-distance kissing-loop interactions between the 3´-CITE and 5´-proximal hairpins for gRNA and sgRNA translation. Bioassays of CITE mutants have confirmed the importance of the identified 5´-3´ RNA communication for viral infectivity and, moreover, have underlined the strong evolutionary
50 CFR Figure 5 to Part 223 - Net Diagram for the Excluder Panel of the Parker Soft TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Net Diagram for the Excluder Panel of the Parker Soft TED 5 Figure 5 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 5 Figure 5...
Ted Irving's early contributions to paleomagnetism
Frankel, H. R.
2014-12-01
Edward (Ted) Irving (1927 - 2014) was one of the most deeply and widely respected paleomagnetists, making significant contributions to the field throughout his career which spanned six decades. Restricting attention to the first decade of his career, the 1950s, he discovered from work on the Torridonian (1951-1953) that fine-grained red sandstones were generally suitable for paleomagnetic work (1951-1952). He rediscovered (1951) that paleomagnetism could be used to test continental drift, and initiated (1951) the first paleomagnetic test of whether India had drifted northward relative to Asia and argued (1954) that it had. He also made significant contributions to the first APW path for Great Britain (Creer, Irving, and Runcorn, 1954). He was the first to draw two APW paths to explain results from Great Britain and North America (1956) and to use paleomagnetism and paleoclimatology together to argue for continental drift (1954, 1956). With Ron Green, his first student, he first APW path for Australia (1958). He was the first to invoke axial rotations to explain away an apparent anomaly with an APW path (1959). His work on the Torridonian led to the first description of stratigraphically sequential reversals in sedimentary rocks. Moreover, his 1959 superb review of the paleomagnetic support for continental drift was instrumental in Hess's becoming a continental drifter before he came up with the idea of seafloor spreading.
Energy Technology Data Exchange (ETDEWEB)
Volterra, L.; De Nava, V.; Mancini, L. [Istituto Superiore di Sanita`, Rome (Italy). Lab. di Igiene Ambientale
1998-12-31
The report concerns two Italian laws, n.130/92 and 131/92 derived from the EEC directives n. 659/78 and 923/91 concerning water quality respectively for freshwater and for marine water suitable for shellfish. The meaning of each parameter, included in the two laws, is explained considering that their purpose is protection and promotion of aquatic life. This review was originated by a request that Ministry of the Environment directed to the `Istituto Superiore of Sanita` to supply information necessary for a possible definition of lacking standards and to draw up appropriate monitoring plans. [Italiano] Il rapporto si riferisce a due decreti, il numero 130/92 e il 131/92 recepiti dalle direttive comunitarie 659/78 e 923/91 riguardanti rispettivamente la qualita` delle acque dolci che richiedono protezione e miglioramento per la vita dei pesci e i requisiti di qualita` delle acque per la molluschiocoltura. Si elencano isignificati dei singoli parametri introdotti nelle due normative il cui scopo e` quello di proteggere e favorire lo sviluppo della vita acquatica in ambienti di acqua dolce e marina. La rassegna e` nata da una richiesta formulata all`Istituto Superiore di Sanita` da parte del Ministero dell`Ambiente per fornire indicazioni necessarie per la eventuale definizione degli standard mancanti ed indirizzi per la formulazione di idonei piani di sorveglianza.
Sustainable Mobility and Lifestyle Mobilità sostenibile e stili di vita
Directory of Open Access Journals (Sweden)
Rosa Anna La Rocca
2011-07-01
discussed in this article refer to “bottom up” solutions to tackle climate change in which the transport sector bears a heavy responsibility.
These reports have all the same target - the urgency to respond to global climate change in urban centers- but different methodology to test how and how much is the commitment of govern and people to meet this challenge.
What stands out is the awareness that current lifestyles must necessarily change in order to assure vivibility to the future generations.
This article attempts to stimulate the attention of the scientific field about the possibilities that an in-depth study dealing with signals of changement may have.
L’articolo propone una riflessione sulla necessità di un approfondimento scientifico sulle prospettive di cambiamento necessarie a qualsiasi modello di sostenibilità.
Nello scenario attuale, la prospettiva della sostenibilità, infatti, sembra sempre più orientata a modificare o quantomeno a mettere in discussione gli attuali modelli di crescita socioeconomica.
A voler sintetizzare all’estremo, si tratta di prendere coscienza del fatto che gli attuali stili di vita debbano necessariamente modificarsi, se realmente si vuole tentare di ammortizzare gli effetti dell’irresponsabile gestione del territorio e delle città sulle generazioni che seguiranno la nostra.
La questione non è affatto semplice e non è avulsa da polemiche e contrasti politici, sostanzialmente pronti ad individuare nella cultura occidentale e nell’economia capitalista conseguente la fonte di tutti i mali.
Obiettivo di questo articolo è provare a riflettere sulle modalità che potrebbero contrastare le criticità derivanti da stili di vita negativamente incidenti sugli elementi territoriali ed ambientali.
A tale scopo nell’articolo vengono esaminati report ed iniziative (bottom-up o top down particolarmente significativi nella ricerca di stili di vita sostenibili.
Gli esempi
van Vugt, M.; de Wit, M.; Sieverink, Floor; Roelofsen, Y.; Hendriks, S.H.; Bilo, H.J.G.; Snoek, F.J.
2016-01-01
We studied the use, uptake, and effects of e-Vita, a personal health record, with self-management support and personalized asynchronized coaching, for type 2 diabetes patients treated in primary care. Patients were invited by their practice nurse to join the study aimed at testing use and effects of
Murray, Eileen; Durkin, Kelley; Chao, Theodore; Star, Jon R.; Vig, Rozy
2018-01-01
Past work on mathematics teachers' content knowledge (CK) and pedagogical content knowledge (PCK) has resulted in mixed findings about the strength of the relationship between and development of these constructs. The current study uses data from the Teacher Education and Development Study in Mathematics (TEDS-M) to examine the relationship between…
Kalantari, Mohammad Hassan; Ghoraishian, Seyed Ahmad; Mohaghegh, Mina
2017-01-01
The aim of this in vitro study was to evaluate the accuracy of shade matching using two spectrophotometric devices. Thirteen patients who require a full coverage restoration for one of their maxillary central incisors were selected while the adjacent central incisor was intact. 3 same frameworks were constructed for each tooth using computer-aided design and computer-aided manufacturing technology. Shade matching was performed using Vita Easyshade spectrophotometer, Shadepilot spectrophotometer, and Vitapan classical shade guide for the first, second, and third crown subsequently. After application, firing, and glazing of the porcelain, the color was evaluated and scored by five inspectors. Both spectrophotometric systems showed significantly better results than visual method ( P spectrophotometers ( P Spectrophotometers are a good substitute for visual color selection methods.
Pictures to a story. Notes on Vita di San Filippo Neri at the Civic Museum of Bassano del Grappa
Directory of Open Access Journals (Sweden)
Federica Vettori
2014-12-01
Full Text Available During the eighteenth century the venetian publishing knows a flowering season thanks to the involvement of great artists in the field of illustration. Pietro Antonio Novelli was one of the most prolific inventors of decorations for illustrated books. He sketched the illustrations of Vita di San Filippo Neri engraved by Innocente Alessandri and printed in Venice in 1793. At the Museum of Bassano del Grappa we can find a special watercolored edition: sixty large prints that tell, as if they were history paintings, the life of the saint.
A atividade cristianizadora de Amando de Maastricht na Vita Sancti Amandi
Directory of Open Access Journals (Sweden)
Leila Rodrigues da Silva
2015-05-01
Full Text Available Tendo como referência o discurso hagiográfico veiculado na Vita Sancti Amandi, o presente artigo tem por objetivo analisar as alusões à atividade cristianizadora do monge-bispo-peregrino Amando de Maastricht. Para tal, dividimos a abordagem em duas partes centrais: na primeira, ressaltamos a relação do monacato irlandês com o processo de multiplicação e expansão das diversas formas de vida monástica, com especial atenção para uma de suas expressões: a Peregrinatio pro Christo. Na segunda, passamos à análise do texto hagiográfico buscando compreender a atividade cristianizadora atribuída a Amando de Maastricht por seu hagiógrafo. Neste processo, ressaltamos cinco modalidades de atuação: pregação a cristãos; pregação a não cristãos, “pagãos” e “supersticiosos”; libertação, conversão e treinamento de cativos para atividade missionária; realização de milagres de cura e conversão das testemunhas, e construção de mosteiros e igrejas.
A Profilaxia do Silêncio: Nietzsche e a Virtude da Vita Contemplativa
Directory of Open Access Journals (Sweden)
Jelson Roberto Oliveira
2011-12-01
Full Text Available http://dx.doi.org/10.5007/1677-2954.2011v10n1p133 Pretende-se mostrar como o tema do silêncio, apresentado como parte do projeto nietzscheano de revitalização da vita contemplativa, adquire importância no chamado segundo período de sua produção, ligado àquela que poderia ser considerada a primeira e mais contundente das virtudes humanas apontadas por Nietzsche: o cultivo de si. Nesse sentido, trata-se de uma noção requisitada como parte do projeto crítico da modernidade implementado pelo filósofo alemão, cujo ponto de partida é uma revisão da própria tarefa da filosofia, conduzindo a uma crítica radical da moralidade vigente, da hipertrofia da racionalidade e da importância da linguagem. O silêncio, associado à solidão, aparece como uma profilaxia e radical aprofundamento em relação à anulação de si no arrulho da multidão moderna.
i-TED: A novel concept for high-sensitivity (n,γ) cross-section measurements
Domingo-Pardo, C.
2016-07-01
A new method for measuring (n , γ) cross-sections aiming at enhanced signal-to-background ratio is presented. This new approach is based on the combination of the pulse-height weighting technique with a total energy detection system that features γ-ray imaging capability (i-TED). The latter allows one to exploit Compton imaging techniques to discriminate between true capture γ-rays arising from the sample under study and background γ-rays coming from contaminant neutron (prompt or delayed) captures in the surrounding environment. A general proof-of-concept detection system for this application is presented in this paper together with a description of the imaging method and a conceptual demonstration based on Monte Carlo simulations.
Adsorption of methane on Zn(bdc)(ted)0.5 microporous metal-organic framework
Krungleviciute, Vaiva; Pramanik, Sanhita; Migone, Aldo; Li, Jing
2011-03-01
Zn(bdc)(ted)0.5 is metal-organic framework crystallized in a tetragonal space group with a 3D porous structure containing intersecting channels of two different sizes. The larger channels are parallel to the c axis and have a cross section 7.5 × 7.5 AA. The smaller channels are along both the a- and b-axes and have a cross section of 4.8 × 3.2 AA. We measured methane adsorption isotherms at several different temperatures between 82 and 102 K. We calculated the effective specific surface area, isosteric heat and binding energy values. Two distinct substeps were observed in the isotherms corresponding to two different adsorption sites. The origin of the substeps will be discussed.
Directory of Open Access Journals (Sweden)
Belal Naser
2005-01-01
Full Text Available Arbor vitae (Thuja occidentalis L. is a native European tree widely used in homeopathy and evidence-based phytotherapy. Many reviews and monographs have been published on the herbal substance's description, mode of action and clinical use. However, no comprehensive evidence-based review is available. Therefore, our aim was to search MEDLINE databases and survey manufacturers for further details or unpublished data. This review presents the botany, ethnobotany and phytochemistry, especially the different contents of essential oil (Thujone in relation to different extraction procedures of this medicinal plant. Thuja's antiviral action and immunopharmacological potential, such as stimulatory and co-stimulatory effects on cytokine and antibody production and activation of macrophages and other immunocompetent cells, have been evaluated in numerous in vitro and in vivo investigations. Although no controlled trials have been conducted on Thuja occ alone, many clinical studies have been performed with a herbal medicinal product containing a special extract of Thuja occ and other immunostimulants, demonstrating its therapeutic efficacy and safety in respiratory tract infections.
Literature in Focus: Engines of Discovery Meet the author Ted Wilson
2007-01-01
Ted Wilson is a world-renowned expert on particle accelerators and a brilliant speaker. He came to CERN in 1967, where he worked on the SPS and collaborated closely with John Adams, taking part in the design and commissioning of the accelerator. In 1980, he joined the PS and worked on the antiproton accumulator. In 1991, he became a member of the LHC Committee and was entrusted with the task of writing a report on the design of the future accelerator. This book for the first time chronicles the development of particle accelerators from the invention of electrostatic accelerators, linear accelerators and the cyclotron to the colliders of today. It also addresses accelerators used as sources of x-rays, for medical purposes and in industrial applications. The book identifies the crucial discoveries in applied physics and engineering that have driven the field and gives the reader insight into the people who made these discoveries as well as the methods they used. Come a...
Directory of Open Access Journals (Sweden)
Davor Illeš
2015-01-01
Full Text Available Objectives: The objective of this study was to evaluate the intra-device repeatability and accuracy of dental shade-matching device (VITA Easyshade® Advance 4.0 using both in vitro and in vivo models. Materials and methods: For the repeatability assessment, the in vivo model utilized shade-matching device to measure the central region of the labial surface of right maxillary central incisors of 10 people twice. The following tooth colors were measured: B1, A1, A2, A3, C1 and C3. The in vitro model included the same six Vitapan Classical tabs. Two measurements were made of the central region of each shade tab. For the accuracy assessment, each shade tab from 3 Vitapan Classical shade guides was measured once. CIE L*a*b* values were determined. Intraclass correlation coefficients (ICCs were used to analyze the in vitro and in vivo intra-device repeatability of the shade-matching device. The difference between in vitro and in vivo models was analyzed. Accuracy of the device tested was calculated. Results: The mean color differences for in vivo and in vitro models were 3.51 and 1.25 E units, respectively. The device repeatability ICCs for in vivo measurements ranged from 0.858 to 0.971 and for in vitro from 0.992 to 0.994. Accuracy of the device tested was 93.75%. Conclusion: Within the limitations of the experiment, VITA Easyshade®Advance 4.0 dental shade-matching device enabled reliable and accurate measurement. It can be a valuable tool for the determination of tooth colours.
Posavec, Ivona; Prpić, Vladimir; Zlatarić, Dubravka Knezović
2016-12-01
The purpose of this study was to evaluate and compare lightness (L), chroma (C) and hue (h), green-red (a) and blue-yellow (b) character of the color of maxillary right central incisors in different light conditions and light sources. Two examiners who were well trained in digital color evaluation participated in the research. Intraclass correlation coefficients (ICCs) were used to analyze intra- and interobserver reliability. The LCh and L*a*b* values were determined at 08.15 and at 10.00 in the morning under three different light conditions. Tooth color was assessed in 10 subjects using intraoral spectrophotometer VITA Easyshade Advance 4.0 ® set at the central region of the vestibular surface of the measured tooth. Intra- and interobserver ICC values were high for both examiners and ranged from 0.57 to 0.99. Statistically significant differences in LCh and L*a*b* values measured in different time of the day and certain light condition were not found (p>0.05). Statistically significant differences in LCh and L*a*b* values measured under three different light conditions were not found, too (p>0.05). VITA Easyshade Advance 4.0 ® is reliable enough for daily clinical work in order to assess tooth color during the fabrication of esthtic appliances because it is not dependent on light conditions and light sources.
Ted Irving's legacy: recent developments on his pioneering work in paleomagnetism
Enkin, R. J.; Opdyke, N. D.; Kent, D. V.; Frankel, H. R.; Evans, D. A.; Geissman, J. W.
2014-12-01
Edward (Ted) Irving (1927-2014) was one of the principal developers of paleomagnetism and an early champion of continental drift. Through careful multidisciplinary research and with great insight, he pioneered many aspects of paleomagnetism which continue to be actively researched. Irving was convinced of the reality of continental drift by 1954 and provided compelling arguments for its support in his classic 1964 textbook, but thought it would take the rest of his career to convince the rest of the scientific community. With the acceptance of plate tectonics in the late 1960s, he then applied his paleomagnetic tools to study young rocks (mid-ocean ridges), old rocks (the Laurentian shield), and mobile belts (the Appalachians and the Cordillera). In this poster we highlight recent work on several of his methods, results and ideas. Topics will include spherical statistics and paleosecular variation, the geomagnetic polarity time scale and the Kiaman superchron, paleoclimatic tests of paleogeography, compilation of paleomagnetic poles and the definition of apparent polar wander paths, and the paleogeography of cratons (e.g., Pangea) and mobile belts (e.g., Baja BC).
The Reduction of TED in Ion Implanted Silicon
International Nuclear Information System (INIS)
Jain, Amitabh
2008-01-01
The leading challenge in the continued scaling of junctions made by ion implantation and annealing is the control of the undesired transient enhanced diffusion (TED) effect. Spike annealing has been used as a means to reduce this effect and has proven successful in previous nodes. The peak temperature in this process is typically 1050 deg. C and the time spent within 50 deg. C of the peak is of the order of 1.5 seconds. As technology advances along the future scaling roadmap, further reduction or elimination of the enhanced diffusion effect is necessary. We have shown that raising the peak temperature to 1175 deg. C or more and reduction of the anneal time at peak temperature to less than a millisecond is effective in eliminating enhanced diffusion. We show that it is possible to employ a sequence of millisecond anneal followed by spike anneal to obtain profiles that do not exhibit gradient degradation at the junction and have junction depth and sheet resistance appropriate to the needs of future technology nodes. We have implemented millisecond annealing using a carbon dioxide laser to support high-volume manufacturing of 65 nm microprocessors and system-on-chip products. We further show how the use of molecular ion implantation to produce amorphousness followed by laser annealing to produce solid phase epitaxial regrowth results in junctions that meet the shallow depth and abruptness requirements of the 32 nm node.
The Reduction of TED in Ion Implanted Silicon
Jain, Amitabh
2008-11-01
The leading challenge in the continued scaling of junctions made by ion implantation and annealing is the control of the undesired transient enhanced diffusion (TED) effect. Spike annealing has been used as a means to reduce this effect and has proven successful in previous nodes. The peak temperature in this process is typically 1050 °C and the time spent within 50 °C of the peak is of the order of 1.5 seconds. As technology advances along the future scaling roadmap, further reduction or elimination of the enhanced diffusion effect is necessary. We have shown that raising the peak temperature to 1175 °C or more and reduction of the anneal time at peak temperature to less than a millisecond is effective in eliminating enhanced diffusion. We show that it is possible to employ a sequence of millisecond anneal followed by spike anneal to obtain profiles that do not exhibit gradient degradation at the junction and have junction depth and sheet resistance appropriate to the needs of future technology nodes. We have implemented millisecond annealing using a carbon dioxide laser to support high-volume manufacturing of 65 nm microprocessors and system-on-chip products. We further show how the use of molecular ion implantation to produce amorphousness followed by laser annealing to produce solid phase epitaxial regrowth results in junctions that meet the shallow depth and abruptness requirements of the 32 nm node.
Directory of Open Access Journals (Sweden)
Mušović Azra A.
2012-01-01
Full Text Available Ted Hughes and Sylvia Plath were husband and wife; they were also two of the most remarkable poets of the twentieth century. Both Hughes and Plath were fond of mythic language - their attempts to find meaning in painful events of life took the form of a journey through myth. Just as Song contains a founding image in the work of Ted Hughes, Ariadne can be identified as a founding image in the work of Sylvia Plath. Both of these poems employ mythic language to identify the emotional pattern of each poet's creative stance toward the distinctive subject matter his or her art will seize on. Since Plath was, indeed, the form taken by the White Goddess in Hughes's life, it had been her destiny to inflict devastation on Hughes, as well as release his creative energy. These were the two aspects of her gift, as Robert Graves defined it: creativity and destruction. This paper is concerned with presenting an up-close look at a couple who saw each other as the means to becoming who they wanted to be: writers and mythic figures representing their generation.
Directory of Open Access Journals (Sweden)
Fabio Franceschi
2011-11-01
Full Text Available Versione riveduta e ampliata, nel testo e nell’apparato bibliografico, della relazione presentata con il titolo “L’impegno dei fedeli laici nella vita pubblica tra responsabilità propria, libertà e dovere di obbedienza al magistero. L’insegnamento di Benedetto XVI” al Convegno di studi “Il fedele laico: realtà e prospettive”, organizzato dalla Pontificia Università della Santa Croce (7-8 aprile 2011. Il contributo è destinato alla pubblicazione negli Atti del Convegno. SOMMARIO: 1. Considerazioni introduttive. Natura essenzialmente laicale della responsabilità politica - 2. L’intervento della Chiesa nel dibattito pubblico su questioni inerenti alla vita sociale e politica. I principi c.d. non negoziabili - 3. Fondamentale libertà dei fedeli rispetto alle indicazioni della gerarchia in materia temporale – 4. La funzione di orientamento dei pastori della comunità ecclesiale e i confini dell’intervento della stessa – 5. I limiti alla libertà dei fedeli in materia temporale: il rapporto tra libertà e verità e la salvaguardia delle esigenze etiche fondamentali e irrinunciabili per il bene comune e della società – 6. Benedetto XVI e l’invito a una nuova generazione di cattolici impegnati in politica. La difesa della centralità della persona umana come compito primario dei credenti impegnati nel governo della città terrena– 7. (segue L’impegno a favore della promozione di un concetto positivo di laicità, aperto alla Trascendenza − 8. (segue La politica come forma singolare di realizzazione della carità – 9. (segue La dottrina sociale della Chiesa come strumento di formazione essenziale e guida sicura per i fedeli laici impegnati nell’ambito socio-politico – 10. Considerazioni conclusive. Doveri, rispettivi, dello Stato e della Chiesa affinché si conservino, o se necessario si creino le condizioni esterne idonee e necessarie allo svolgimento dei compiti dei christifideles laici nella polis.
Directory of Open Access Journals (Sweden)
Antonio Gómez Ortiz
2005-12-01
Full Text Available RESUMEN:La formación del profesorado de bachillerato siempre ha resultado una tarea inacabada, pues las distintas experiencias llevadas a término nunca han concluido con saldo positivo duradero. Así se desprende de lo acontecido durante estos últimos años en nuestro sistema educativo, desde la implantación del CAP hasta el efímero TED. El artículo se ocupa de ello y lo hace desde la posición que le corresponde a la Geografía aportando ideas y reflexiones acerca del cometido que debiera tener nuestra ciencia y su didáctica en la formación inicial del futuro docente.PALABRAS CLAVE:Bachillerato, Didáctica de la Geografía, formación inicial, Geografía, profesorado, ABSTRACT:Higher education teachers instruction has been always a difficult subject to deal with. Spanish educational system enhances this afirmation. From CAP to TED many deficiencies appear. This paper gives ideas and thoughts about Spanish educational system and the paper that Geography and its didactics are supposed to develop. KEY WORDS:Higher education, Geography didactics, initial formation, Geography, teachers. RESUMÉ:La formation du professorat de baccalauréat a toujours résulté une tache inachevée. 11est ainsi conclu de ce qui est arrivé pendant ces demiers années dans notre systeme éducatif, depuis I'implantation du CAP jusqu'a l'éphémere TED. L'article apporte des idées et des réflexions sur I'affectation qui devrait avoir la Géographie et sa didactique dans la formation initiale du futur enseignant. MOTS CLÉ:Baccalauréat, Didactique de la Géographie, formation initiale, Géographie, professorat.
Borges, Ariosto e la vita segreta dei personaggi minori
Directory of Open Access Journals (Sweden)
Marco Dorigatti
2013-12-01
Full Text Available Inteso quale omaggio a Emilio Bigi, sia pure indiretto, lo studio prende spunto da un’intervista, tuttora inedita, rilasciata nel 1984 dallo scrittore argentino Jorge Luis Borges, in cui aveva citato, credendoli ariosteschi, dei versi che per lui, giunto in età ormai avanzata, erano diventati, più che un motto, una metafora di vita. Poco importa che, come verrà chiarito vagliando la loro storia e le relative fonti, quei versi, facenti capo alla misteriosa figura di un personaggio saraceno, Alibante di Toledo, in realtà appartenessero all’officina poetica di Francesco Berni: essi vengono ciò nondimeno assunti quale filo conduttore per un percorso esplorativo all’interno dell’Orlando furioso che ne vaglia la valenza per così dire “ariostesca”, giusta la reminiscenza borgesiana. Approdata infine a Cervantes, la discussione si conclude facendo ritorno a Borges e misurando l’impatto che quei medesimi versi hanno avuto sulla sua propria opera poetica.Intended as a heartfelt tribute to Emilio Bigi, albeit an indirect one, this essay draws on an interview, still unpublished, given by Argentine writer Jorge Luis Borges in 1984, in which he quoted a couple of lines of poetry which he firmly believed to be by Ariosto, and which for him, by then an old man, had become, more than a motto, a metaphor of life. It does not really matter that, as will become apparent retracing their history as well as their sources, these lines, centring on the mysterious figure of a Saracen character called Alibante of Toledo, actually belonged to Francesco Berni: they are here assumed as the main motif to be explored within Orlando furioso, in order to ascertain to what extent their nature may be regarded to be Ariostan, just as Borges thought. Having finally reached Cervantes, the discussion concludes by returning once more to Borges and considering the impact that these lines, which had remained engrained in his memory throughout his life, had on his own
Tatto, Maria Teresa; Peck, Ray; Schwille, John; Bankov, Kiril; Senk, Sharon L.; Rodriguez, Michael; Ingvarson, Lawrence; Reckase, Mark; Rowley, Glenn
2012-01-01
The Teacher Education Study in Mathematics (TEDS-M) 2008 is the first cross-national study to provide data on the knowledge that future primary and lower-secondary school teachers acquire during their mathematics teacher education. It is also the first major study to examine variations in the nature and influence of teacher education programs…
La vita è blending. Per una lettura integrata del film di Roberto Benigni
Directory of Open Access Journals (Sweden)
Emanuele Broccio
2014-05-01
Full Text Available Il notevole incremento di studi critici sulla Poetica Cognitiva sta riscattandola dall’accusa di offrire soltanto una nuova e seducente terminologia, guadagnandole invece la dignità di metodologia scientifica. Mosso dall’interesse che il fenomeno della integrazione concettuale (blending suscita, il mio intervento propone una lettura del film La vita è bella di Roberto Benigni proprio in funzione del suo organizzarsi intorno a un blending che ne sostiene l’intero impianto ideativo. Il film è stato molto criticato, oltre che per un certo impaccio tecnico nella messa in scena, per il fatto di condurre un racconto di morte e sterminio attraverso un punto di vista comico. Attraverso l’applicazione del blending, insieme ad altri strumenti di analisi classica, cercherò di dimostrare come la strutturazione del racconto intorno alla duplice contaminazione di realtà e fantasia, comico e tragico, lo sottrae dal rischio di scivolare nel melodramma e nel patetismo, mantenendo alta l’empatia dello spettatore. La mia lettura sottolinea dunque come tutto il film sia costruito su un continuo blending, e ne evidenzia le modalità di realizzazione, dimostrando, attraverso un’opera ampiamente nota e di vasto consenso, come le scienze cognitive possano offrire validi strumenti di analisi che precisano pregresse intuizioni critiche e illuminano zone dell’opera d’arte rimaste in ombra o confinate alla valutazione estetica.
Kühbeck, Felizian; Engelhardt, Stefan; Sarikas, Antonio
2014-01-01
Background and aim: Audience response (AR) systems are increasingly used in undergraduate medical education. However, high costs and complexity of conventional AR systems often limit their use. Here we present a novel AR system that is platform independent and does not require hardware clickers or additional software to be installed. Methods and results: “OnlineTED” was developed at Technische Universität München (TUM) based on Hypertext Preprocessor (PHP) with a My Structured Query Language (MySQL)-database as server- and Javascript as client-side programming languages. “OnlineTED” enables lecturers to create and manage question sets online and start polls in-class via a web-browser. Students can participate in the polls with any internet-enabled device (smartphones, tablet-PCs or laptops). A paper-based survey was conducted with undergraduate medical students and lecturers at TUM to compare "OnlineTED" with conventional AR systems using clickers. "OnlineTED" received above-average evaluation results by both students and lecturers at TUM and was seen on par or superior to conventional AR systems. The survey results indicated that up to 80% of students at TUM own an internet-enabled device (smartphone or tablet-PC) for participation in web-based AR technologies. Summary and Conclusion: “OnlineTED” is a novel web-based and platform-independent AR system for higher education that was well received by students and lecturers. As a non-commercial alternative to conventional AR systems it may foster interactive teaching in undergraduate education, in particular with large audiences. PMID:24575156
Directory of Open Access Journals (Sweden)
Kühbeck, Felizian
2014-02-01
Full Text Available [english] Background and aim: Audience response (AR systems are increasingly used in undergraduate medical education. However, high costs and complexity of conventional AR systems often limit their use. Here we present a novel AR system that is platform independent and does not require hardware clickers or additional software to be installed.Methods and results: “OnlineTED” was developed at Technische Universität München (TUM based on Hypertext Preprocessor (PHP with a My Structured Query Language (MySQL-database as server- and Javascript as client-side programming languages. “OnlineTED” enables lecturers to create and manage question sets online and start polls in-class via a web-browser. Students can participate in the polls with any internet-enabled device (smartphones, tablet-PCs or laptops. A paper-based survey was conducted with undergraduate medical students and lecturers at TUM to compare "OnlineTED" with conventional AR systems using clickers. "OnlineTED" received above-average evaluation results by both students and lecturers at TUM and was seen on par or superior to conventional AR systems. The survey results indicated that up to 80% of students at TUM own an internet-enabled device (smartphone or tablet-PC for participation in web-based AR technologies.Summary and Conclusion: “OnlineTED” is a novel web-based and platform-independent AR system for higher education that was well received by students and lecturers. As a non-commercial alternative to conventional AR systems it may foster interactive teaching in undergraduate education, in particular with large audiences.
The success rate of TED upper eyelid retraction reoperations.
Golan, Shani; Rootman, Dan B; Goldberg, Robert A
2016-12-01
Although reoperation rates for upper lid retraction surgery for thyroid eye disease (TED) typically range between 8% and 23%, there is little literature describing the outcomes of these second operations. In this retrospective observational cohort study, all patients that underwent surgery for upper eyelid retraction over a 14-year period at a single institution were included. Cases were included if a second eyelid retraction surgery was performed during the study period. Success of surgery was defined as a marginal reflex distance (MRD1) of 2.5 to 4.5 mm in each eye and less than 1 mm difference in MRD1 between the eyes. Overcorrection and undercorrection were defined as above and below these bounds, respectively. 72 eyes in 49 patients were included in the study. The mean age was 56.6 (±11.5) years. By definition, all patients had at least 1 lid lengthening surgery for upper eyelid retraction, and at least 1 subsequent surgery. For this second surgery, 61 eyes (85%) underwent retraction surgery and 11 eyes (15%) underwent ptosis surgery. After this second operation, 31% were undercorrected and 33% were overcorrected. A third surgery was performed in 19 eyes (25%), 12 had surgery for residual retraction and 7 for ptosis. After the third operation 10% of eyes were under corrected and 11% were over corrected. Four patients underwent a fourth surgery: one for retraction and three for ptosis. Success was noted in 35% after the second surgery and 44% after the third. Surgical success in eyelid retraction surgery increases from a second to a third consecutive surgery, and residual asymmetry was roughly equally distributed between over- and undercorrection.
Ethos Formula: Liturgy and Rhetorics in the Work of Ted Shawn
Directory of Open Access Journals (Sweden)
Alexander Schwan
2017-06-01
Full Text Available Beginning with Giorgio Agamben’s alignment of ethics and potentiality, this essay questions the ethical dimension of gesture in the field of dance as an eminently potentiality-bound art form. This draws on Daniel Sibony’s concept of law and dance, according to which the body simultaneously repels and longs for the law as a nexus of heteronomous structures. I frame this through a revision of Aby Warburg’s rhetorical concept, pathos formula, into the corollary term, ethos formula, as the encoded movement patterns of ethical attitudes or comportments which are motivated by decision-making rather than emotional content. Do gestures and their citation in dance bear an ethical dimension similar to the encoded transmission of emotions through movement? This new concept of ethos formula finds an excellent example in the work of the American choreographer Ted Shawn (1891–1972. His strikingly hybrid use of ethos formula from the 19th century Catholic theorist François Delsarte and his parallel practice of quoting liturgical gestures from Protestant church services, pursues the ambiguity and uncanniness of modernity itself. For Shawn—like many other protagonists of modernist dance—argues on the one hand for freeing the body from the boundaries of classical ballet in the name of individual expression, and on the other hand for an instrumentalized body that still clings to principles of taxonomy and normativity.
Gupta, B L
1991-06-01
This review surveys the emergence of electron probe X-ray microanalysis as a quantitative method for measuring the chemical elements in situ. The extension of the method to the biological sciences under the influence of Ted Hall is reviewed. Some classical experiments by Hall and his colleagues in Cambridge, UK, previously unpublished, are described; as are some of the earliest quantitative results from the cryo-sections obtained in Cambridge and elsewhere. The progress of the methodology is critically evaluated from the earliest starts to the present state of the art. Particular attention has been focused on the application of the method in providing fresh insights into the role of ions in cell and tissue physiology and pathology. A comprehensive list of references is included for a further pursuit of the topics by the interested reader.
Directory of Open Access Journals (Sweden)
Alessandra Gigli
2009-07-01
Full Text Available Il presente rapporto di ricerca costituisce l'esito del lavoro svolto dalle ricercatrici A. Gigli, S. Demozzi del Dipartimento di Scienze dell’Educazione dell’Università di Bologna all'interno del progetto Strategico di Ateneo dal titolo “Definizione di linee guida d’intervento sui pazienti pediatrici affetti da malattie emorragiche congenite: aspetti medici, psicosociali, educativi ed etici”. L'obiettivo principale del lavoro è stato quello di analizzare il punto di vista degli insegnanti in merito alla vita scolastica dei bambini con malattie emorragiche congenite (Mec, le loro relazioni con insegnanti e compagni, i rapporti tra scuola e famiglie. Per monitorare questi aspetti legati alla vita scolastica, nel 2008 è stata realizzata un’indagine sul campo che ha coinvolto insegnanti di scuole dell’infanzia, scuole primarie, scuole secondarie di primo grado della Provincia di Bologna che hanno in classe un/a bambino/a affetti da Mec. Le rilevazioni effettuate tramite interviste semi strutturate hanno avuto i seguenti obiettivi: verificare l’esistenza di rappresentazioni “distorte” delle patologie ed eventuali pregiudizi esistenti; analizzare il processo informativo attraverso cui i docenti conoscono la situazione del bambino e vengono informati sulle Mec; rilevare i nodi problematici e punti di forza, che qualificano negativamente o positivamente le relazione scuola-famiglia; monitorare l’esistenza di pregiudizi in merito alle capacità cognitive dei bambini; verificare se, secondo i docenti, la malattia influisce sulla qualità della relazione educativa, indagando, in particolare, sugli aspetti comunicativi; rilevare eventuali problematiche di integrazione nel gruppo dei pari; verificare se l’adozione di strategie per permettere una migliore integrazione o lo svolgimento delle attività didattiche, ludiche e sportive; rilevare i bisogni formativi e informativi dei docenti. Nell’articolo si presenta una lettura
O tradutor de estilos - Entrevista de Ted Polhemus a Tarcisio D'Almeida
Directory of Open Access Journals (Sweden)
Tarcisio D'Almeida
2008-11-01
Full Text Available Considerado "guru dos estilos" e idealizador do conceito "supermercado de estilos", o antropólogo Ted Polhemus é reticente quanto aos "roubos fashion" pela hegemônica indústria da moda e acredita na força e no poder da comunicação visual de estilos e comportamentos como formas de expressão humana. Na conturbada e agitada década de 1960, o antropólogo anglo-americano Ted Polhemus, 57, trocou os EUA pela Inglaterra, em especial, a ensolarada Califórnia (para onde os jovens costumavam ir pela acinzentada e enevoada Londres. Esse contexto político-histórico de busca pela liberdade ideológica da era hippie e expansão da moda com o surgimento do prêt-à-porter possibilitou ao pesquisador estudar antropologia na Temple University, na Filadélfia. Em seguida, em Londres, desenvolveu seus estudos de mestrado sobre "Body Image and Adornment" (Imagem e Adorno do Corpo na prestigiada University of London. O projeto de mapear as inter-relações entre corpo e estilo na concepção de moda e comportamento sempre norteou sua verve intelectual de um antropólogo comprometido com os fenômenos da atualidade, sobretudo os que decorrem a partir da contemporaneidade do século 20. Publicou Fashion & Anti-fashion: anthropology of clothing and adornment (Thames & Hudson, 1979, Streetstyle: from sidewalk to catwalk (Thames & Hudson, 1994 e Style Surfing: what to wear in the 3rd millennium (Thames & Hudson, 1996, entre outros. Em seu novo livro, Hot Bodies, Cool Styles: new techniques in self adornment (Thames & Hudson, 2004, lançado no final do ano passado, o "guru dos estilos" e pai do conceito "supermercado de estilos" dá mostras de como a onda global do entusiasmo para a decoração do corpo é enraizada em nosso passado e examina ainda seu sentido na prospecção do futuro. Polhemus tornou-se referência na literatura de moda e do corpo. Ao lado de outros pesquisadores do assunto, como Dick Hebdige, que conceituou a exist
Gómez Redondo, Fernando
2011-01-01
Esta nota rinde homenaje a don José Fradejas Lebrero, fallecido en diciembre de 2010, reconstruyendo desde una conversación telefónica la que pudo ser su última pesquisa filológica: averiguar el significado de la voz «rera» en el "Libro de vita beata" de Juan de Lucena. This note pays homage to don José Fradejas Lebrero, who died in December 2010, rebuilt from a telephone conversation that could be his last philological research: find the meaning of the word «rera» in the ...
Analysis of the temperature and pore water pressure field in the TED heating experiment
International Nuclear Information System (INIS)
Garitte, B.; Vaunat, J.; Gens, A.; Conil, N.; Armand, G
2012-01-01
Document available in extended abstract form only. The TED experiment is a heating experiment in Callovo-Oxfordian Clay performed in the Meuse Haute Marne underground research laboratory. It was set up by Andra to confirm the results obtained in a previous thermal experiment (TER). The main objectives are: characterisation of the thermal properties of intact argillite, identification of the Thermo-Hydro-Mechanical (THM) coupling parameters, improvement of the understanding of THM behaviour and comparison of parameters measured in-situ and in the laboratory. The three heaters in the TED experiment were installed parallel at a distance of about 2.7 m to reproduce as closely as possible the real storage case (HA cells). This arrangement should allow the verification of: i) the superposition of several temperature fields generated by the three heaters and ii) the overpressure generated in the symmetry planes between the three heaters. Three heaters 4 m long and 0.143 m diameter have been installed in parallel boreholes drilled form GED gallery. To limit the influence of the conditions prevailing in the gallery, a distance of 12 m have been left between the GED wall and the closest extremity of the heaters. Rock has been intensively instrumented within a zone of 15 m around the heaters. There are 108 thermal sensors, 10 pore pressure sensors, 2 extensometers/inclinometers, placed in 13 different small diameter boreholes (56 mm). 11 boreholes were filled with bentonite (those containing thermal and pore pressure sensors) and 2 of them left open (those equipped with extensometer/inclinometers). First heating started on 22 January 2010 at the central heater and consists of three steps: 120 days at 180 W, 150 days at 300 W and one last period at 600 W. The two lateral heaters have been switched on after 14 months following the same heating sequence. The concept and the results of the TED experiment are fully described in a companion paper. Concerning heat transport
2014-01-01
Particle accelerators exploit the cutting edge of every aspect of today's technology and have themselves contributed to many of these technologies. The largest accelerators have been constructed as research tools for nuclear and high energy physics and there is no doubt that it is this field that has sustained their development culminating in the Large Hadron Collider. Engines of discovery: a century of particle accelerators (revised and expanded edition), by Andrew Sessler and Ted Wilson, World Scientific, 2014, ISBN 9789814417198. An earlier book by the same authors, Engines of Discovery: A Century of Particle Accelerators, chronicled the development of these large accelerators and colliders, emphasising the critical discoveries in applied physics and engineering that drove the field. Particular attention was given to the key individuals who contributed, the methods they used to arrive at their particular discoveries and inventions, often recalling how their human strengths and attit...
DEFF Research Database (Denmark)
Schwartz, Lauren K; O'Keefe, Stephen J D; Fujioka, Ken
2016-01-01
of teduglutide. METHODS: Enrolled patients had completed 24 weeks of either teduglutide (TED/TED) or placebo (PBO/TED) in the initial placebo-controlled study or qualified for that study, but were not treated (NT/TED) because of full enrollment. Patients received subcutaneous teduglutide 0.05 mg/kg/day for up...... to 24 months (NT/TED and PBO/TED) or up to 30 months (TED/TED). Clinical response was defined as 20-100% reduction from baseline in weekly PS volume; baseline was considered the beginning of teduglutide treatment in the initial placebo-controlled study (TED/TED) or STEPS-2 (NT/TED and PBO/TED...... albumin remained stable. In patients who completed the study, clinical response was achieved in 28/30 (93%) TED/TED, 16/29 (55%) PBO/TED, and 4/6 (67%) NT/TED patients. Mean PS volume reductions from baseline were 7.6 (66%), 3.1 (28%), and 4.0 (39%) l/week in the TED/TED, PBO/TED, and NT/TED groups...
Green, B N; Johnson, C D; Keating, J C
1998-06-01
Long before technology assessment and continuous quality improvement were in vogue in chiropractic, Ted L. Shrader, D.C., F.I.C.C., was working toward these goals in the profession. Convinced that chiropractic must change from within for the benefit of society, Dr. Shrader has made a career-long commitment to evaluating chiropractic procedures and establishing consensus statements regarding chiropractic principle. Determined in mind, moral by nature, and unobtrusive in manner, Dr. Shrader has been decidedly effective in his endeavors. He has encouraged in chiropractic a mind for critical thinking. The fruits of his labor can be seen today in chiropractic publication, among chiropractic scholars, within the American Chiropractic Association Council on Technique, in conference proceedings, and in our institutions.
Directory of Open Access Journals (Sweden)
Ewelina Drzewiecka
2015-12-01
Full Text Available "The paper focuses on the relations between two 16th century works: Marcellus Palingenius’ The Zodiac of Life and Mikołaj Rej’s The Image of a Good Man’s Life. The philosophical poem Zodiacus vitae fell into oblivion in Italy, but has gained considerable popularity all over Europe since the 16th century. In Poland all the greatest Renaissance humanists, such as Jan Kochanowski and Mikołaj Rej, knew and read it. The latter, clearly inspired by the work of the Italian master, published The Image of a Good Man’s Life in 1558. Since the 19th century there have been some comparative studies of The Zodiac and The Image in the field of Polish literature. This article presents the current state of the research and points out general similarities and differences between these works, regarding both the story line and philosophy. "
International Nuclear Information System (INIS)
Spurny, F.; Brabcova, K.; Jadrnickova, I.; Uchihori, Y.; Kitamura, H.; Yasuda, N.; Molokanov, A. G.
2009-01-01
The sets of track etched detectors based (TED) spectrometer's of the linear energy transfer (LET) have been, together with two types of thermoluminescent detectors (TLD)and MDU- Liulin energy deposition spectrometer exposed in the C 290 MeV/n and Ne 400 MeV/n ion beams at the HlMAC installation at NIRS, Chiba, Japan. The experiment has been performed in the frame of NPI project 20P241 agreed by HlMAC P AC at the beginning of 2008 year. Up to now, moxstle only results obtained in C-ion beam have been treated and analyzed. Sets of TED spectrometer's and TLD detectors have been exposed in 19 depths in the C-ion beam with expected LET values of primary particles from 13 keV/μm in water, through the Bragg peak area up to two depth behind the Bragg peak. The contribution of fragments to total number of events, and to the energy absorbed in Si has been determined, when possible separately for different fragments. In all cases also total contribution of fragments (and other secondary particles) to the total number of energy deposition events and to the absorbed dose has been estimated. LET and energy deposition spectra obtained will be compared together , a good agreement of data has bee stated. Some of results have been also compared with those obtained by calculation by means of PHITS code. (authors)
Action in the vita activa: Plurality, freedom, power, and the language of Daang Matuwid
Directory of Open Access Journals (Sweden)
Joefer Maninang
2016-01-01
Full Text Available “A life without speech and without action…is literally dead to the world; it has ceased to be a human life because it is no longer lived among men.” – H. Arendt, The Human Condition In her celebrated philosophical work The Human Condition (HC,woman philosopher - political theorist Johanna “Hannah” Arendt (1906-75 writes in the Prologue, “What I propose, therefore, is very simple: it is nothing more than to think what we are doing.” What we are doing, Arendt reiterates, is the central theme of her philosophical work which investigates the vita activa, a term she uses to designate three fundamental human activities namely labor, work, and action. These activities according to Arendt correspond to the basic human conditions of life, worldliness, and plurality respectively which in turn are under the most general condition of existence: birth and death, natality, and mortality (Arendt, 1998. The central theme “what we are doing” is from where this whole papers reflective expository analysis of the current Philippine government administrations political battle cry of Daang Matuwid or “straight path” - the national anti-corruption campaign or honesty in the government platform proceeds and takes inspiration (Casiple, 2014. As we may have known, Daang Matuwid is executed as a public policy by President Benigno “Noynoy” Aquino III (popularly addressed as “PNoy” for President Noynoy in his legitimate capacity being the highest official of the country. Daang Matuwid is implemented in all branches of the government: the executive, the legislative, the judicial and their departments. It applies to all institutions in their functions, to all offices and their affiliates. Daang Matuwid is mandated to be observed by all government personnel; elected and appointed officials (the president himself included, administrators and staff, and extends to employees of corporations in the public service. Daang Matuwid simply means honesty
Energy Technology Data Exchange (ETDEWEB)
De Bari, I; Dinnino, G; Braccio, G [Dipartimento Tecnologie per l' Energia, Fonti Rinnovabili e Risparmio Energetico, ENEA, Centro Ricerche Trisaia, Matera (Italy)
2008-07-01
In this report, the mass and energy balance along with a land-to-wheel Life Cycle Assessment (LCA) is described for a corn stover-to-ethanol industrial process assumed to consist of the main technologies being researched at ENEA TRISAIA: pretreatment by steam explosion and enzymatic hydrolysis. The modelled plant has a processing capacity of 60kt/y (dimensioned on realistic supplying basins of residues in Italy); biomass is pre-treated by acid catalyzed-steam explosion; cellulose and hemicelluloses are hydrolyzed and separately fermented; enzymes are on-site produced. The main target was to minimize the consumption of fresh water, enzymes and energy. The results indicate that the production of 1kg bio ethanol (95.4 wt%) requires 3.5 kg biomass dry matter and produces an energy surplus up to 740 Wh. The main purpose of the LCA analysis was to assess the environmental impact of the entire life cycle from the bio ethanol production up to its end-use as E10 blended gasoline. Boustead Model was used as tool to compile the life cycle inventory. The results obtained and discussed in this reports suffer of some limitations deriving from the following main points: some process yields have been extrapolated according to optimistic development scenarios; the energy and steam recovery could be lower than that projected because of lacks in the real systems; water recycle could be limited by the yeast tolerance toward the potential accumulation of toxic compounds. Nevertheless, the detailed process analysis here provided has its usefulness in: showing the challenging targets (even if they are ambitious) to bet on to make the integrated process feasible; driving the choice of the most suitable technologies to bypass some process bottlenecks. [Italian] Questo rapporto illustra il bilancio di massa e di energia insieme alla valutazione del Ciclo di vita (LCA) per un processo industriale di produzione di bioetanolo da residui di mais costituito dalle principali tecnologie studiate
Seidner, Douglas L; Fujioka, Ken; Boullata, Joseph I; Iyer, Kishore; Lee, Hak-Myung; Ziegler, Thomas R
2018-05-15
Patients with intestinal failure associated with short bowel syndrome (SBS-IF) require parenteral support (PS) to maintain fluid balance or nutrition. Teduglutide (TED) reduced PS requirements in patients with SBS-IF in the randomized, placebo (PBO)-controlled STEPS study (NCT00798967) and its 2-year, open-label extension, STEPS-2 (NCT00930644). STEPS-3 (NCT01560403), a 1-year, open-label extension study in patients with SBS-IF who completed STEPS-2, further monitored the safety and efficacy of TED (0.05 mg/kg/day). Baseline was the start of TED treatment, in either STEPS or STEPS-2. At the end of STEPS-3, patients treated with TED in both STEPS and STEPS-2 (TED-TED) received TED for ≤42 months, and patients treated with TED only in STEPS-2 (no TED treatment [NT]/PBO-TED) received TED for ≤36 months. Fourteen patients enrolled (TED-TED, n = 5; NT/PBO-TED, n = 9) and 13 completed STEPS-3. At the last dosing visit, mean (SD) PS was reduced from baseline by 9.8 (14.4 [50%]) and 3.9 (2.8 [48%]) L/week in TED-TED and NT/PBO-TED, respectively. Mean (SD) PS infusions decreased by 3.0 (4.6) and 2.1 (2.2) days per week from baseline in TED-TED and NT/PBO-TED, respectively. Two patients achieved PS independence; 2 additional patients who achieved independence in STEPS-2 maintained enteral autonomy throughout STEPS-3. All patients reported ≥1 treatment-emergent adverse event (TEAE); 3 patients had TEAEs that were reported as treatment related. No patient had a treatment-related treatment-emergent serious AE. Long-term TED treatment yielded a safety profile consistent with previous studies, sustained efficacy, and a further decline in PS requirements. © 2018 The Authors. Nutrition in Clinical Practice published by Wiley Periodicals, Inc. on behalf of American Society for Parenteral and Enteral Nutrition.
Talboom-Kamp, E P W A; Verdijk, N A; Blom, C M G; Harmans, L M; Talboom, I J S H; Numans, M E; Chavannes, N H
2016-08-16
COPD is a highly complex disease to manage as patients show great variation in symptoms and limitations in daily life. In the last decade self-management support of COPD has been introduced as an effective method to improve quality and efficiency of care, and to reduce healthcare costs. Despite the urge to change the organisation of health care and the potential of eHealth to support this, large-scale implementation in daily practice remains behind, especially in the Netherlands. We designed a multilevel study, called e-Vita, to investigate different organisational implementation methods of a self-management web portal to support and empower patients with COPD in three different primary care settings. Using a parallel cohort design, the clinical effects of the web portal will be assessed using an interrupted times series (ITS) study design and measured according to changes in health status with the Clinical COPD Questionnaire (CCQ). The different implementations and net benefits of self-management through eHealth on clinical outcomes will be evaluated from human, organisational, and technical perspectives. To our knowledge this is the first study to combine different study designs that enable simultaneous investigation of clinical effects, as well as effects of different organisational implementation methods whilst controlling for confounding effects of the organisational characteristics. We hypothesize that an implementation with higher levels of personal assistance, and integrated in an existing care program will result in increased use of and satisfaction with the platform, thereby increasing health status and diminishing exacerbation and hospitalisation. NTR4098 (31-07-2013).
Inchiesta sulle condizioni di vita e sanitarie degli immigrati presenti nella cittá di Messina
Directory of Open Access Journals (Sweden)
D. Alfino
2003-05-01
Full Text Available A Messina e nella sua provincia vivono circa 7328 stranieri con regolare permesso di soggiorno (dati aggiornati al 31/12/02 Questura di Messina Ufficio Immigrati ai quali si deve aggiungere una quota di soggetti, irregolari e clandestini, stimata intorno al 25% dei regolari (fonte dati Caritas, Kirone. Le Comunità maggiormente presenti sono quelle provenienti dalle Filippine, Marocco, Sri Lanka. Al fine di valutare il livello di assistenza sanitaria fornita agli immigrati, nel periodo compreso tra Dicembre 2002 e Maggio 2003, abbiamo intervistato un campione di immigrati relativamente alle loro abitudini di vita, sul tipo di lavoro svolto, sullo stato di salute attuale e pregresso, sull’eventuale ricorso alle strutture del Servizio Sanitario Locale e sulle vaccinazioni praticate nel Paese di origine e in Italia. Sono stati intervistati 1204 soggetti (42,19% Sri Lanka, 24,75% Marocco, 25,91% Filippine, 3,15% Tunisia, 1,82% Senegal, 0,16% Algeria. La comunità cinese, anch’essa significativamente presente nella città, si è dimostrata diffidente e non interessata alla nostra indagine. Sono state evidenziate notevoli carenze del Servizio Sanitario locale, per mancanza di un sistema di monitoraggio e prevenzione rivolto agli immigrati. Il 99% degli intervistati pur essendo iscritto al S.S.N.ed avendo nell’84% il medico di famiglia, non possiede il libretto sanitario, è stato sottoposto alle vaccinazioni obbligatorie del Paese di origine, ma non le ha integrate con quelle Italiane, ad eccezione del 2,3% di soggetti che ha praticato quella antiinfluenzale e dell’ 1,2% che si è sottoposto a quella antitifica ed antiepatite A per motivi occupazionali. Malgrado l’intervista mirasse a sondare il livello di assistenza sanitaria, ha svelato altri dettagli: il 79,2% dei soggetti cerca di mantenere le abitudini alimentari originarie; solo lo 0,5% ha dichiarato di aver subito un infortunio, mentre riguardo al tipo di attività svolta si rilevano
Curriculum vitae of the LOTOS–EUROS (v2.0 chemistry transport model
Directory of Open Access Journals (Sweden)
A. M. M. Manders
2017-11-01
Full Text Available The development and application of chemistry transport models has a long tradition. Within the Netherlands the LOTOS–EUROS model has been developed by a consortium of institutes, after combining its independently developed predecessors in 2005. Recently, version 2.0 of the model was released as an open-source version. This paper presents the curriculum vitae of the model system, describing the model's history, model philosophy, basic features and a validation with EMEP stations for the new benchmark year 2012, and presents cases with the model's most recent and key developments. By setting the model developments in context and providing an outlook for directions for further development, the paper goes beyond the common model description.With an origin in ozone and sulfur modelling for the models LOTOS and EUROS, the application areas were gradually extended with persistent organic pollutants, reactive nitrogen, and primary and secondary particulate matter. After the combination of the models to LOTOS–EUROS in 2005, the model was further developed to include new source parametrizations (e.g. road resuspension, desert dust, wildfires, applied for operational smog forecasts in the Netherlands and Europe, and has been used for emission scenarios, source apportionment, and long-term hindcast and climate change scenarios. LOTOS–EUROS has been a front-runner in data assimilation of ground-based and satellite observations and has participated in many model intercomparison studies. The model is no longer confined to applications over Europe but is also applied to other regions of the world, e.g. China. The increasing interaction with emission experts has also contributed to the improvement of the model's performance. The philosophy for model development has always been to use knowledge that is state of the art and proven, to keep a good balance in the level of detail of process description and accuracy of input and output, and to keep a good record
Lifestyle and emotional well-being in men and women with type 2 diabetes (e-VitaDM-4; ZODIAC-48).
Hendriks, Steven H; van Soldt, Evelien G W; van Vugt, Michael; Groenier, Klaas H; Roelofsen, Yvonne; Maas, Angela H E M; Bilo, Henk J G; Kleefstra, Nanne; van Hateren, Kornelis J J
2017-12-01
Whether lifestyle is associated with well-being in patients with type 2 diabetes (T2D) is largely unknown. Uncovering and clarifying associations between these constructs may lead to new strategies for improving both. The aim was to investigate the relationship between lifestyle and well-being, focussing on gender differences. This cross-sectional study included 1085 patients with T2D that participated in the e-Vita part of the Zwolle outpatient diabetes project integrating available care (ZODIAC) study. Patients were included from May 2012 until September 2014 from 52 general practices. Emotional well-being was assessed with the World Health Organization-5 well-being index (WHO-5). Lifestyle information on body mass index, smoking, physical activity and alcohol use was extracted from self-reported questionnaires. Multiple linear regression analyses were used. After adjustment for other lifestyle factors, physical activity, smoking and drinking 22-35 alcohol consumptions per week were associated with the WHO-5 score in men and physical activity and smoking were associated with the WHO-5 score in women. In the fully adjusted analyses for the total study population, physical activity and smoking were still associated with the WHO-5 score (b = 1.1, P men: b =0.8, P = .006, in women: b = 1.4, P = .001). This study shows a negative, non-clinically relevant association between smoking and emotional well-being in the total population with T2D and a positive, non-clinically relevant association between physical activity and emotional well-being in both men and women with T2D.
Estcourt, Stephanie; Hickey, Janis; Perros, Petros; Dayan, Colin; Vaidya, Bijay
2009-09-01
A recent consensus statement from the European Group on Graves' Orbitopathy recommends referring all patients with thyroid eye disease (TED), except the mildest cases, to a specialist multidisciplinary clinic. To study the patients' experiences of accessing services for the treatment of TED in the UK. A postal questionnaire survey of 395 members of two patients support organisations for TED in the UK, the TED Charitable Trust and the British Thyroid Foundation. The response rate was 67%. The majority of responders were females (91%) and aged above 45 (74%). There were delays in the diagnosis and referral. In 26% of responders, the time lapsed from the first symptoms to the diagnosis of TED for over 12 months. There was a wide variation in the type of clinic and healthcare professionals involved in the treatment of TED. Only 25% of the responders attended a specialist TED clinic. Out of these, 33% waited over 6 months from the first consultation with a doctor to being seen at a specialist TED clinic. Only 56% of responders were satisfied with the treatment they received for TED. More responders who had attended a specialist TED clinic were satisfied with the treatment than those who had not attended a specialist clinic (67 vs 52%, P<0.05). Only a minority of patients with TED are treated at a specialist TED clinic in the UK. Those patients who are treated at a specialist TED clinic are more likely to be satisfied with the treatment.
Wang, Chia-Yu; Ho, Ren-Wen; Fang, Po-Chiung; Yu, Hun-Ju; Chien, Chun-Chih; Hsiao, Chang-Chun; Kuo, Ming-Tse
2018-04-12
To investigate function and morphology of the meibomian gland (MG) in patients with thyroid eye disease (TED). In this prospective case series study, patients with unilateral or bilateral TED were consecutively enrolled. The diagnosis of TED was based on the typical orbital findings and/or radiographic evidence. The disease activity of TED was classified according to the clinical activity score (CAS). Degrees of lagophthalmos and exophthalmos, blinking rates, and results of the Schirmer test 1 were also recorded. All patients completed the SPEED questionnaire and underwent MG assessment, including lipid layer thickness (LLT), MG dropout (MGd), and MG expression. In total 31 eyes from 17 patients with unilateral or bilateral TED were included. Patients were divided into inactive TED (CAS 0-1; 20 eyes from 11 patients) and active TED (CAS 2-3, 11 eyes from 6 patients) groups. MGd was significantly more severe in the active TED than the inactive TED group [Median (Inter-quartile region): 3.0 (2.0-3.0) vs. 2.0 (1.0-2.0) degree, P = 0.04]. However, patients with active TED had thicker LLT than those with inactive TED (90.0 [80.0-100.0] vs. 65.0 [47.8-82.5] nm, P = 0.02), and LLT was positively correlated with lagophthalmos (r = 0.37, P = 0.04). Patients with active TED had more severe MGd, but thicker LLT. Active TED may cause periglandular inflammation of MGs, leading to MGd, but compensatory secretion from residual MGs and lagophthalmos-induced forceful blinking might temporarily release more lipids over the tear film.
International Nuclear Information System (INIS)
Kamata, I.; Nagano, M.; Tsuchida, H.; Chen, Y.; Dudley, M.
2009-01-01
Topography image variation of threading edge dislocations (TEDs) in 4H-SiC epilayers has been investigated by grazing incidence high-resolution synchrotron topography. Six different images of TEDs resulting from an angle between the diffraction vector and the TED Burgers vector were confirmed by correlation between experimental topography images and simulation results. The TED-type distribution, dependent on the direction of the TED Burger vector, was examined on epitaxial wafers, while the spatial distribution of TEDs on a whole 2 in wafer along (1 1 2 0) and (1 1 0 0) was investigated.
Ted Irving and the Precambrian continental drift of (within?) the Canadian Shield
Hoffman, P. F.
2014-12-01
Ted Irving was no stranger to the Precambrian when he began paleomagnetic studies in the Canadian Shield (CS) that would dominate his research in the early and mid-1970's. Twenty years before, his graduate work on billion-year-old strata in Scotland established paleomagnetic methodologies applicable to sedimentary rocks generally. In 1958, he and Ronald Green presented an 'Upper Proterozoic' APW path from Australia as evidence for pre-Carboniferous drift relative to Europe and North America (the poles actually range in age from 1.2 to 2.7 Ga). His first published CS poles were obtained from the Franklin LIP of the Arctic platform and demonstrate igneous emplacement across the paleoequator. Characteristically, his 1971 poles are statistically indistinguishable from the most recent grand mean paleopole of 2009. His main focus, however, was on the question of Precambrian continental drift. He compared APW paths with respect to Laurentia with those obtained from other Precambrian shields, and he compared APW paths from different tectonic provinces within the CS. He was consistently antagonistic to the concept of a single long-lived Proterozoic supercontinent, but he was on less certain ground regarding motions within the CS due to inadequate geochronology. With Ron Emslie, he boldly proposed rapid convergence between parts of the Grenville Province and Interior Laurentia (IL) ~1.0 Ga. This was controversial given the uncertain ages of multiple magnetic components in high-grade metamorphic rocks. With John McGlynn and John Park, he developed a Paleoproterozoic APW path for the Slave Province from mafic dikes and red clastics, encompassing the time of consolidation of IL during 2.0-1.8 Ga orogenesis. Before 1980, he constructed Paleoproterozoic APW paths for IL as a whole, finding little evidence for significant internal displacement. He recognized that the Laurentian APW path describes a series of straight tracks linked by hairpins, the latter corresponding in age to
Evaluation of Dental Shade Guide Variability Using Cross-Polarized Photography.
Gurrea, Jon; Gurrea, Marta; Bruguera, August; Sampaio, Camila S; Janal, Malvin; Bonfante, Estevam; Coelho, Paulo G; Hirata, Ronaldo
2016-01-01
This study evaluated color variability in the A hue between the VITA Classical (VITA Zahnfabrik) shade guide and four other VITA-coded ceramic shade guides using a Canon EOS 60D camera and software (Photoshop CC, Adobe). A total of 125 photographs were taken, 5 per shade tab for each of 5 shades (A1 to A4) from the following shade guides: VITA Classical (control), IPS e.max Ceram (Ivoclar Vivadent), IPS d.SIGN (Ivoclar Vivadent), Initial ZI (GC), and Creation CC (Creation Willi Geller). Photos were processed with Adobe Photoshop CC to allow standardized evaluation of hue, chroma, and value between shade tabs. None of the VITA-coded shade tabs fully matched the VITA Classical shade tab for hue, chroma, or value. The VITA-coded shade guides evaluated herein showed an overall unmatched shade in all tabs when compared with the control, suggesting that shade selection should be made using the guide produced by the manufacturer of the ceramic intended for the final restoration.
Energy Technology Data Exchange (ETDEWEB)
Zerlia, Tiziana [Stazione Sperimentale per i Combustibili, San Donato Milanese (Italy)
2004-07-01
of infrastructure,..); (b) raw gas composition (CH4/Co2); (c) methodologies used to evaluate/measure emissions. Thus, while the uncertainly in Co2 emissions by combustion is rather low, the estimate of pre combustion emissions evaluated by using default emission factors coupled with different methodologies and/or different system boundaries, may have a wide (and, most of all, unknown) range of uncertainty especially in some fuel producing countries. All this suggests that. owing to the heavy Italian reliance on fossil imports, the emission reduction projects aimed to earn carbon credits by the Kyoto mechanisms might really play a significant role to help Italy to fulfil the Kyoto commitments and to give the private sector growth opportunities abroad. At the same time, it seems obvious that the carbon emissions can be really t rated just when data concerning them are reliable. Thus, the harmonization of the emission evaluation approaches and the adoption of recognized methodologies of measure/estimate, constitute binding items to make it possible that the Kyoto mechanisms and their environmental targets can work. [Italian] In un precedente studio sul ciclo di vita dei combustibili fossili nella produzione termoelettrica sono stati individuati i principali punti deboli di carbone, olio e gas nello stadio combustione. L'attenzione viene ora rivolta al segmento precombustione del gas naturale e del carbone. I risultati mostrano l'entita' delle emissioni di gas serra precombustione, la loro incidenza sul ciclo di vita completo e l'elevata incertezza della stima legata principalmente alla sito-specificita' delle torri delle emissioni nel segmento precombustione e alla metodologia seguita.
Awuni, Victoria; Alhassan, Martha Wunnam; Amagloh, Francis Kweku
2018-01-01
Refining food recipes with orange-fleshed sweet potato (OFSP) has the potential to improve dietary intake of vitamin A. The objectives of this study were to utilize OFSP in the development of two composite bread types and to assess their contribution to dietary intake of vitamin A using the dietary reference intake of lactating mothers. Two composite OFSP-wheat flour bread recipes-vita butter bread and vita tea bread-were developed by incorporating 46% OFSP puree in existing 100% wheat flour bread recipes consumed by Ghanaians. A paired-preference test was used to profile the appearance, aroma, sweetness, and overall degree of liking of the vita butter bread and vita tea bread and their respective 100% wheat flour bread types. Weighed bread intake by lactating mothers ( n = 50) was used to estimate the contribution to dietary vitamin A based on the trans β-carotene content. The developed vita butter bread and vita tea bread were most preferred by at least 77% ( p bread was 247 g, and for vita tea bread was 196 g. The trans β-carotene content of vita butter bread and vita tea bread were found to be 1.333 mg/100 g and 0.985 mg/100 g, respectively. The estimated trans-β-carotene intake was 3,293 μg/day (vita butter) and 1,931 μg/day (vita tea) based on the weighed bread intake, respectively, meeting 21% and 12% of the daily requirement (1,300 μg RAE/day) for lactating mothers, the life stage group with the highest vitamin A requirement. OFSP therefore could composite wheat flour to bake butter and tea bread, and will contribute to significant amount of dietary intake of vitamin A.
Lee, Hwa; Lee, Young Hen; Suh, Sang-Il; Jeong, Eun-Kee; Baek, Sehyun; Seo, Hyung Suk
The aim of this study was to determine whether the optic nerve is affected by thyroid eye disease (TED) before the development of dysthyroid optic neuropathy with diffusion-tensor imaging (DTI). Twenty TED patients and 20 controls were included. The mean, axial, and radial diffusivities and fractional anisotropy (FA) value were measured at the optic nerves in DTI. Extraocular muscle diameters were measured on computed tomography. The diffusivities and FA of the optic nerves were compared between TED and controls and between active and inactive stages of TED. The correlations between these DTI parameters and the clinical features were determined. The mean, axial, and radial diffusivities were lower in TED compared with the controls (P optic nerve before dysthyroid optic neuropathy in TED. The FA, in particular, reflected TED activity and severity.
Short-term diffusive sampler for nitrogen dioxide monitoring in epidemiology
International Nuclear Information System (INIS)
Michaud, J.P.; Quackenboss, J.
1991-01-01
An automated timed exposure diffusive sampler (TEDS) for sampling nitrogen dioxide (NO 2 ) was developed for use in epidemiological studies. The TEDS sequentially exposes four passive sampling devices (PSD) by microprocessor controlled valves while a pump and air flow guide prevent sampler starvation. Two TEDS units and two portable, real-time NO 2 monitors were tested for accuracy, precision, sensitivity, and linearity of response. The accuracy of the TEDS was within 10 percent of the means of the measured values. The TEDS sensitivity was 20 to 30 ppb-hour for NO 2 . Co-location of the TEDS with a chemiluminescent NO x monitor (EPA reference method) showed a similar responses to ambient NO 2 . TEDS allows better time resolution than traditional diffusive samplers (i.e., Palmes tube) while sharing their ability to sample a variety of gases
Talboom-Kamp, Esther Pwa; Verdijk, Noortje A; Kasteleyn, Marise J; Harmans, Lara M; Talboom, Irvin Jsh; Looijmans-van den Akker, Ingrid; van Geloven, Nan; Numans, Mattijs E; Chavannes, Niels H
2017-08-16
Worldwide nearly 3 million people die from chronic obstructive pulmonary disease (COPD) every year. Integrated disease management (IDM) improves quality of life for COPD patients and can reduce hospitalization. Self-management of COPD through eHealth is an effective method to improve IDM and clinical outcomes. The objective of this implementation study was to investigate the effect of 3 chronic obstructive pulmonary disease eHealth programs applied in primary care on health status. The e-Vita COPD study compares different levels of integration of Web-based self-management platforms in IDM in 3 primary care settings. Patient health status is examined using the Clinical COPD Questionnaire (CCQ). The parallel cohort design includes 3 levels of integration in IDM (groups 1, 2, 3) and randomization of 2 levels of personal assistance for patients (group A, high assistance, group B, low assistance). Interrupted time series (ITS) design was used to collect CCQ data at multiple time points before and after intervention, and multilevel linear regression modeling was used to analyze CCQ data. Of the 702 invited patients, 215 (30.6%) registered to a platform. Of these, 82 participated in group 1 (high integration IDM), 36 in group 1A (high assistance), and 46 in group 1B (low assistance); 96 participated in group 2 (medium integration IDM), 44 in group 2A (high assistance) and 52 in group 2B (low assistance); also, 37 participated in group 3 (no integration IDM). In the total group, no significant difference was found in change in CCQ trend (P=.334) before (-0.47% per month) and after the intervention (-0.084% per month). Also, no significant difference was found in CCQ changes before versus after the intervention between the groups with high versus low personal assistance. In all subgroups, there was no significant change in the CCQ trend before and after the intervention (group 1A, P=.237; 1B, P=.991; 2A, P=.120; 2B, P=.166; 3, P=.945). The e-Vita eHealth-supported COPD
Development of fabrication method for thermal expansion difference irradiation temperature monitor
International Nuclear Information System (INIS)
Noguchi, Kouichi; Takatsudo, Hiroshi; Miyakawa, Shun-ichi; Kobori, Takahisa; Miyo, Toshimasa
1998-03-01
This report describes the development activities for the fabrication of the Thermal Expansion Difference irradiation temperature monitor (TED) at the Oarai Engineering Center (OEC)/PNC. TED is used for various irradiation tests in the experimental fast reactor JOYO. TED is the most accurate off-line temperature monitor used for irradiation examination. The TED is composed of a metallic sphere lid and either a stainless steel or nickel alloy container. Once the container is filled with sodium, the metallic sphere lid is sealed by using a resistance weld. This capsule is then loaded into a reactor. Once a TED is loaded into the JOYO reactor, the sodium inside the metallic container increases as a result of thermal expansion. The TED identifies the peak irradiation temperature of the reactor based on a formula correlating temperature to increment values. This formula is established specifically for the particular TED being used during a calibration process performed when the TED is fabricated. Initially the TED was developed by Argonne National Laboratory (ANL) in the United States, and was imported by PNC for use in the JOYO reactor. In 1992 PNC decided to fabricate TED domestically in order to ensure the stability of future supplies. Based on technical information provided by ANL, PNC began fabrication of a TED on an experimental basis. In addition, PNC endeavored to make the domestically produced TED more efficient. This involved improving the techniques used in the sodium filling and the metallic sphere welding processes. These quality control efforts led to PNC's development of processes enabling the capsules to be filled with sodium to nearly 100%. As a result, the accuracy of the temperature dispersion in the out-pile calibration test was improved from +/-10degC to +/-5degC. In 1996 the new domestically fabricated TED was attached to a JOYO irradiation rig. In March of 1997, irradiation of the rig was started on the 30th duty cycle operation, and should be
Wei, Shihu; Fukuhara, Hideo; Chen, Guang; Kawada, Chiaki; Kurabayashi, Atsushi; Furihata, Mutsuo; Inoue, Keiji; Shuin, Taro
2014-01-01
The aim of this study was to investigate whether terrestrosin D (TED) inhibits the progression of castration-resistant prostate cancer and consider its mechanism. Cell cycle, mitochondrial membrane potential (ΔΨm) and apoptosis were determined by flow cytometry. Caspase-3 activity and vascular endothelial growth factor secretion were detected by a caspase-3 assay and human vascular endothelial growth factor kit, respectively. A PC-3 xenograft mouse model was used to evaluate the anticancer effect of TED in vivo. In vitro, TED strongly suppressed the growth of prostate cancer cells and endothelial cells in a dose-dependent manner. TED induced cell cycle arrest and apoptosis in PC-3 cells and human umbilical vascular endothelial cells (HUVECs). TED-induced apoptosis did not involve the caspase pathway. TED also decreased ΔΨm in PC-3 cells and HUVECs. In vivo, TED significantly suppressed tumor growth in nude mice bearing PC-3 cells, without any overt toxicity. Immunohistochemical analysis showed TED induced apoptotic cell death and inhibited angiogenesis in xenograft tumor cells. Cell cycle arrest and induction of apoptosis in cancer cells and endothelial cells might be plausible mechanisms of actions for the observed antitumor and antiangiogenic activities of TED. © 2014 S. Karger AG, Basel.
I bookcrossers, una comunità (virtuale di donatori
Directory of Open Access Journals (Sweden)
Alessandra Guigoni
2003-09-01
Full Text Available In conclusione, ci pare di poter dire che le comunità virtuali, dopo aver trascorso anni nel mondo online, sembrano (in questo come in altri casi analoghi volersi riappropriare di spazi, oggetti e relazioni sociali del mondo offline. E' altresì l'occasione per fare il punto sulle comunità virtuali di interesse intellettuale, ossia basate su interessi culturali condivisi, di cui la comunità dei BCs fa parte, e in cui l'interazione tra vita virtuale e vita reale è intensa e decisamente più impegnata nel mondo reale che in passato. Questa maggiore integrazione tra vita online e vita offline costituisce un'evoluzione plausibile delle comunità virtuali d'interesse, che, oltre ad avere come in passato argomenti ancorati al mondo reale (interessi ed esperienze di vita da condividere, conoscenze e competenze, progetti da costituire nella vita telematica, da qualche tempo stanno creando legami attraverso spazi, oggetti e reti reali, come nel caso del bookcrossing appunto.
Skipping of exon 27 in C3 gene compromises TED domain and results in complete human C3 deficiency.
da Silva, Karina Ribeiro; Fraga, Tatiana Rodrigues; Lucatelli, Juliana Faggion; Grumach, Anete Sevciovic; Isaac, Lourdes
2016-05-01
Primary deficiency of complement C3 is rare and usually associated with increased susceptibility to bacterial infections. In this work, we investigated the molecular basis of complete C3 deficiency in a Brazilian 9-year old female patient with a family history of consanguinity. Hemolytic assays revealed complete lack of complement-mediated hemolytic activity in the patient's serum. While levels of the complement regulatory proteins Factor I, Factor H and Factor B were normal in the patient's and family members' sera, complement C3 levels were undetectable in the patient's serum and were reduced by at least 50% in the sera of the patient's parents and brother. Additionally, no C3 could be observed in the patient's plasma and cell culture supernatants by Western blot. We also observed that patient's skin fibroblasts stimulated with Escherichia coli LPS were unable to secrete C3, which might be accumulated within the cells before being intracellularly degraded. Sequencing analysis of the patient's C3 cDNA revealed a genetic mutation responsible for the complete skipping of exon 27, resulting in the loss of 99 nucleotides (3450-3549) located in the TED domain. Sequencing of the intronic region between the exons 26 and 27 of the C3 gene (nucleotides 6690313-6690961) showed a nucleotide exchange (T→C) at position 6690626 located in a splicing donor site, resulting in the complete skipping of exon 27 in the C3 mRNA. Copyright © 2016. Published by Elsevier GmbH.
Directory of Open Access Journals (Sweden)
Tamara Lönngren
2003-02-01
Full Text Available This paper attempts to show that Nil Sorskii, the author of the well-known three-volume "Sobornik", in compiling this collection of ancient Greek vitae used Greek texts as well as Slavonic translations. He compared the Slavonic texts with the Greek originals and corrected their difficult archaic language, thus turning it into the understandable simple Russian language of his own time.
Phasing out of the Universal Mega Dose of Vitamin-A Prophylaxis to Avoid Toxicity
Directory of Open Access Journals (Sweden)
Sudip Bhattacharya
2017-01-01
Full Text Available Childhood blindness due to corneal ulceration was prevalent among poor Indian children. To tackle this situation, the National Institute of Nutrition (NIN, Hyderabad, India, Vitamin-A (Vit-A prophylaxis programme was launched nationally in 1970 after field testing. Research of Indian Council for Medical Research (ICMR documented that prevalence of Vit-A deficiency signs such as Bitot’s spot decreased among children, over a period of time. However, this decrease cannot be ascertained is due to mass Vit-A prophylaxis programme. This is because coverage was low and patchy. Improved nutrition status, wider vaccination coverage, increased rate in breast feeding and improvement of healthcare services played a crucial role. Rather many studies revealed that (mass prophylaxis to the child who is having adequate Vit-A level it may be harmful to certain group of children as a result of acute toxic symptoms. High dose of Vit-A is capable of loss of bone density-hence retarded growth may be observed in susceptible individuals. To tackle this issue food based approach should be promoted (which includes breast feeding along with timely measles vaccination. The children who have signs of Vit-A deficiency (e.g. night blindness, xeropthalmia, Bitot’s spot or post measles children should receive Vit-A in age specific daily doses for two weeks along with Vit-A rich food, like green leafy vegetables, red palm oil, liver etc. Public spirited citizens, together with scientific community in India, should discourage this “one size fit to all” approach. It will not only avoid the ill effects of high dose of Vit-A but also it will help us optimal utilization of health resources in a resource poor country like India.
Management of thyroid eye disease in the United Kingdom: A multi-centre thyroid eye disease audit.
Mellington, F E; Dayan, C M; Dickinson, A J; Hickey, J L; MacEwen, C J; McLaren, J; Perros, P; Rose, G E; Uddin, J; Vaidya, B; Foley, P; Lazarus, J H; Mitchell, A; Ezra, D G
2017-06-01
This article aims to provide baseline data and highlight any major deficiencies in the current level of care provided for adult patients with thyroid eye disease (TED). We undertook a prospective, nonrandomized cross-sectional multicenter observational study. During a 3-month period June-August 2014, consecutive adult patients with TED who presented to nominated specialist eye clinics in the United Kingdom, completed a standardized questionnaire. Main outcome measures were: demographics, time from diagnosis to referral to tertiary centre, time from referral to review in specialist eye clinic, management of thyroid dysfunction, radioiodine and provision of steroid prophylaxis, smoking, and TED classification. 91 patients (mean age 47.88 years) were included. Female-to-male ratio was 6:1. Mean time since first symptoms of TED = 27.92 (73.71) months; from first visit to any doctor with symptoms to diagnosis = 9.37 (26.03) months; from hyperthyroidism diagnosis to euthyroidism 12.45 (16.81) months. First, 13% had received radioiodine. All those with active TED received prophylactic steroids. Seven patients who received radioiodine and did not have TED at the time went on to develop it. Then, 60% patients were current or ex-smokers. 63% current smokers had been offered smoking cessation advice. 65% patients had active TED; 4% had sight-threatening TED. A large proportion of patients (54%) were unaware of their thyroid status. Not enough patients are being provided with smoking cessation advice and information on the impact of smoking on TED and control of thyroid function.
Talboom-Kamp, Esther Pwa; Verdijk, Noortje A; Kasteleyn, Marise J; Harmans, Lara M; Talboom, Irvin Jsh; Numans, Mattijs E; Chavannes, Niels H
2017-05-31
Worldwide, nearly 3 million people die of chronic obstructive pulmonary disease (COPD) every year. Integrated disease management (IDM) improves disease-specific quality of life and exercise capacity for people with COPD, but can also reduce hospital admissions and hospital days. Self-management of COPD through eHealth interventions has shown to be an effective method to improve the quality and efficiency of IDM in several settings, but it remains unknown which factors influence usage of eHealth and change in behavior of patients. Our study, e-Vita COPD, compares different levels of integration of Web-based self-management platforms in IDM in three primary care settings. The main aim of this study is to analyze the factors that successfully promote the use of a self-management platform for COPD patients. The e-Vita COPD study compares three different approaches to incorporating eHealth via Web-based self-management platforms into IDM of COPD using a parallel cohort design. Three groups integrated the platforms to different levels. In groups 1 (high integration) and 2 (medium integration), randomization was performed to two levels of personal assistance for patients (high and low assistance); in group 3 there was no integration into disease management (none integration). Every visit to the e-Vita and Zorgdraad COPD Web platforms was tracked objectively by collecting log data (sessions and services). At the first log-in, patients completed a baseline questionnaire. Baseline characteristics were automatically extracted from the log files including age, gender, education level, scores on the Clinical COPD Questionnaire (CCQ), dyspnea scale (MRC), and quality of life questionnaire (EQ5D). To predict the use of the platforms, multiple linear regression analyses for the different independent variables were performed: integration in IDM (high, medium, none), personal assistance for the participants (high vs low), educational level, and self-efficacy level (General Self
DiBianco, R; Rosenfeld, S P; Katz, R J; Simpson, A G; Fletcher, R D; Singh, S
1980-08-01
Aminophylline [(theophylline ethylene diamine (TED)] reportedly improved cardiac hemodynamics by lowering vascular resistances and increasing contractility. TED as used clinically has not been compared to the vasodilator sodium nitroprusside (NP). To assess the relative hemodynamic effects of these two commonly used agents, the following comparison was made. Ten patients with congestive cardiomyopathy in chronic refractory heart failure [New York Heart Association (NYHA) class IV] were studied. All patients demonstrated cardiomegaly by chest x ray and echocardiography (LVd = 6.3 +/- 0.7 cm) and markedly abnormal hemodynamics during baseline observations (see Table I). Hemodynamic measurements at baseline were compared after TED infusion (mean blood level = 16 +/- 12 micrograms/m/TED) and during intravenous NP. No significant changes in heart rate occurred during either therapeutic intervention; a fall in mean arterial pressure of 10 mmHg (p TED. Theophylline ethylene diamine demonstrated no detectable cardiac hemodynamic effects 60--90 min post infusion despite proven blood levels, whereas NP exhibited distinctly beneficial effects in this patient group. Previous studies demonstrating improved hemodynamics occurring with TED have been limited to the time of infusion or within the following 40 min, a time when TED blood levels are maximum and therefore closest to toxicity. The results of this study suggest that TED demonstrates no beneficial hemodynamic effects in refractory heart failure as early as 1 h after infusion despite blood levels in the therapeutic range.
Marsh, Herbert W; Nagengast, Benjamin; Morin, Alexandre J S
2013-06-01
This substantive-methodological synergy applies evolving approaches to factor analysis to substantively important developmental issues of how five-factor-approach (FFA) personality measures vary with gender, age, and their interaction. Confirmatory factor analyses (CFAs) conducted at the item level often do not support a priori FFA structures, due in part to the overly restrictive assumptions of CFA models. Here we demonstrate that exploratory structural equation modeling (ESEM), an integration of CFA and exploratory factor analysis, overcomes these problems with the 15-item Big Five Inventory administered as part of the nationally representative British Household Panel Study (N = 14,021; age: 15-99 years, Mage = 47.1). ESEM fitted the data substantially better and resulted in much more differentiated (less correlated) factors than did CFA. Methodologically, we extended ESEM (introducing ESEM-within-CFA models and a hybrid of multiple groups and multiple indicators multiple causes models), evaluating full measurement invariance and latent mean differences over age, gender, and their interaction. Substantively the results showed that women had higher latent scores for all Big Five factors except for Openness and that these gender differences were consistent over the entire life span. Substantial nonlinear age effects led to the rejection of the plaster hypothesis and the maturity principle but did support a newly proposed la dolce vita effect in old age. In later years, individuals become happier (more agreeable and less neurotic), more self-content and self-centered (less extroverted and open), more laid back and satisfied with what they have (less conscientious, open, outgoing and extroverted), and less preoccupied with productivity. PsycINFO Database Record (c) 2013 APA, all rights reserved
Investigation of dislocations in 8° off-axis 4H-SiC epilayer
International Nuclear Information System (INIS)
Rui-Xia, Miao; Yu-Ming, Zhang; Yi-Men, Zhang; Xiao-Yan, Tang; Qing-Feng, Gai
2010-01-01
This paper reports that the etching morphology of dislocations in 8° off-axis 4H-SiC epilayer is observed by using a scanning electronic microscope. It is found that different types of dislocations correspond with different densities and basal plane dislcation (BPD) array and threading edge dislocation (TED) pileup group lie along some certain crystal directions in the epilayer. It is concluded that the elastic energy of threading screw dislocations (TSDs) is highest and TEDs is lowest among these dislocations, so the density of TSDs is lower than TEDs. The BPDs can convert to TEDs but TSDs can only propagate into the epilyer in spite of the higher elastic energy than TEDs. The reason of the form of BPDs array in epilayer is that the big step along the basal plane caused by face defects blocked the upstream atoms, and TEDs pileup group is that the dislocations slide is blocked by dislocation groups in epilayer. (condensed matter: structure, thermal and mechanical properties)
Management of thyroid eye disease
International Nuclear Information System (INIS)
Bartalena, Luigi; Tanda, Maria Laura; Marcocci, Claudio; Pinchera, Aldo
2002-01-01
Thyroid eye disease (TED) is the most frequent extrathyroidal manifestation of Graves' disease. In most instances it is mild and non-progressive, but in 3%-5% of cases it is severe. Non-severe TED requires only supportive measures, such as eye ointments, sunglasses and prisms. By contrast, severe TED requires aggressive treatment, either medical (high-dose glucocorticoids, orbital radiotherapy) or surgical (orbital decompression). The choice of treatment relies on the assessment of both TED severity and activity. Removal of controllable risk factors, especially cigarette smoking, is important to improve the course and the therapeutic outcome. A coordinated approach to the treatment of hyperthyroidism and TED is also required. Novel promising treatments, to be verified in large series of patients, include somatostatin analogues and cytokine antagonists. (orig.)
Management of thyroid eye disease
Energy Technology Data Exchange (ETDEWEB)
Bartalena, Luigi; Tanda, Maria Laura [Department of Endocrinology, University of Insubria, Ospedale di Circolo, Viale Borri, 57, 21100 Varese (Italy); Marcocci, Claudio; Pinchera, Aldo [Department of Endocrinology and Metabolism, University of Pisa, Pisa (Italy)
2002-08-01
Thyroid eye disease (TED) is the most frequent extrathyroidal manifestation of Graves' disease. In most instances it is mild and non-progressive, but in 3%-5% of cases it is severe. Non-severe TED requires only supportive measures, such as eye ointments, sunglasses and prisms. By contrast, severe TED requires aggressive treatment, either medical (high-dose glucocorticoids, orbital radiotherapy) or surgical (orbital decompression). The choice of treatment relies on the assessment of both TED severity and activity. Removal of controllable risk factors, especially cigarette smoking, is important to improve the course and the therapeutic outcome. A coordinated approach to the treatment of hyperthyroidism and TED is also required. Novel promising treatments, to be verified in large series of patients, include somatostatin analogues and cytokine antagonists. (orig.)
Flury, Simon; Schmidt, Stefanie Zita; Peutzfeldt, Anne; Lussi, Adrian
2016-10-01
The aim was to investigate dentin bond strength of two resin-ceramic materials and five cements after 24 h and six months storage. Cylinders (n=15/group) of Lava Ultimate (3M ESPE) and VITA ENAMIC (VITA Zahnfabrik) were cemented to mid-coronal dentin of 300 extracted human molars with RelyX Ultimate (3M ESPE), PANAVIA F2.0 (Kuraray), Variolink II (Ivoclar Vivadent), els cem (Saremco Dental), or Ketac Cem Plus (3M ESPE). Shear bond strength (SBS) was measured after 24 h or six months storage (37°C, 100% humidity) and statistically analyzed (significance level: α=0.05). SBS varied markedly between Lava Ultimate and VITA ENAMIC, between the five cements, and between storage of either 24 h or six months. After six months, SBS was highest when Lava Ultimate was cemented with RelyX Ultimate and when VITA ENAMIC was cemented with RelyX Ultimate or with Variolink II. Lava Ultimate was somewhat more sensitive to storage than was VITA ENAMIC.
Reliability of conventional shade guides in teeth color determination.
Todorović, Ana; Todorović, Aleksandar; Gostović, Aleksandra Spadijer; Lazić, Vojkan; Milicić, Biljana; Djurisić, Slobodan
2013-10-01
Color matching in prosthodontic therapy is a very important task because it influences the esthetic value of dental restorations. Visual shade matching represents the most frequently applied method in clinical practice. Instrumental measurements provide objective and quantified data in color assessment of natural teeth and restorations. In instrumental shade analysis, the goal is to achieve the smallest deltaE value possible, indicating the most accurate shade match. The aim of this study was to evaluate the reliability of commercially available ceramic shade guides. VITA Easyshade spectrophotometer (VITA, Germany) was used for instrumental color determination. Utilizing this device, color samples of ten VITA Classical and ten VITA 3D - Master shade guides were analyzed. Each color sample from all shade guides was measured three times and the basic parameters of color quality were examined: deltaL, deltaC, deltaH, deltaE, deltaElc. Based on these parameters spectrophotometer marks the shade matching as good, fair or adjust. After performing 1,248 measurements of ceramic color samples, frequency of evaluations adjust, fair and good were statistically significantly different between VITA Classical and VITA 3D Master shade guides (p = 0.002). There were 27.1% cases scored as adjust, 66.3% as fair and 6.7% as good. In VITA 3D - Master shade guides 30.9% cases were evaluated as adjust, 66.4% as fair and 2.7% cases as good. Color samples from different shade guides, produced by the same manufacturer, show variability in basic color parameters, which once again proves the lack of precision and nonuniformity of the conventional method.
75 FR 53925 - Sea Turtle Conservation; Shrimp and Summer Flounder Trawling Requirements
2010-09-02
... sequence of six bars (inward) followed by one point (aft). A ``straight'' or ``all-point'' cut indicates a... flap piece were attached to the inside of the TED extension. At the point where the sides of each flap piece intersected the TED frame, the flap sides were then sewn to a row of meshes aft of the TED frame...
Color stability of shade guides after autoclave sterilization.
Schmeling, Max; Sartori, Neimar; Monteiro, Sylvio; Baratieri, Luiz
2014-01-01
This study evaluated the influence of 120 autoclave sterilization cycles on the color stability of two commercial shade guides (Vita Classical and Vita System 3D-Master). The specimens were evaluated by spectrophotometer before and after the sterilization cycles. The color was described using the three-dimensional CIELab system. The statistical analysis was performed in three chromaticity coordinates, before and after sterilization cycles, using the paired samples t test. All specimens became darker after autoclave sterilization cycles. However, specimens of Vita Classical became redder, while those of the Vita System 3D-Master became more yellow. Repeated cycles of autoclave sterilization caused statistically significant changes in the color coordinates of the two shade guides. However, these differences are considered clinically acceptable.
Dental Shade Guide Variability for Hues B, C, and D Using Cross-Polarized Photography.
Sampaio, Camila S; Gurrea, Jon; Gurrea, Marta; Bruguera, August; Atria, Pablo J; Janal, Malvin; Bonfante, Estevam A; Coelho, Paulo G; Hirata, Ronaldo
2018-04-20
This study evaluated the color variability of hues B, C, and D between the VITA Classical shade guide (Vita Zahnfabrik) and four other VITA-coded ceramic shade guides using a digital camera (Canon EOS 60D) and computer software (Adobe Photoshop CC). A cross-polarizing filter was used to standardize external light sources influencing color match. A total of 275 pictures were taken, 5 per shade tab, for 11 shades (B1, B2, B3, B4, C1, C2, C3, C4, D2, D3, and D4), from the following shade guides: VITA Classical (control); IPS e.max Ceram (Ivoclar Vivadent); IPS d.SIGN (Ivoclar Vivadent); Initial ZI (GC); and Creation CC (Creation Willi Geller). Pictures were evaluated using Adobe Photoshop CC for standardization of hue, chroma, and value between shade tabs. The VITA-coded shade guides evaluated here showed an overall unmatched shade in all their tabs when compared to the control, suggesting that shade selection should be made with the corresponding manufacturer guide of the ceramic intended for the final restoration.
Zhao, Yonggang; Wu, Haohan; Emge, Thomas J; Gong, Qihan; Nijem, Nour; Chabal, Yves J; Kong, Lingzhu; Langreth, David C; Liu, Hui; Zeng, Heping; Li, Jing
2011-04-26
Hydroxyl- and amino- functionalized [Zn(BDC)(TED)(0.5)]·2DMF·0.2H(2)O leads to two new structures, [Zn(BDC-OH)(TED)(0.5)]·1.5DMF·0.3H(2)O and [Zn(BDC-NH(2))(TED)(0.5)]·xDMF·yH(2)O (BDC=terephthalic acid, TED=triethylenediamine, BDC-OH=2-hydroxylterephthalic acid, BDC-NH(2)=2-aminoterephthalic acid). Single-crystal X-ray diffraction and powder X-ray diffraction studies confirmed that the structures of both functionalized compounds are very similar to that of their parent structure. Compound [Zn(BDC)(TED)(0.5)]·2DMF·0.2H(2)O can be considered a 3D porous structure with three interlacing 1D channels, whereas both [Zn(BDC-OH)(TED)(0.5)]·1.5DMF·0.3H(2)O and [Zn(BDC-NH(2))(TED)(0.5)]·xDMF·yH(2)O contain only 1D open channels as a result of functionalization of the BDC ligand by the OH and NH(2) groups. A notable decrease in surface area and pore size is thus observed in both compounds. Consequently, [Zn(BDC)(TED)(0.5)]·2DMF·0.2H(2)O takes up the highest amount of H(2) at low temperatures. Interestingly, however, both [Zn(BDC-OH)(TED)(0.5)]·1.5DMF·0.3H(2)O and [Zn(BDC-NH(2))(TED)(0.5)]·xDMF·yH(2)O show significant enhancement in CO(2) uptake at room temperature, suggesting that the strong interactions between CO(2) and the functionalized ligands, indicating that surface chemistry, rather than porosity, plays a more important role in CO(2) adsorption. A comparison of single-component CO(2), CH(4), CO, N(2), and O(2) adsorption isotherms demonstrates that the adsorption selectivity of CO(2) over other small gases is considerably enhanced through functionalization of the frameworks. Infrared absorption spectroscopic measurements and theoretical calculations are also carried out to assess the effect of functional groups on CO(2) and H(2) adsorption potentials. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Bogna Stawarczyk
2016-06-01
Full Text Available This study investigated the colorimetric properties of different veneering materials on core materials. Standardized specimens (10 mm × 10 mm × 1.5 mm reflecting four core (polyetheretherketone (PEEK, zirconia (ZrO2, cobalt–chromium–molybdenum alloy (CoCrMo, and titanium oxide (TiO2; thickness: 1.5 mm and veneering materials (VITA Mark II, IPS e.max CAD, LAVA Ultimate and VITA Enamic, all in shade A3; thickness: 0.5, 1.0, 1.5 and 2 mm, respectively were fabricated. Specimens were superimposed to assemblies, and the color was determined with a spectrophotometer (CieLab-System or a chair-side color measurement device (VITA EasyShade, respectively. Data were analyzed using three-, two-, and one-way ANOVA, a Chi2-test, and a Wilson approach (p < 0.05. The measurements with EasyShade showed A2 for VITA Mark II, A3.5 for VITA Enamic, B2 for LAVA Ultimate, and B3 for IPS e.max CAD. LabE-values showed significant differences between the tested veneering materials (p < 0.001. CieLab-System and VITA EasyShade parameters of the different assemblies showed a significant impact of core (p < 0.001, veneering material (p < 0.001, and thickness of the veneering material (p < 0.001. PEEK as core material showed comparable outcomes as compared to ZrO2 and CoCrMo, with respect to CieLab-System parameters for each veneering material. The relative frequency of the measured VITA EasyShade parameters regarding PEEK cores also showed comparable results as compared to the gold standard CoCrMo, regardless of the veneering material used.
Evaluation of reliability and validity of three dental color-matching devices.
Tsiliagkou, Aikaterini; Diamantopoulou, Sofia; Papazoglou, Efstratios; Kakaboura, Afrodite
2016-01-01
To assess the repeatability and accuracy of three dental color-matching devices under standardized and freehand measurement conditions. Two shade guides (Vita Classical A1-D4, Vita; and Vita Toothguide 3D-Master, Vita), and three color-matching devices (Easyshade, Vita; SpectroShade, MHT Optic Research; and ShadeVision, X-Rite) were used. Five shade tabs were selected from the Vita Classical A1-D4 (A2, A3.5, B1, C4, D3), and five from the Vita Toothguide 3D-Master (1M1, 2R1.5, 3M2, 4L2.5, 5M3) shade guides. Each shade tab was recorded 15 continuous, repeated times with each device under two different measurement conditions (standardized, and freehand). Both qualitative (color shade) and quantitative (L, a, and b) color characteristics were recorded. The color difference (ΔE) of each recorded value with the known values of the shade tab was calculated. The repeatability of each device was evaluated by the coefficient of variance. The accuracy of each device was determined by comparing the recorded values with the known values of the reference shade tab (one sample t test; α = 0.05). The agreement between the recorded shade and the reference shade tab was calculated. The influence of the parameters (devices and conditions) on the parameter ΔE was investigated (two-way ANOVA). Comparison of the devices was performed with Bonferroni pairwise post-hoc analysis. Under standardized conditions, repeatability of all three devices was very good, except for ShadeVision with Vita Classical A1-D4. Accuracy ranged from good to fair, depending on the device and the shade guide. Under freehand conditions, repeatability and accuracy for Easyshade and ShadeVision were negatively influenced, but not for SpectroShade, regardless of the shade guide. Based on the total of the color parameters assessed per device, SpectroShade was the most reliable of the three color-matching devices studied.
International Nuclear Information System (INIS)
Khirnyj, V.F.; Seminozhenko, V.P.; Zagoskin, V.T.
1995-01-01
Study of temperature-electric domain (TED) behaviour is conducted and physico-chemical properties of specimens treated by moving TED are investigated. According to the data obtained, texture does not appear during such a treatment. To reduce v of TED the specimen is placed to a longitudinal magnetic field. TED stop at H=0.4 T and V=3.2 V is observed when the direction of the north magnetic pole coincides with the point of the positive electrode junction. Domain movement rate, at which texture occurrence is possible, is achieved by means of magnetic field intensity H variation. 10 refs.; 3 figs.; 1 tab
Ventolin Diskus and Inspyril Turbuhaler: an in vitro comparison.
Broeders, M E A C; Molema, J; Burnell, P K P; Folgering, H T M
2005-01-01
Dose delivery (total emitted dose, or TED) from dry powder inhalers (DPIs), pulmonary deposition, and the biological effects depend on drug formulation and device and patient characteristics. The aim of this study was to measure, in vitro, the relationship between parameters of inhalation profiles recorded from patients, the TED and fine particle mass (FPM) of Diskus and Turbuhaler inhalers. Inhalation profiles (IPs) of 25 patients, a representative sample of a wide range of 1500 IPs generated by 10 stable asthmatics, 3 x 16 (mild/moderate/severe) COPD patients and 15 hospitalized patients with an exacerbation asthma or COPD, were selected for each device. These 25 IPs were input IPs for the Electronic Lung (a computerdriven inhalation simulator) to determine particle size distribution from Ventolin Diskus and Inspyril Turbuhaler. The TED and FPM of Diskus and FPM of Turbuhaler were affected by the peak inspiratory flow (PIF) and not by slope of the pressure-time curve, inhaled volume and inhalation time. This flow-dependency was more marked at lower flows (PIF TED and FPM of Diskus were significantly higher as compared to those of the Turbuhaler [mean (SD) TED(_diskus) (%label claim) 83.5 (13.9) vs. TED(_turbuhaler) (72.5 (11.1) (p = 0.004), FPM(_diskus) (%label claim) 36.8 (9.8) vs FPM(_turbuhaler) (28.7 (7.7) (p TED and FPM of Diskus and FPM of Turbuhaler were affected by PIF, the flow-dependency being greater at PIF values below 40 L/min. Lower PIFs occurred more often when using Turbuhaler than Diskus, since Turbuhaler have a higher resistivity, requires substantially higher pressure in order to generate the same flow as Diskus. TED, dose consistency and the FPM were higher for Diskus as compared to Turbuhaler. The flow dependency of TED and FPM was substantially influenced by inhalation profiles when not only profiles of the usual outpatient population were included but also the real outliers from exacerbated patients.
Time scales of transient enhanced diffusion: Free and clustered interstitials
Cowern, N. E. B.; Huizing, H. G. A.; Stolk, P. A.; Visser, C. C. G.; de Kruif, R. C. M.; Kyllesbech Larsen, K.; Privitera, V.; Nanver, L. K.; Crans, W.
1996-12-01
Transient enhanced diffusion (TED) and electrical activation after nonamorphizing Si implantations into lightly B-doped Si multilayers shows two distinct timescales, each related to a different class of interstitial defect. At 700°C, ultrafast TED occurs within the first 15 s with a B diffusivity enhancement of > 2 × 10 5. Immobile clustered B is present at low concentration levels after the ultrafast transient and persists for an extended period (˜ 10 2-10 3 s). The later phase of TED exhibits a near-constant diffusivity enhancement of ≈ 1 × 10 4, consistent with interstitial injection controlled by dissolving {113} interstitial clusters. The relative contributions of the ultrafast and regular TED regimes to the final diffusive broadening of the B profile depends on the proportion of interstitials that escape capture by {113} clusters growing within the implant damage region upon annealing. Our results explain the ultrafast TED recently observed after medium-dose B implantation. In that case there are enough B atoms to trap a large proportion of interstitials in SiB clusters, and the remaining interstitials contribute to TED without passing through an intermediate {113} defect stage. The data on the ultrafast TED pulse allows us to extract lower limits for the diffusivities of the Si interstitial ( DI > 2 × 10 -10 cm 2s -1) and the B interstitial(cy) defect ( DBi > 2 × 10 -13 cm 2s -1) at 700°C.
International Nuclear Information System (INIS)
Nakagawa, K; Tanaka, T; Suzuki, T
2014-01-01
This paper presents the fabrication of a new energy harvesting module that used the thermoelectric device (TED) by using molding technology. The output voltage per heater temperature of the TED module at 20 °C ambient temperature is 8mV/K and similar to the result with the aluminium heat sink which is almost the same fin size as the TED module. The accelerated environmental tests are performed on damp heat test that is an aging test under high temperature and high humidity, cold test and highly accelerated temperature and humidity stress test (HAST) for the purpose of evaluating the electrical reliability in harsh environments. Every result of tests indicates that the TED and circuit board can be properly protected from harsh temperature and humidity by using molding technology, because the output voltage of after tested modules is reduced by less than 5%.This study presents a novel fabrication method for a high reliability TED-installed module appropriate for Machine to Machine wireless sensor networks
Directory of Open Access Journals (Sweden)
George Veletsianos
Full Text Available Scholars, educators, and students are increasingly encouraged to participate in online spaces. While the current literature highlights the potential positive outcomes of such participation, little research exists on the sentiment that these individuals may face online and on the factors that may lead some people to face different types of sentiment than others. To investigate these issues, we examined the strength of positive and negative sentiment expressed in response to TEDx and TED-Ed talks posted on YouTube (n = 655, the effect of several variables on comment and reply sentiment (n = 774,939, and the projected effects that sentiment-based moderation would have had on posted content. We found that most comments and replies were neutral in nature and some topics were more likely than others to elicit positive or negative sentiment. Videos of male presenters showed greater neutrality, while videos of female presenters saw significantly greater positive and negative polarity in replies. Animations neutralized both the negativity and positivity of replies at a very high rate. Gender and video format influenced the sentiment of replies and not just the initial comments that were directed toward the video. Finally, we found that using sentiment as a way to moderate offensive content would have a significant effect on non-offensive content. These findings have far-reaching implications for social media platforms and for those who encourage or prepare students and scholars to participate online.
Kimmons, Royce; Larsen, Ross; Dousay, Tonia A.; Lowenthal, Patrick R.
2018-01-01
Scholars, educators, and students are increasingly encouraged to participate in online spaces. While the current literature highlights the potential positive outcomes of such participation, little research exists on the sentiment that these individuals may face online and on the factors that may lead some people to face different types of sentiment than others. To investigate these issues, we examined the strength of positive and negative sentiment expressed in response to TEDx and TED-Ed talks posted on YouTube (n = 655), the effect of several variables on comment and reply sentiment (n = 774,939), and the projected effects that sentiment-based moderation would have had on posted content. We found that most comments and replies were neutral in nature and some topics were more likely than others to elicit positive or negative sentiment. Videos of male presenters showed greater neutrality, while videos of female presenters saw significantly greater positive and negative polarity in replies. Animations neutralized both the negativity and positivity of replies at a very high rate. Gender and video format influenced the sentiment of replies and not just the initial comments that were directed toward the video. Finally, we found that using sentiment as a way to moderate offensive content would have a significant effect on non-offensive content. These findings have far-reaching implications for social media platforms and for those who encourage or prepare students and scholars to participate online. PMID:29856749
Veletsianos, George; Kimmons, Royce; Larsen, Ross; Dousay, Tonia A; Lowenthal, Patrick R
2018-01-01
Scholars, educators, and students are increasingly encouraged to participate in online spaces. While the current literature highlights the potential positive outcomes of such participation, little research exists on the sentiment that these individuals may face online and on the factors that may lead some people to face different types of sentiment than others. To investigate these issues, we examined the strength of positive and negative sentiment expressed in response to TEDx and TED-Ed talks posted on YouTube (n = 655), the effect of several variables on comment and reply sentiment (n = 774,939), and the projected effects that sentiment-based moderation would have had on posted content. We found that most comments and replies were neutral in nature and some topics were more likely than others to elicit positive or negative sentiment. Videos of male presenters showed greater neutrality, while videos of female presenters saw significantly greater positive and negative polarity in replies. Animations neutralized both the negativity and positivity of replies at a very high rate. Gender and video format influenced the sentiment of replies and not just the initial comments that were directed toward the video. Finally, we found that using sentiment as a way to moderate offensive content would have a significant effect on non-offensive content. These findings have far-reaching implications for social media platforms and for those who encourage or prepare students and scholars to participate online.
Allacciare i fili spezzati: analisi di tre autobiografie di persone divenute disabili
Directory of Open Access Journals (Sweden)
Rosalba Perrotta
2011-04-01
Full Text Available Leggere autobiografie consente di conoscere esperienze e momenti della vita che restano ignoti a chi non li ha vissuti. Le autobiografie ci svelano un mondo e, nello stesso tempo, ci introducono in esso. Illustrano e spiegano senza illustrare e senza spiegare. Catturano il lettore nella narrazione e, rendendolo protagonista di quello che accade, gli fanno provare le emozioni di chi racconta e gli mostrano la realtà attraverso i suoi occhi. La corrente sociologica dell’Interazionismo simbolico, un approccio che dà particolare rilievo ai significati attribuiti dagli uomini agli oggetti di cui hanno esperienza, considera le storie di vita uno strumento di indagine prezioso. Il racconto di un tratto della vita, o della vita in genere, consente di raggiungere una conoscenza della realtà soggettiva di chi narra molto superiore rispetto a quella ottenuta attraverso questionari o interviste strutturate.
Manimaran, P; Sadan, D Sai
2016-10-01
Smile is one of the most important interactive communication skills of a person. A smile is the key factor for an aesthetic appearance. Hence aesthetics is one of the motivating factor for the patients to seek dental care. Correction of unaesthetic appearance gives a positive effect to the self esteem of the patient. The aim of this study was to compare the difference in the shade between the commercially available shade guides namely Vita Classical And Ivoclar Chromascop and the fired porcelain samples fabricated using Vita Zahnfabrik VMK 95 and Ivoclar Classic Materials respectively. The objective of this study was to obtain a matching brand of material that has a particular shade tab among the brands used. To conclude, Ivoclar material matched the chromascop shade guide better than the vita material matched the vita classic shade guide.
International Nuclear Information System (INIS)
Nakagawa, K; Tanaka, T; Suzuki, T
2015-01-01
This paper presents the fabrication of a new energy harvesting module that uses a thermoelectric device (TED) by using molding technology. Through molding technology, the TED and circuit board can be properly protected and a heat-radiating fin structure can be simultaneously constructed. The output voltage per heater temperature of the TED module at 20 °C ambient temperature is 8 mV K −1 , similar to the result with the aluminum heat sink which is almost the same fin size as the TED module. The accelerated environmental tests are performed on a damp heat test, which is an aging test under high temperature and high humidity, highly accelerated temperature, and humidity stress test (HAST) for the purpose of evaluating the electrical reliability in harsh environments, cold test and thermal cycle test to evaluate degrading characteristics by cycling through two temperatures. All test results indicate that the TED and circuit board can be properly protected from harsh temperature and humidity by using molding technology because the output voltage of after-tested modules is reduced by less than 5%. This study presents a novel fabrication method for a high reliability TED-installed module appropriate for Machine to Machine wireless sensor networks. (paper)
“And time future contained in time past”: British Modernist Poetry from T.S. Eliot to Ted Hughes
Directory of Open Access Journals (Sweden)
Tatiana N. Krasavchenko
2017-09-01
Full Text Available It seems that T.S. Eliot (1888–1965 and Ted Hughes (1930–1998 are poets of different individual talents and epochs. Hughes, a poet of the second half of the 20 th century, concentrated on the conflict between Nature and the human being destroying Nature and thus preparing the end of the humanity. T.S. Eliot was a poet of urban civilization, a reformer of the Anglophone modernist poetry. In his days, the “poetry of Nature” rooted in the pastoral poetry of the 17 th –18 th centuries and in Romanticism, existed but only at the margins of mainstream poetic trends. Nevertheless, one can find it even in Eliot’s poetry, particularly in his Landscapes — poems written at the beginning of the 1930s. Also, both Eliot and Hughes were modernists. Eliot standing at the beginning of modernism, Hughes at its end; though the latter lived in the time of postmodernism, he was not a postmodernist himself since he was not engaged in the deconstruction and fragmentation of the “world model.” Like Eliot, he was a poet with integral Weltanschauung and a bright individual talent. Like Eliot, he was a traditionalist, though Eliot being an American was a “conscious traditionalist,” while Hughes, an Englishman, was most likely a “born” traditionalist: instead of deconstructing tradition, he was bearing on it. His “great tradition” included Shakespeare, Blake, Coleridge, Kipling, Graves, and Dylan Thomas. Both Eliot and Hughes are poets of eschatological trend and mythologists. However, one will not find Eliot among the authorities enlisted by Hughes in his “great tradition.” In the time of Hughes, Eliot was rejected due to the regular change of mainstreams trends. British poetry in the second half of the 20 th century is “tired” of urban poetry, of “Nature denial,” so it comes back to its track, and the motives that existed in Eliot’s poetry only in the background are now brought to the forefront.
High Resolution Topography Analysis on Threading Edge Dislocations in 4H-SiC Epilayers
International Nuclear Information System (INIS)
Kamata, I.; Nagano, M.; Tsuchida, H.; Chen, Y.; Dudley, M.
2009-01-01
Threading edge dislocations (TEDs) in a 4H-SiC epitaxial layer are investigated using high-resolution synchrotron topography. Six types of TED image are confirmed to correspond to the Burgers vector directions by a comparison of computer simulated images and observed topography images in crystal boundaries. Using a mapping method, a wide spatial distribution of the six types of TED is examined in a quarter section of a 2-inch wafer.
International Nuclear Information System (INIS)
Neumann, W.; Hofmeister, H.; Heydenreich, J.; Komrska, J.
1988-01-01
The influence of the crystal shape on the fine structure of transmission electron diffraction (TED) patterns described by the crystal shape amplitude is discussed. A general algebraic expression for the crystal shape amplitude of any crystal polyhedron is used for computing the intensity distribution of TED reflections. The computer simulation method is applied to the analysis of the fine structure of TED patterns of small gold and palladium crystals having octahedral and tetrahedral habits. (orig.)
Directory of Open Access Journals (Sweden)
P Manimaran
2016-01-01
Full Text Available Introduction: Smile is one of the most important interactive communication skills of a person. A smile is the key factor for an aesthetic appearance. Hence aesthetics is one of the motivating factor for the patients to seek dental care. Correction of unaesthetic appearance gives a positive effect to the self esteem of the patient. Aim: The aim of this study was to compare the difference in the shade between the commercially available shade guides namely Vita Classical And Ivoclar Chromascop and the fired porcelain samples fabricated using Vita Zahnfabrik VMK 95 and Ivoclar Classic Materials respectively. Objectives: The objective of this study was to obtain a matching brand of material that has a particular shade tab among the brands used. Conclusion: To conclude, Ivoclar material matched the chromascop shade guide better than the vita material matched the vita classic shade guide.
Tra "dolce vita" e Sinistra / Between the "Dolce Vita" and the Left
Directory of Open Access Journals (Sweden)
Guilherme Wisnik
2014-01-01
Full Text Available Morto a quasi 105 anni, Niemeyer ha attraversato momenti storici cruciali per la storia recente del Brasile entrando a pieno titolo a farne parte. Collaboratore di Lucio Costa e sodale del presidente Kubitschek, l'architetto carioca ha contribuito a costruire, nel vero senso della parola, parti imprescindibili del paese, portando il suo linguaggio e la sua concezione progettuale ad essere non soltanto emblema nazionale di sviluppo, per un Paese con una storia relativamente breve, ma anche simbolo del paese stesso nel mondo. / Died at almost 105 years, Niemeyer has experienced important times in the recent history of Brazil. Collaborator of Lucio Costa and fellow of President Kubitschek, the carioca architect has helped contributed in building essential parts of the country, making his language and his conception of the project to be not only an emblem of national development for a country with a relatively short history, but also a symbol of the country itself in the world.
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis... Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis pdb|1TED|A Chain ... A..., Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis emb|C... pdb|1TED|C Chain ... C, Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculos...is pdb|1TED|B Chain ... B, Crystal Structure Of A
ORF Alignment: NC_002755 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis... Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis pdb|1TED|A Chain ... A..., Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis emb|C... pdb|1TED|C Chain ... C, Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculos...is pdb|1TED|B Chain ... B, Crystal Structure Of A
ORF Alignment: NC_000962 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis... Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis pdb|1TED|A Chain ... A..., Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis emb|C... pdb|1TED|C Chain ... C, Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculos...is pdb|1TED|B Chain ... B, Crystal Structure Of A
Chitrarsu, Vijai Krishnan; Chidambaranathan, Ahila Singaravel; Balasubramaniam, Muthukumar
2017-10-31
To evaluate the shade matching capabilities in natural dentitions using Vita Toothguide 3D-Master and an intraoral digital spectrophotometer (Vita Easyshade Advance 4.0) in various light sources. Participants between 20 and 40 years old with natural, unrestored right maxillary central incisors, no history of bleaching, orthodontic treatment, or malocclusion and no rotations were included. According to their shades, subjects were randomly selected and grouped into A1, A2, and A3. A total of 100 participants (50 male and 50 female) in each group were chosen for this study. Shade selection was made between 10 am and 2 pm for all light sources. The same examiner selected the shade of natural teeth with Vita Toothguide 3D-Master under natural light within 2 minutes. Once the Vita Toothguide 3D-Masterwas matched with the maxillary right central incisor, the L*, a*, and b* values, chroma, and hue were recorded with Vita Easyshade Advance 4.0 by placing it on the shade tab under the same light source. The values were statistically analyzed using one-way ANOVA and Tukey's HSD post hoc test with SPSS v22.0 software. The mean ∆E* ab values for shades A1, A2, and A3 for groups 1, 2, and 3 were statistically significantly different from each other (p spectrophotometer showed statistically significant differences in shade matching compared to Vita Toothguide 3D-Master. Incandescent light showed more accurate shade matching than the filtered LED, LED, and daylight. © 2017 by the American College of Prosthodontists.
Prostate Cancer Radiation Therapy and Risk of Thromboembolic Events
Energy Technology Data Exchange (ETDEWEB)
Bosco, Cecilia, E-mail: Cecilia.t.bosco@kcl.ac.uk [Translational Oncology & Urology Research (TOUR), Division of Cancer Studies, King' s College London, London (United Kingdom); Garmo, Hans [Translational Oncology & Urology Research (TOUR), Division of Cancer Studies, King' s College London, London (United Kingdom); Regional Cancer Centre, Uppsala, Akademiska Sjukhuset, Uppsala (Sweden); Adolfsson, Jan [CLINTEC Department, Karolinska Institutet, Stockholm (Sweden); Stattin, Pär [Department of Surgical Sciences, Uppsala University, Uppsala (Sweden); Department of Surgical and Perioperative Sciences, Urology and Andrology, Umeå University, Umeå (Sweden); Holmberg, Lars [Translational Oncology & Urology Research (TOUR), Division of Cancer Studies, King' s College London, London (United Kingdom); Regional Cancer Centre, Uppsala, Akademiska Sjukhuset, Uppsala (Sweden); Department of Surgical Sciences, Uppsala University, Uppsala (Sweden); Nilsson, Per; Gunnlaugsson, Adalsteinn [Department of Hematology, Oncology and Radiation Physics, Skane University Hospital, Lund University, Lund (Sweden); Widmark, Anders [Department of Radiation Sciences, Oncology, Umeå University, Umeå (Sweden); Van Hemelrijck, Mieke [Translational Oncology & Urology Research (TOUR), Division of Cancer Studies, King' s College London, London (United Kingdom); Institute of Environmental Medicine, Karolinska Institute, Stockholm (Sweden)
2017-04-01
Purpose: To investigate the risk of thromboembolic disease (TED) after radiation therapy (RT) with curative intent for prostate cancer (PCa). Patients and Methods: We identified all men who received RT as curative treatment (n=9410) and grouped according to external beam RT (EBRT) or brachytherapy (BT). By comparing with an age- and county-matched comparison cohort of PCa-free men (n=46,826), we investigated risk of TED after RT using Cox proportional hazard regression models. The model was adjusted for tumor characteristics, demographics, comorbidities, PCa treatments, and known risk factors of TED, such as recent surgery and disease progression. Results: Between 2006 and 2013, 6232 men with PCa received EBRT, and 3178 underwent BT. A statistically significant association was found between EBRT and BT and risk of pulmonary embolism in the crude analysis. However, upon adjusting for known TED risk factors these associations disappeared. No significant associations were found between BT or EBRT and deep venous thrombosis. Conclusion: Curative RT for prostate cancer using contemporary methodologies was not associated with an increased risk of TED.
Prostate Cancer Radiation Therapy and Risk of Thromboembolic Events
International Nuclear Information System (INIS)
Bosco, Cecilia; Garmo, Hans; Adolfsson, Jan; Stattin, Pär; Holmberg, Lars; Nilsson, Per; Gunnlaugsson, Adalsteinn; Widmark, Anders; Van Hemelrijck, Mieke
2017-01-01
Purpose: To investigate the risk of thromboembolic disease (TED) after radiation therapy (RT) with curative intent for prostate cancer (PCa). Patients and Methods: We identified all men who received RT as curative treatment (n=9410) and grouped according to external beam RT (EBRT) or brachytherapy (BT). By comparing with an age- and county-matched comparison cohort of PCa-free men (n=46,826), we investigated risk of TED after RT using Cox proportional hazard regression models. The model was adjusted for tumor characteristics, demographics, comorbidities, PCa treatments, and known risk factors of TED, such as recent surgery and disease progression. Results: Between 2006 and 2013, 6232 men with PCa received EBRT, and 3178 underwent BT. A statistically significant association was found between EBRT and BT and risk of pulmonary embolism in the crude analysis. However, upon adjusting for known TED risk factors these associations disappeared. No significant associations were found between BT or EBRT and deep venous thrombosis. Conclusion: Curative RT for prostate cancer using contemporary methodologies was not associated with an increased risk of TED.
Adipogenesis in thyroid eye disease.
Crisp, M; Starkey, K J; Lane, C; Ham, J; Ludgate, M
2000-10-01
Adipogenesis contributes to the pathogenesis of thyroid eye disease (TED). Thyrotropin receptor (TSHR) transcripts are present in orbital fat. This study was conducted to determine whether they are expressed as functional protein, and if so, whether this is restricted to TED orbits or to a particular stage in adipocyte differentiation. Samples of fat were obtained from 18 TED-affected orbits and 4 normal orbits, and 9 were obtained from nonorbital locations. Frozen sections were examined by immunocytochemistry using monoclonal antibodies specific for the human TSHR. Samples were disaggregated and the preadipocytes separated from the mature by differential centrifugation and cultured in serum-free or DM and examined for morphologic changes, oil red O and TSHR staining, and TSH-induced cyclic adenosine monophosphate (cAMP) production. Marked immunoreactivity was observed in frozen sections from all three TED samples and faint staining in both normal orbital fat samples. In vitro, 1% to 5% of preadipocytes displayed TSHR immunoreactivity in five of six TED and two of three normal orbital samples and in three of five nonorbital samples. Differentiation, was induced in all 14 orbital samples. Three of four nonorbital samples contained occasional differentiated cells. Fifty percent to 70% of differentiating cells demonstrated receptor immunoreactivity. Two of three TED and four of four nonorbital preadipocytes in DM and/or mature adipocytes displayed a TSH-mediated increase in cAMP. The results indicate that orbital fat TSHR transcripts are expressed as protein, which can be functional. This is not aberrant in TED orbits, although expression may be upregulated. The majority of preadipocytes undergoing differentiation express the receptor, indicating a key role for this population in one mechanism for increasing orbital volume.
Thyroid-Associated Ophthalmopathy in Iranian Patients
Directory of Open Access Journals (Sweden)
Mohsen Bahmani Kashkouli
2011-09-01
Full Text Available "nWe determined the frequency of clinical thyroid ophthalmopathy in Iranian patients. This cross-sectional study was performed at the Endocrinology Institute of Tehran University of Medical Sciences. All patients with documented thyroid disorders from September 2003 to July 2005 were recruited. Eye examinations included evaluation of soft tissue changes, measurement of proptosis, lid width, lagophthalmos, evaluation of eye muscle function, and determination of visual acuity. The activity of ophthalmopathy was scored according to the NOSPECS scale. Among 851 visited patients, 303 cases had thyroid eye disease (TED. The nature of the ophthalmopathy breaks down as follows: 53.4% were hypothyroid (9.3% Hashimoto disease, 5.5% euthyroid and 41.1% had Graves' disease. The prevalence of TED in males was 60% which was nearly 2 times the prevalence of TED in females. There was a significant relationship between presentation of TED and active smoking of the patients (P<0.0001 while no significant relationship with passive smoking was obtained (P=0.181. The most common clinical sign of TED in descending order respectively were proptosis with 63.4%, soft tissue involvement (40.9%, extraocular muscle involvement (22.1%, corneal involvement (12.9% and optic nerve dysfunction (6.3%. Myasthenia gravis occurred in only 2 patients. In the logistic regression, occurrence of TED was influenced by cardiovascular disease (OR=5.346, Graves' disease (OR=47.507, radioiodine therapy (OR=2.590, and anti-thyroid medications (OR=0.650. Thyroid ophtalmopathy (orbitopathy is a matter of important health concern among patients with thyroid disorder. Since TED occurred with a high prevalence in all thyroid states, a close collaboration between endocrinologists and ophthalmologists along with timely referrals of patients with any eye complaint is deemed necessary. Also smoking was the most important risk factor for developing TED. Therefore, it is advisable to raise
Det muliges kunst og det umuliges politik
DEFF Research Database (Denmark)
Mai, Anne-Marie
2014-01-01
Artiklen diskuterer Rancières ideer om litteratur og politik som bidrag til ny politisk historie og inddrager Vita Andersens forfatterskab som eksempel......Artiklen diskuterer Rancières ideer om litteratur og politik som bidrag til ny politisk historie og inddrager Vita Andersens forfatterskab som eksempel...
Similar Marginal Precision of Zirconia- and Metal-Ceramic Fixed Dental Prostheses
DEFF Research Database (Denmark)
Nicolaisen, Maj Høygaard; Bahrami, Golnosh; Schropp, Lars
clinical trial, 34 patients were randomized into two groups to receive a 3-unit fixed dental prosthesis (FDP) replacing a second premolar or a first molar. 17 ZC FDPs (BeCe CAD Zirkon, BEGO with Vita VM9, VITA ) and 17 MC FDPs (Bio PontoStar, BEGO with Vita VM13, VITA). All FDPs were made in accordance...... with the manufacturer’s guidelines by one operator. Before and after veneering, the FDPs were placed on the abutment teeth with a light-body A-silicone impression material (Extrude Wash, Kerr) between the restoration and the abutment teeth. After setting, the FDPs were removed and the light-body material was stabilized...... with a heavy-body impression material (Extrude, Kerr). The impression specimens were segmented to allow measurements of the thickness of the light-body material corresponding to the marginal gap at 12 points for each abutment. The measurements were done under 32X magnification with SPOT Advanced. Statistical...
Charisma and authority: Toward a hagiographic portrait of St. Sava
Directory of Open Access Journals (Sweden)
Marjanović-Dušanić Smilja
2015-01-01
Full Text Available The paper analyses hagiographical strategies used by the writers of St. Sava’s vitae, the purpose of which was to delineate clearly the principal features of the saint’s portrait. Their main concern was to confirm Sava’s personal charisma and to convey a sense of his saintly authority. The focus of the paper is on the hagiographical techniques of imitation such as comparing the hero to biblical models and telling stories of his miracles that repeat the miracles of Christ himself and the most important saints. The paper devotes particular attention to those sections of the vitae that describe Sava’s wielding institutional authority, and it is precisely here that there are notable similarities between Teodosije’s vita and his hagiographical model, the vita of St. Sava of Jerusalem by Cyril of Skythopolis. [Projekat Ministarstva nauke Republike Srbije, br. 177003: Srednjovekovno nasleđe Balkana - institucije i kultura
Rezende, Márcia; Bonafé, Elize; Vochikovski, Laína; Farago, Paulo Vitor; Loguercio, Alessandro Dourado; Reis, Alessandra; Kossatz, Stella
2016-01-01
Tooth sensitivity (TS) is the most common side effect of dental bleaching therapies. Dexamethasone has been used with tooth bleaching to reduce TS. The efficacy of dexamethasone for this purpose has not been well studied. The authors conducted a triple-masked, randomized, clinical trial with a parallel design involving 63 healthy participants who received either a placebo or dexamethasone. The placebo or dexamethasone (8 milligrams) was administered 1 hour before the in-office bleaching (35% hydrogen peroxide) and extra doses of 4 mg were administered every 6 hours for a total of 48 hours. TS was recorded on 2 scales: visual analog scale (0-10) and numeric rating scale (0-4) in different periods. The color evaluations were performed before and 1 month after dental bleaching with visual shade guides VITA Classical (VITA Zahnfabrik) and VITA Bleachedguide 3D-MASTER (VITA Zahnfabrik), and for a shade guide evaluation, the authors used a digital spectrophotometer, VITA Easyshade (VITA Zahnfabrik). The absolute risk of TS was evaluated by a Fisher exact test. Data of TS intensity using the NRS scale for the 2 groups were compared with Mann-Whitney and Friedman tests, whereas data from the visual analog scale were evaluated by 2-way repeated measures analysis of variance. The color changes between groups were compared using a t test (α = .05). In both groups, the authors detected a high risk of TS, which was approximately 90%. No significant difference was observed in terms of TS intensity. A whitening of approximately 3 shade guide units of the VITA Classical was detected in both groups, which were statistically similar. The use of dexamethasone before bleaching did not reduce the risk and intensity of bleaching-induced TS. The use of the steroidal anti-inflammatory agent dexamethasone was not capable of preventing TS arising from in-office dental bleaching. Copyright © 2016 American Dental Association. Published by Elsevier Inc. All rights reserved.
Golizadeh, A; Jafari-Behi, V; Razmjou, J; Naseri, B; Hassanpour, M
2017-02-01
The rose aphid, Macrosiphum rosae (L.), is one of the most important pests on rose plants (Rosa spp.) with a worldwide distribution. As resistance indices, the development, survivorship, and reproduction of this aphid were evaluated on 10 rose cultivars, including Bella Vita, Cool Water, Dolce Vita, Maroussia, Orange Juice, Pinkpromise, Roulette, Tea, Valentine, and Persian Yellow in laboratory at 25 ± 1°C, 65 ± 5% relative humidity, and photoperiod of 16:8 (L/D) h. Rose aphid successfully survived on all 10 rose cultivars, although mortality rate was higher on Tea and Bella Vita. The number of offspring per female differed significantly among the tested rose cultivars, and ranged from 9.2 on Tea to 38.7 nymphs on Orange Juice. Population growth parameters were significantly affected by rose cultivars. The longest mean generation time (T) was observed on Bella Vita (14.8 days) and Tea (14.7 days) and the shortest on Orange Juice (10.0 days). The net reproductive rate (R 0 ) ranged from 6.9 on Tea to 33.2 nymphs on Orange Juice cultivar. Correspondingly, the highest value of intrinsic rate of increase (r m ) was observed on Orange Juice (0.348 day -1 ) and lower values on Tea (0.131 day -1 ) followed by Bella Vita (0.154 day -1 ). Cluster analysis of all the measured parameters of rose aphid on different rose cultivars revealed that Tea and Bella Vita were relatively resistant to M. rosae. These findings could be useful in developing an integrated pest management (IPM) program for this aphid in urbanized areas and commercial rose potting.
Ceramic Inlays: Effect of Mechanical Cycling and Ceramic Type on Restoration-dentin Bond Strength.
Trindade, F Z; Kleverlaan, C J; da Silva, L H; Feilzer, A J; Cesar, P F; Bottino, M A; Valandro, L F
2016-01-01
This study aimed to evaluate the bond strength between dentin and five different ceramic inlays in permanent maxillary premolars, with and without mechanical cycling. One hundred permanent maxillary premolars were prepared and divided into 10 groups (n=10) according to the ceramic system (IPS e.Max Press; IPS e.Max CAD; Vita PM9; Vita Mark II; and Vita VM7) and the mechanical cycling factor (with and without [100 N, 2 Hz, 1.2×10(6) cycles]). The inlays were adhesively cemented, and all of the specimens were cut into microbars (1×1 mm, nontrimming method), which were tested under microtensile loading. The failure mode was classified and contact angle, roughness, and microtopographic analyses were performed on each ceramic surface. The mechanical cycling had a significant effect (p=0.0087) on the bond strength between dentin and IPS e.max Press. The Vita Mark II group had the highest bond strength values under both conditions, with mechanical cycling (9.7±1.8 MPa) and without (8.2±1.9 MPa), while IPS e.Max CAD had the lowest values (2.6±1.6 and 2.2±1.4, respectively). The adhesive failure mode at the ceramic/cement interface was the most frequent. Vita Mark II showed the highest value of average roughness. IPS e.max Press and Vita Mark II ceramics presented the lowest contact angles. In conclusion, the composition and manufacturing process of ceramics seem to have an influence on the ceramic surface and resin cement bond strength. Mechanical cycling did not cause significant degradation on the dentin and ceramic bond strength under the configuration used.
The Role of the Immune Response in the Pathogenesis of Thyroid Eye Disease: A Reassessment.
Directory of Open Access Journals (Sweden)
James T Rosenbaum
Full Text Available Although thyroid eye disease is a common complication of Graves' disease, the pathogenesis of the orbital disease is poorly understood. Most authorities implicate the immune response as an important causal factor. We sought to clarify pathogenesis by using gene expression microarray.An international consortium of ocular pathologists and orbital surgeons contributed formalin fixed orbital biopsies. RNA was extracted from orbital tissue from 20 healthy controls, 25 patients with thyroid eye disease (TED, 25 patients with nonspecific orbital inflammation (NSOI, 7 patients with sarcoidosis and 6 patients with granulomatosis with polyangiitis (GPA. Tissue was divided into a discovery set and a validation set. Gene expression was quantified using Affymetrix U133 Plus 2.0 microarrays which include 54,000 probe sets.Principal component analysis showed that gene expression from tissue from patients with TED more closely resembled gene expression from healthy control tissue in comparison to gene expression characteristic of sarcoidosis, NSOI, or granulomatosis with polyangiitis. Unsupervised cluster dendrograms further indicated the similarity between TED and healthy controls. Heat maps based on gene expression for cytokines, chemokines, or their receptors showed that these inflammatory markers were associated with NSOI, sarcoidosis, or GPA much more frequently than with TED.This is the first study to compare gene expression in TED to gene expression associated with other causes of exophthalmos. The juxtaposition shows that inflammatory markers are far less characteristic of TED relative to other orbital inflammatory diseases.
Wagenaar, Kim P; Broekhuizen, Berna D L; Dickstein, Kenneth; Jaarsma, Tiny; Hoes, Arno W; Rutten, Frans H
2015-12-01
Electronic health support (e-health) may improve self-care of patients with heart failure (HF). We aim to assess whether an adjusted care pathway with replacement of routine consultations by e-health improves self-care as compared with usual care. In addition, we will determine whether the ESC/HFA (European Society of Cardiology/Heart Failure Association) website heartfailurematters.org (HFM website) improves self-care when added to usual care. Finally, we aim to evaluate the cost-effectiveness of these interventions. A three-arm parallel randomized trial will be conducted. Arm 1 consists of usual care; arm 2 consists of usual care plus the HFM website; and arm 3 is the adjusted care pathway with an interactive platform for disease management (e-Vita platform), with a link to the HFM website, which replaces routine consultations with HF nurses at the outpatient clinic. In total, 414 patients managed in 10 Dutch HF outpatient clinics or in general practice will be included and followed for 12 months. Participants are included if they have had an established diagnosis of HF for at least 3 months. The primary outcome is self-care as measured by the European Heart Failure Self-care Behaviour scale (EHFScB scale). Secondary outcomes are quality of life, cardiovascular- and HF-related mortality, hospitalization, and its duration as captured by hospital and general practitioner registries, use of and user satisfaction with the HFM website, and cost-effectiveness. This study will provide important prospective data on the impact and cost-effectiveness of an interactive platform for disease management and the HFM website. unique identifier: NCT01755988. © 2015 The Authors European Journal of Heart Failure © 2015 European Society of Cardiology.
Visulaizing the Curriculum Vitae
DEFF Research Database (Denmark)
Wildgaard, Lorna Elizabeth; Lund, Haakon
, the relationships between publications and academic activites matter more than the individual activity. In order to leverage relationships in CV and publication data, we explore the usefulness of OrientDB, a multimodel noSQL database with a graph database engine, that claims to be simple and effecient to use...... is to explore if using OrientDB can present a supplementary infographic in evaluation using CV and publication information visually, as an analytical tool to create maps, giving the evaluand the opportunity to draw thematic connections between job experience/career goals and publication activites....
Nicolaysen, Rainer; Krause, Eckart; Oeter, Stefan; Cujé, Lennie; Lüthje, Jürgen; Schoch, Magdalene
2008-01-01
Aus der Einleitung: „In einer akademischen Feierstunde am 15. Juni 2006 wurde der Hörsaal J im Hauptgebäude der Universität Hamburg in Magdalene-Schoch-Hörsaal benannt – die fünfte Namensgebung im Rahmen des 1999 begonnenen Programms zur Benennung restaurierter Hörsäle nach im „Dritten Reich“ vertriebenen Hamburger Wissenschaftlerinnen und Wissenschaftlern. [...] Das vorliegende Heft der Hamburger Universitätsreden dokumentiert die auf der Feier gehaltenen Reden [...] Bei den anschließend ...
Smolin, Lee
1998-01-01
Secondo l'autore, la fisica contemporanea dovrebbe superare la vecchia impostazione newtoniana, e il pensiero fisico dovrebbe tener conto a tutti i livelli dei più recenti sviluppi teorici: l'universo si comporta come se fosse soggetto alle leggi dell'evoluzione e della selezione naturale. E' tutto plastico, e le sue leggi non sono immutabili; esiste addirittura una "competizione tra universi possibili", che dà come risultato la realtà in cui viviamo.
Total analysis systems with Thermochromic Etching Discs technology.
Avella-Oliver, Miquel; Morais, Sergi; Carrascosa, Javier; Puchades, Rosa; Maquieira, Ángel
2014-12-16
A new analytical system based on Thermochromic Etching Discs (TED) technology is presented. TED comprises a number of attractive features such as track independency, selective irradiation, a high power laser, and the capability to create useful assay platforms. The analytical versatility of this tool opens up a wide range of possibilities to design new compact disc-based total analysis systems applicable in chemistry and life sciences. In this paper, TED analytical implementation is described and discussed, and their analytical potential is supported by several applications. Microarray immunoassay, immunofiltration assay, solution measurement, and cell culture approaches are herein addressed in order to demonstrate the practical capacity of this system. The analytical usefulness of TED technology is herein demonstrated, describing how to exploit this tool for developing truly integrated analytical systems that provide solutions within the point of care framework.
New Polymer Electrolyte Cell Systems
Smyrl, William H.; Owens, Boone B.; Mann, Kent; Pappenfus, T.; Henderson, W.
2004-01-01
PAPERS PUBLISHED: 1. Pappenfus, Ted M.; Henderson, Wesley A.; Owens, Boone B.; Mann, Kent R.; Smyrl, William H. Complexes of Lithium Imide Salts with Tetraglyme and Their Polyelectrolyte Composite Materials. Journal of the Electrochemical Society (2004), 15 1 (2), A209-A2 15. 2. Pappenfus, Ted M.; Henderson, Wesley A.; Owens, Boone B.; Mann, Kent R.; Smyrl, William H. Ionic-liquidlpolymer electrolyte composite materials for electrochemical device applications. Polymeric Materials Science and Engineering (2003), 88 302. 3. Pappenfus, Ted R.; Henderson, Wesley A.; Owens, Boone B.; Mann, Kent R.; and Smyrl, William H. Ionic Conductivity of a poly(vinylpyridinium)/Silver Iodide Solid Polymer Electrolyte System. Solid State Ionics (in press 2004). 4. Pappenfus Ted M.; Mann, Kent R; Smyrl, William H. Polyelectrolyte Composite Materials with LiPFs and Tetraglyme. Electrochemical and Solid State Letters, (2004), 7(8), A254.
Healthcare-Wide Hazards: Surgical Suite
... Topics Page. OSHA Technical Manual (OTM) . OSHA Directive TED 01-00-015 [TED 1-0.15A], (January 20, 1999). Laser Hazards . ... stools) with a bright color, or a taped "X", making them more visible and distinguishable from the ...
Vita biografica vs. Vita biologica. la questione dell’anthropos in Karl Löwith
Directory of Open Access Journals (Sweden)
Gambardella, Fabiana
2012-12-01
Full Text Available This work focuses on Karl Löwith’s anthropology. Despite the great number of anthropological studies carried out at the beginning of 20th Century and aimed at describing human nature by means of natural science (biology, ethology, zoology, Löwith elaborates an anthropology based on the concept of biographical life. Man is not a simple living being, he is also an unnatural being that produces himself through the relationship with the other within a shared world.
Evaluation of a novel multiple phase veneering ceramic.
Sinthuprasirt, Pannapa; van Noort, Richard; Moorehead, Robert; Pollington, Sarah
2015-04-01
To produce a new veneering ceramic based on the production of a multiple phase glass-ceramic with improved performance in terms of strength and toughness. A composition of 60% leucite, 20% diopside and 20% feldspathic glass was prepared, blended and a heat treatment schedule of 930°C for 5 min was derived from differential thermal analysis (DTA) of the glasses. X-ray diffraction (XRD) and SEM analysis determined the crystalline phases and microstructure. Chemical solubility, biaxial flexural strength (BFS), fracture toughness, hardness, total transmittance and coefficient of thermal expansion (CTE) were all measured in comparison to a commercial veneering ceramic (VITA VM9). Thermal shock resistance of the leucite-diopside and VITA VM9 veneered onto a commercial high strength zirconia (Vita In-Ceram YZ) was also assessed. Statistical analysis was undertaken using Independent Samples t-test. Weibull analysis was employed to examine the reliability of the strength data. The mean chemical solubility was 6 μg/cm(2) for both ceramics (P=1.00). The mean BFS was 109 ± 8 MPa for leucite-diopside ceramic and 79 ± 11 MPa for VITA VM9 ceramic (P=0.01). Similarly, the leucite-diopside ceramic demonstrated a significantly higher fracture toughness and hardness. The average total transmittance was 46.3% for leucite-diopside ceramic and 39.8% for VITA VM9 (P=0.01). The leucite-diopside outperformed the VITA VM9 in terms of thermal shock resistance. Significance This novel veneering ceramic exhibits significant improvements in terms of mechanical properties, yet retains a high translucency and is the most appropriate choice as a veneering ceramic for a zirconia base core material. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Volunteer Income Tax Assistance: A Community Coalition for Financial Education and Asset Building
Koonce, Joan; Scarrow, Andrea; Palmer, Lance
2016-01-01
Free tax programs, such as Volunteer Income Tax Assistance (VITA), allow recipients of the earned income tax credit (EITC) to have their returns filed for free. VITA and other free tax programs are nationwide. However, each program is distinct, and the services provided by these programs differ. This article discusses a successful and unique…
International Nuclear Information System (INIS)
Lee, Jun-Ha; Lee, Hoong-Joo
2005-01-01
We developed a new systematic calibration procedure which was applied to the prediction of the diffusivity, the segregation, and transient enhanced diffusion (TED) of an indium impurity. The TED of the indium impurity was studied using four different experimental conditions. Although indium is susceptible to TED, rapid thermal annealing (RTA) is effective in suppressing the TED effect and maintaining a steep retrograde profile. Like boron impurities, the indium shows significant oxidation-enhanced diffusion in silicon and has segregation coefficients much less than 1 at the Si/SiO 2 interface. In contrast to boron, the segregation coefficient of indium decreases as the temperature increases. The accuracy of the proposed procedure was validated by using secondary ion mass spectrometry (SIMS) data and by using the 0.13-μm device characteristics, such as V th and I dsat , for which the differences between simulation and experiment less than 5 %.
Pierre Rabhi: agro-ecology, femininity and Śakti
Directory of Open Access Journals (Sweden)
Carola Benedetto
2016-01-01
Full Text Available Nato in Algeria, in una tradizione musulmana, da adolescente Pierre Rabhi si converte al Cristianesimo e a vent’anni approda a Parigi per lavorare come operaio specializzato. Dopo tre anni di una vita “in scatola” abbandona la capitale per installarsi nel Sud Est della Francia. Diventato operaio agricolo, si oppone però ben presto alla logica di produttività intensiva e innaturale dell’agricoltura industriale. Da autodidatta studia l’agricoltura biodinamica e biologica applicandone con successo i metodi fino a creare quella che lui ama definire un’oasi di vita. Da anni ormai Pierre Rabhi è incessantemente impegnato a promuovere un nuovo paradigma di vita basato sul rispetto dell'uomo e della terra.
Preclinical cadaveric study of transanal endoscopic da Vinci® surgery.
Hompes, R; Rauh, S M; Hagen, M E; Mortensen, N J
2012-08-01
Single-port platforms are increasingly being used for transanal surgery and may be associated with a shorter learning curve than transanal endoscopic microsurgery. However, these procedures remain technically challenging, and robotic technology could overcome some of the limitations and increase intraluminal manoeuvrability. An initial experimental experience with transanal endoscopic da Vinci(®) surgery (TEdS) using a glove port on human cadavers is reported. After initial dry laboratory experiments, the feasibility of TEdS and ideal set-up were further evaluated in human cadavers. For transanal access a glove port was constructed on-table by using a circular anal dilator, a standard wound retractor and a surgical glove. A da Vinci(®) Si HD system was used in combination with the glove port for transanal endoscopic resections. It was possible to perform all necessary tasks to complete a full-thickness excision and closure of the rectal wall, with cadavers in both prone and supine positions. The stable magnified view, combined with the EndoWrist(®) technology of the robotic instruments, made every task straightforward. Intraluminal manoeuvrability could be improved further by intersecting the robotic instruments. The glove port proved to be very reliable and the inherent flexibility of the glove facilitated docking of the robotic arms in a narrow confined space. Using a reliable and universally available glove port, TEdS was feasible and a preferred set-up was determined. Further clinical trials will be necessary to assess the safety and efficacy of this technique. Copyright © 2012 British Journal of Surgery Society Ltd. Published by John Wiley & Sons, Ltd.
A reading of Antonio Tabucchi's Il filo dell'orizzonte | Wilson | Italian ...
African Journals Online (AJOL)
Questa lettura de Il filo dell'orizzonte (1986) di Antonio Tabucchi esamina il percorso del protagonista, Spino, attraverso gli spazi di una città. La sua è una ricerca ossessiva delle “segrete ragioni” che guidano una vita. Nel tentativo di restituire l'esistenza ad un morto, Spino percepisce che la reciprocità del legame fra vita e ...
Sonmez, Nesrin; Gultekin, Pinar; Turp, Volkan; Akgungor, Gokhan; Sen, Deniz; Mijiritsky, Eitan
2018-01-08
Polymer infiltrated ceramics and nano-ceramic resins are the new restorative materials which have been developed in order to enhance the adverse properties of glass-matrix ceramics and resin composites. The aim of the present in vitro study was to evaluate the characteristics of various CAD/CAM materials through mechanical, microstructural, and SEM analysis. Five test groups (n = 22) were formed by using the indicated CAD/CAM blocks: VITA Enamic (VITA Zahnfabrik), Lava Ultimate (3 M ESPE), IPS e.max CAD (Ivoclar Vivadent), IPS Empress CAD (Ivoclar Vivadent), and VITA Mark II (VITA Zahnfabrik). Two specimens from each test group were used for XRD and EDS analysis. Remaining samples were divided into two subgroups (n = 10). One subgroup specimens were thermocycled (5 °C to 55 °C, 30s, 10,000 cycles) whereas the other were not. All of the specimens were evaluated in terms of flexural strength, Vickers hardness, and fracture toughness. Results were statistically analyzed using two-way ANOVA, one-way ANOVA, Tukey's HSD, and Student's t tests (α = .05). Fractured specimens were evaluated using SEM. The highest Vickers microhardness value was found for VITA Mark II (p CAD was found to have the highest flexural strength (p CAD was also higher than other tested block materials (p CAD groups. It should be realised that simulated aging process seem to affect ceramic-polymer composite materials more significantly than glass ceramics.
One-day live webcast of the TEDGlobal 2012 Conference
2012-01-01
We would like to invite you to a one-day live webcast of the TEDGlobal 2012 Conference. TED is a nonprofit organisation devoted to Ideas Worth Spreading. It started out (in 1984) as a conference bringing together people from three worlds: Technology, Entertainment, Design. The two annual TED conferences, in Long Beach/Palm Springs and Edinburgh, Scotland, bring together the world's most fascinating thinkers and doers, who are challenged to give the talk of their lives (in 18 minutes or less). TED includes the TEDx programs which give communities, organisations and individuals the opportunity to stimulate dialogue through TED-like experiences at the local level. TEDx events are planned and coordinated independently. CERN is investigating the possibility of holding a TEDx event in the future. Follow @TEDxCERN on twitter or like our TEDxCERN Facebook page for more information as it becomes available. Meanwhile, on 27 June, we will be showing 3 sessions of the TEDGlobal 2012 live...
FindYourWay : Aplicación web: buscador de perfiles profesionales
Cano Sandín, Cristina
2014-01-01
Desarrollo de un producto de software de gestión del capital humano, en su módulo funcional de gestión de curriculum vitae. Desenvolupament d'un producte de programari de gestió del capital humà, en el seu mòdul funcional de gestió de currículum vitae. Bachelor thesis for the Multimedia program.
Elementary Teacher Education in the Top Performing European TIMSS Countries: A Comparative Study
Sabrin, Mohammed
2018-01-01
This paper analyzed elementary teacher education (hereafter 'TED') programs in the top performing European (TIMSS) countries to help inform future elementary TED policy in the Kingdom of Saudi Arabia. Methodological emphasis revolved around how much emphasis should be placed on general content knowledge (GCK), as opposed to general pedagogical…
DOE 2012 Occupational Radiation Exposure October 2013
Energy Technology Data Exchange (ETDEWEB)
Podonsky, Glenn S. [US Dept. of Energy, Washington, DC (United States). Office of Health, Safety and Security
2012-02-02
The U.S. Department of Energy (DOE) Office of Analysis within the Office of Health, Safety and Security (HSS) publishes the annual DOE Occupational Radiation Exposure Report to provide an overview of the status of radiation protection practices at DOE (including the National Nuclear Security Administration [NNSA]). The DOE 2012 Occupational Radiation Exposure Report provides an evaluation of DOE-wide performance regarding compliance with Title 10, Code of Federal Regulations (C.F.R.), Part 835, Occupational Radiation Protection dose limits and as low as reasonably achievable (ALARA) process requirements. In addition, the report provides data to DOE organizations responsible for developing policies for protection of individuals from the adverse health effects of radiation. The report provides a summary and an analysis of occupational radiation exposure information from the monitoring of individuals involved in DOE activities. Over the past 5-year period, the occupational radiation exposure information is analyzed in terms of aggregate data, dose to individuals, and dose by site. As an indicator of the overall amount of radiation dose received during the conduct of operations at DOE, the report includes information on collective total effective dose (TED). The TED is comprised of the effective dose (ED) from external sources, which includes neutron and photon radiation, and the internal committed effective dose (CED), which results from the intake of radioactive material into the body. The collective ED from photon exposure decreased by 23% between 2011 and 2012, while the neutron dose increased by 5%. The internal dose components of the collective TED decreased by 7%. Over the past 5-year period, 99.99% of the individuals receiving measurable TED have received doses below the 2 roentgen equivalent in man (rems) (20 millisievert [mSv]) TED administrative control level (ACL), which is well below the DOE regulatory limit of 5 rems (50 mSv) TED annually. The
Traction esophageal diverticulum: a rare cause of gastro-intestinal bleeding.
Ballehaninna, Umashankar K; Shaw, Jason P; Brichkov, Igor
2012-12-01
Esophageal diverticula are uncommon lesions that are usually classified according to their location (cervical, thoracic, or epiphrenic), or underlying pathogenesis (pulsion or traction), and their morphology (true or false).The majority of esophageal diverticula are acquired lesions that occur predominantly in elderly adults. Pulsion, or false, diverticula are the most commonly encountered type of esophageal diverticula noticed at the level of cricopharyngeus muscle, occur as a localized outpouchings that lacks a muscular coat, and as such their wall is formed entirely by mucosa and submucosa. True, or traction, esophageal diverticulum (TED) is seen in the middle one third of the thoracic esophagus in a peribronchial location, occurs secondary to mediastinal inflammatory lesions such as tuberculosis or histoplasmosis. The resultant desmoplastic reaction in the paraesophageal tissue causes full thickness pinching on the esophageal wall, producing a conical, broad-mouthed true diverticulum. They often project to the right side because subcarinal lymph nodes in this area are closely associated with the right anterior wall of the esophagus. TED usually presents with symptoms such as dysphagia, postural regurgitation, belching, retrosternal pain, heartburn, and epigastric pain. As in patients with pharyngoesophageal (Zenker's) diverticula, pulmonary symptoms are often present but underestimated in TED patients. These symptoms range from mild nocturnal cough to life-threatening massive aspiration. In this particular report we describe a rare case of TED presenting as a symptomatic upper gastrointestinal bleeding. Diagnostic evaluation of TED includes chest X-ray, barium esophagogram and manometry. A significant proportion of lower esophageal diverticula are associated with motility disorders. Management of TED include treating the underlying cause sometimes a surgical resection of diverticulum along with esophageal myotomy is necessitated in symptomatic patients.
Wallace, Michael P; Stewart, Catherine E; Moseley, Merrick J; Stephens, David A; Fielder, Alistair R
2016-12-01
To generate a statistical model for personalizing a patient's occlusion therapy regimen. Statistical modelling was undertaken on a combined data set of the Monitored Occlusion Treatment of Amblyopia Study (MOTAS) and the Randomized Occlusion Treatment of Amblyopia Study (ROTAS). This exercise permits the calculation of future patients' total effective dose (TED)-that predicted to achieve their best attainable visual acuity. Daily patching regimens (hours/day) can be calculated from the TED. Occlusion data for 149 study participants with amblyopia (anisometropic in 50, strabismic in 43, and mixed in 56) were analyzed. Median time to best observed visual acuity was 63 days (25% and 75% quartiles; 28 and 91 days). Median visual acuity in the amblyopic eye at start of occlusion was 0.40 logMAR (quartiles 0.22 and 0.68 logMAR) and at end of occlusion was 0.12 (quartiles 0.025 and 0.32 logMAR). Median lower and upper estimates of TED were 120 hours (quartiles 34 and 242 hours), and 176 hours (quartiles 84 and 316 hours). The data suggest a piecewise linear relationship (P = 0.008) between patching dose-rate (hours/day) and TED with a single breakpoint estimated at 2.16 (standard error 0.51) hours/day, suggesting doses below 2.16 hours/day are less effective. We introduce the concept of TED of occlusion. Predictors for TED are visual acuity deficit, amblyopia type, and age at start of occlusion therapy. Dose-rates prescribed within the model range from 2.5 to 12 hours/day and can be revised dynamically throughout treatment in response to recorded patient compliance: a personalized dosing strategy.
Directory of Open Access Journals (Sweden)
Francisco Javier Fuertes
2011-06-01
Full Text Available Buscando profundizar en la demonología cristiana tardoantigua, el trabajo analiza un ambiguo pasaje de la Vita Antonii de Atanasio de Alejandría donde se narra la ascensión del alma de Antonio a los cielos y su encuentro con unos seres “terribles”. El autor parte de los trabajos de J. Daniélou sobre las potencias aéreas y su papel en las distintas variantes del mito gnóstico del ascenso del alma a través de los diferentes cielos. A partir de ahí, el autor profundiza en el análisis del pasaje, aportando diversos paralelos textuales. Termina adhiriéndose a las perspectivas de D. Brakke sobre las teorías ascéticas de Atanasio para defender finalmente que dichos “seres” podrían identificarse con los «arcontes», término de connotaciones heterodoxas que el obispo habría silenciado en sus esfuerzos para inculcar en los fieles la idea de que lo realmente necesario para alcanzar la salvación era un comportamiento moral virtuoso.
Laschke, Christin
2013-01-01
How individual characteristics affect the acquisition of knowledge in teacher education has been widely unexplored thus far. The "Teacher Education and Development Study--Learning to Teach Mathematics (TEDS-M)" provides a database for examining this research question across countries. Based on the Taiwanese and German sample of TEDS-M,…
Dygtige lærere er en forudsætning for folkeskolens resultater
DEFF Research Database (Denmark)
Andersen, Frans Ørsted; Egelund, Niels
2014-01-01
Artiklen refererer til en række internationale undersøgelser af lærere og elevers kompetencer, bl.a. PIACC, TEDS-M og TIMSS......Artiklen refererer til en række internationale undersøgelser af lærere og elevers kompetencer, bl.a. PIACC, TEDS-M og TIMSS...
Directory of Open Access Journals (Sweden)
Rosales Saurer, Bruno
2008-10-01
Full Text Available The field of ambulatory nursing is rapidly growing due to rising health care costs and the demographic development. Today there are approximately 2 million persons in Germany who need outpatient care. Experts predict that there will be more than twice as much by 2050. Ambulatory care nurses must quickly and efficiently assess their patients’ condition and needs. Against this background, the VitaBIT project started in July 2007 with the objective of reorganizing ambulatory care in order to improve quality while at the same time increasing efficiency and saving costs. VitaBIT is promoted by the German federal ministry of economy and technology (BMWi. VitaBIT runs up to the end of 2009, partners of the project are CAS Software AG, PTV Planung Transport Verkehr AG, FZI Forschungszentrum Informatik, Sozial- und Diakoniestation Weinstadt e.V. und Wibu-Systems AG. VitaBIT aims to design an ICT platform for the safe application of mobile information services in ambulatory nursing. Communication and secure information exchange between all parties involved in the care process will also be guaranteed. The article explains the project’s current approach to develop a user-oriented solution by integrating already existing components and services.
Bossi, A; Whitcombe, M J; Uludag, Y; Fowler, S; Chianella, I; Subrahmanyam, S; Sanchez, I; Piletsky, S A
2010-05-15
A "grafting from" approach has been used for controlled deposition of cross-linked polymers by living radical polymerisation. Borosilicate glass was modified with N,N-diethylaminodithiocarbamoylpropyl(trimethoxy)silane, in order to confine the iniferter reactive groups solely at its surface, then placed in solution with monomers and cross-linker. The polymerisation was initiated by UV irradiation. Formation of the cross-linked polymers was studied in terms of time course of the reaction, type of monomers incorporated and influence of oxygen. Grafted surfaces were characterised by AFM, FT-IR, ellipsometry and contact angle measurements. The ability to control the grafted layer improved dramatically when the chain terminator agent, N,N-N',N'-tetraethyl thiuram disulphide (TED) was added. Upon irradiation TED increases the concentration of passive capping radicals and decreases the possibility of recombination of active macro-radicals, thus prolonging their lifetime. In the absence of TED the thickness of produced coatings was below 10 nm. TED added at different concentrations assisted in the formation of grafted layers of 10-130 nm thickness. Iniferter chemistry in the presence of TED can be used for growing nanometre-scale polymer layers on solid supports. It constitutes a robust general platform for controlled grafting and offer a general solution to address the needs of surface derivatisation in sensors technology. 2010 Elsevier B.V. All rights reserved.
Gorler, Oguzhan; Saygin, Aysegul Goze
2017-06-01
Laser modalities and direct metal laser sintering (DMLS) have a potential to enhance micromechanical bonding between dental super- and infrastructures. However, the effect of different manufacturing methods on the metal-ceramic bond strength needs further evaluation. We investigated the effect of surface treatment with Er:YAG, Nd:YAG, and Ho:YAG lasers on the shear bond strength (SBS) of high-fusion dental porcelains (Vita and G-Ceram) to infrastructures prepared with DMLS in vitro settings. Study specimens (n = 128) were randomly divided into study subsets (n = 8), considering treatment types applied on the surface of infrastructures, including sandblasting and selected laser modalities; infrastructure types as direct laser sintered (DLS) and Ni-Cr based; and superstructure porcelains as Vita and G-Ceram. The SBS test was performed to assess the effectiveness of surface modifications that were also examined with a stereo microscope. Considering laser procedure types, the highest SBS values were obtained by Er:YAG laser, followed by, with a decreasing efficiency, Ho:YAG laser and sandblasting procedures, and Nd:YAG laser procedure (p laser decreases the bonding of Vita and G-Ceram in all the infrastructures compared with sandblasting. Considering porcelains, the highest SBS values were obtained by Vita (p laser procedures caused surface irregularities as revealed by the stereo microscopic examination. In current experimental settings, Er:YAG laser applied to DLS infrastructure veneered with Vita porcelain increases bonding strength more distinctly, and Nd:YAG laser applied to Ni-Cr-based infrastructure veneered with G-Ceram porcelain alters bonding strength unfavorably.
“Si Lasci Quindi ad Ognuno il Diritto di Raccontare i Fatti suoi a Modo suo”
Directory of Open Access Journals (Sweden)
Doris Nátia Cavallari
2015-06-01
Full Text Available Nel Decameron di Giovanni Boccaccio i personaggi-narratori raccontano novelle con la propria intonazione narrativa e creano una nuova estetica della prosa letteraria. La libertà del modo di narrare i fatti presi dalla vita e trasformati in fiction rivela la proposta dell’autore di segnare la distanza tra vita e arte, che ha come risultato un testo rinnovatore nel carattere pluridiscorsivo e pluristilistico
“Si lasci quindi ad ognuno il diritto di raccontare i fatti suoi a modo suo”
Directory of Open Access Journals (Sweden)
Doris Nátia Cavallari
2015-06-01
Full Text Available Nel Decameron di Giovanni Boccaccio i personaggi-narratori raccontano novelle con la propria intonazione narrativa e creano una nuova estetica della prosa letteraria. La libertà del modo di narrare i fatti presi dalla vita e trasformati in fiction rivela la proposta dell’autore di segnare la distanza tra vita e arte, che ha come risultato un testo rinnovatore nel carattere pluridiscorsivo e pluristilistico
How Alzheimer's Changes the Brain
Full Text Available ... 17. TEDx Talks 12,392 views 12:17 Alzheimer’s Is Not Normal Aging — And We Can Cure It | Samuel Cohen | TED Talks - Duration: 7:54. TED 286,506 views 7:54 Day in the Life of an Alzheimer's Caregiver: Heartbreaking - Duration: 4:39. DavidNazarNews 31,783 ...
Microstructure characterization and SCG of newly engineered dental ceramics.
Ramos, Nathália de Carvalho; Campos, Tiago Moreira Bastos; Paz, Igor Siqueira de La; Machado, João Paulo Barros; Bottino, Marco Antonio; Cesar, Paulo Francisco; Melo, Renata Marques de
2016-07-01
The aim of this study was to characterize the microstructure of four dental CAD-CAM ceramics and evaluate their susceptibility to stress corrosion. SEM and EDS were performed for microstructural characterization. For evaluation of the pattern of crystallization of the ceramics and the molecular composition, XRD and FTIR, respectively, were used. Elastic modulus, Poisson's ratio, density and fracture toughness were also measured. The specimens were subjected to biaxial flexure under five stress rates (0.006, 0.06, 0.6, 6 and 60MPa/s) to determine the subcritical crack growth parameters (n and D). Twenty-five specimens were further tested in mineral oil for determination of Weibull parameters. Two hundred forty ceramic discs (12mm diameter and 1.2mm thick) were made from four ceramics: feldspathic ceramic - FEL (Vita Mark II, Vita Zahnfabrik), ceramic-infiltrated polymer - PIC (Vita Enamic, Vita Zahnfabrik), lithium disilicate - LD (IPS e.max CAD, Ivoclar Vivadent) and zirconia-reinforced lithium silicate - LS (Vita Suprinity, Vita Zahnfabrik). PIC discs presented organic and inorganic phases (n=29.1±7.7) and Weibull modulus (m) of 8.96. The FEL discs showed n=36.6±6.8 and m=8.02. The LD discs showed a structure with needle-like disilicate grains in a glassy matrix and had the lowest value of n (8.4±0.8) and m=6.19. The ZLS discs showed similar rod-like grains, n=11.2±1.4 and m=9.98. The FEL and PIC discs showed the lowest susceptibility to slow crack growth (SCG), whereas the LD and ZLS discs presented the highest. PIC presented the lowest elastic modulus and no crystals in its composition, while ZLS presented tetragonal zirconia. The overall strength and SCG of the new materials did not benefit from the additional phase or microconstituents present in them. Copyright © 2016 The Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Oliveira, Karla Mychellyne Costa
2007-01-01
Full Text Available Introdução: Uma nova geração de resinas laboratoriais contendo micro-partículas cerâmicas em sua composição tem sido introduzida no mercado com a finalidade de melhorar suas propriedades mecânicas. Objetivo: O objetivo deste estudo foi avaliar o efeito da termociclagem na resistência à flexão de três resinas laboratoriais. Materiais e método: Foram confeccionadas 48 barras com medidas de 2 mm × 2 mm × 25 mm, utilizando as resinas laboratoriais: G1 - RESILAB MASTER (Wilcos, Brasil, G2 - VITA VM LC (Vita Zanhfabrik, Germany, G3 - VITA ZETA LC (Vita Zanhfabrik, Germany. A metade das barras de cada grupo foi submetida a 3000 ciclos térmicos (5ºC/55ºC ± 1, com banhos de 30 s. Os ensaios mecânicos foram efetuados em máquina de ensaio universal EMIC com capacidade de carga de 100 kg e velocidade de 0,5 mm/min. Resultados: Os dados obtidos foram analisados estatisticamente pelo teste de ANOVA (two-way e Tukey (p < 0,05. As médias (± DP observadas para os grupos sem ciclagem foram: G1(112,6 ± 25,39, G2(116,5 ± 18,51 e G3(136,1 ± 24,34; e para os grupos com ciclagem: G1(91,8 ± 18,86, G2(101,9 ± 20,61 e G3(89,9 ± 23,05. Conclusão: Concluiu-se que a diminuição da resistência à flexão em MPa está diretamente dependente da ciclagem térmica nos grupos testados, sendo que os maiores valores foram obtidos pela resina VITA VM LC. Entretanto, na condição sem ciclagem térmica a VITA ZETA apresentou os maiores valores
Flury, Simon; Diebold, Elisabeth; Peutzfeldt, Anne; Lussi, Adrian
2017-06-01
Because of the different composition of resin-ceramic computer-aided design and computer-aided manufacturing (CAD-CAM) materials, their polishability and their micromechanical properties vary. Moreover, depending on the composition of the materials, their surface roughness and micromechanical properties are likely to change with time. The purpose of this in vitro study was to investigate the effect of artificial toothbrushing and water storage on the surface roughness (Ra and Rz) and the micromechanical properties, surface hardness (Vickers [VHN]) and indentation modulus (E IT ), of 5 different tooth-colored CAD-CAM materials when polished with 2 different polishing systems. Specimens (n=40 per material) were cut from a composite resin (Paradigm MZ100; 3M ESPE), a feldspathic ceramic (Vitablocs Mark II; Vita Zahnfabrik), a resin nanoceramic (Lava Ultimate; 3M ESPE), a hybrid dental ceramic (Vita Enamic; Vita Zahnfabrik), and a nanocomposite resin (Ambarino High-Class; Creamed). All specimens were roughened in a standardized manner and polished either with Sof-Lex XT discs or the Vita Polishing Set Clinical. Surface roughness, VHN, and E IT were measured after polishing and after storage for 6 months (tap water, 37°C) with periodic, artificial toothbrushing. The surface roughness, VHN, and E IT results were analyzed with a nonparametric ANOVA followed by Kruskal-Wallis and exact Wilcoxon rank sum tests (α=.05). Irrespective of polishing system and of artificial toothbrushing and storage, Lava Ultimate generally showed the lowest surface roughness and Vitablocs Mark II the highest. As regards micromechanical properties, the following ranking of the CAD-CAM materials was found (from highest VHN/E IT to lowest VHN/E IT ): Vitablocs Mark II > Vita Enamic > Paradigm MZ100 > Lava Ultimate > Ambarino High-Class. Irrespective of material and of artificial toothbrushing and storage, polishing with Sof-Lex XT discs resulted in lower surface roughness than the Vita Polishing
Nanda, Tavish; Dunbar, Kristen E; Campbell, Ashley A; Bathras, Ryan M; Kazim, Michael
2018-05-18
Despite the paucity of supporting data, it has generally been held that proptosis in thyroid eye disease (TED) may provide relative protection from compressive optic neuropathy (CON) by producing spontaneous decompression. The objective of this study was to investigate this phenomenon in patients with bilateral TED-CON. We retrospectively reviewed the charts of 67 patients (134 orbits) with bilateral TED-CON at Columbia-Presbyterian Medical Center. Significant asymmetric proptosis (Hertel) was defined as ≥ 2 mm. Significant asymmetric CON was defined first, as the presence of an relative afferent pupillary defect. Those without an relative afferent pupillary defect were evaluated according to the TED-CON formula y = -0.69 - 0.31 × (motility) - 0.2 × (mean deviation) - 0.02 × (color vision) as previously established for the diagnosis of TED-CON. A difference in the formula result ≥ 1.0 between eyes was considered significant. Patients were then divided into 4 groups. Forty-one of 67 patients demonstrated asymmetric CON (29 by relative afferent pupillary defect, 12 by formula). Twenty-one of 67 patients demonstrated asymmetric proptosis. Only 5 of 12 (41.6%) of the patients who had both asymmetric proptosis and asymmetric CON (group 1) showed greater proptosis in the eye with less CON. Twenty-nine patients (group 2) showed that asymmetric CON occurred despite symmetrical proptosis. Seventeen patients (group 3), showed the inverse, that asymmetric differences in proptosis occurred with symmetrical CON. Despite commonly held assumptions, our results suggest that greater proptosis is not associated with improved TED-CON. Combining groups 1 to 3-all of which demonstrated asymmetry of either proptosis, CON, or both-91.4% of patients did not show a relationship between greater proptosis and improved CON.
Energy Technology Data Exchange (ETDEWEB)
Carnevale, Francisco Cesar, E-mail: francisco.carnevale@criep.com.br; Moreira, Airton Mota [University of Sao Paulo, Department of Radiology (Brazil); Harward, Sardis Honoria [The Dartmouth Institute for Health Policy and Clinical Practice (United States); Bhatia, Shivank [University of Miami Medical Center, Department of Interventional Radiology (United States); Assis, Andre Moreira de [University of Sao Paulo, Department of Radiology (Brazil); Srougi, Miguel [University of Sao Paulo, Department of Urology (Brazil); Cerri, Giovanni Guido [University of Sao Paulo, Department of Radiology (Brazil); Antunes, Alberto Azoubel [University of Sao Paulo, Department of Urology (Brazil)
2017-03-15
PurposeTo compare recurrence of lower urinary tract symptoms (LUTS) recurrence at 12 months following original prostate artery embolization (oPAE) or “proximal embolization first, then embolize distal” (PErFecTED) PAE for benign prostatic hyperplasia (BPH).Materials and Methods105 consecutive patients older than 45 years, with prostate size greater than 30 cm{sup 3}, International Prostate Symptom Score (IPSS) ≥ 8, quality of life (QoL) index ≥ 3, and refractory status or intolerance of medical management were prospectively enrolled between June 2008 and August 2013. The study was IRB-approved, and all patients provided informed consent. Patients underwent oPAE or PErFecTED PAE and were followed for at least 12 months. Technical success was defined as bilateral embolization and clinical success (non-recurrence) was defined as removal of the Foley catheter in patients with urinary retention, IPSS < 8 and QoL index < 3 at 12 months of follow-up. Nonparametric statistics were used to compare the study groups due to the size of the study population and distributions of clinical data.Results97 patients had 12-month data and were categorized as oPAE without recurrence (n = 46), oPAE with recurrence (n = 13), PErFecTED without recurrence (n = 36), or PErFecTED with recurrence (n = 2). Recurrence was significantly more common in oPAE patients (χ{sup 2}, p = 0.026). Unilateral embolization was significantly associated with recurrence among patients who underwent oPAE (χ{sup 2}, p = 0.032).ConclusionsBoth oPAE and PErFecTED PAE are safe and effective methods for treatment of LUTS, but PErFecTED PAE is associated with a significantly lower rate of symptom recurrence.
Directory of Open Access Journals (Sweden)
Karina M. Cancelliero-Gaiad
2013-12-01
Full Text Available BACKGROUND: Transcutaneous electrical diaphragmatic stimulation (TEDS has been used to improve respiratory muscle strength in patients with respiratory muscle weakness. However, this physical therapy resource has not been studied in chronic obstructive pulmonary disease (COPD. OBJECTIVE: To evaluate the respiratory pattern during one session of TEDS in COPD patients. METHOD: Fifteen COPD patients participated in one TEDS session for plethysmographic analysis and assessment of peripheral oxygen saturation (SpO2 and heart rate (HR. After the session, patients were divided into two groups: Responder (R; n=9 and Non-Responder (NR; n=6 to TEDS. Statistic analysis was performed using the Shapiro-Wilk normality test and two-way ANOVA. For the parameters that showed interaction, the Student t test was used (P<0.05. RESULTS: R group consisted mainly of men, with lower SpO2 and higher HR than NR group. When time (before and during and groups (R and NR were compared (interaction, there were differences in the parameters minute ventilation (Vent, inspiratory tidal volume (ViVol, expiratory tidal volume (VeVol, and respiratory rate (Br/M. In the intergroup comparison, differences were observed in the parameters Vent, ViVol, and VeVol. A significant effect was also observed for time in change in end-expiratory lung volume level (qDEEL, phase relation during inspiration (PhRIB; phase relation during expiration (PhREB; phase relation of entire breath (PhRTB, and phase angle (PhAng. During TEDS, there was an increase in SpO2 and a reduction in HR in both groups. CONCLUSIONS: The most hypoxemic group with greater HR responded to TEDS and there was interaction between group and time of analysis for the pulmonary volumes. The time factor had an influence on the two groups with an increase in thoracoabdominal asynchrony.
Directory of Open Access Journals (Sweden)
Teuta Serreqi Jurić
2017-01-01
Full Text Available The Christian idea of Providence is quite conventional in Byzantine literature and it is not surprising that it is present in Vita Bas., the biography of Emperor Basil I, Porphyrogenitus’ grandfather, in which we also find a strong influence of the Holy Scripture. Taking into account the author’s frequent references to the mentioned idea, in this paper we aim to examine the relationship between the emphasis of the idea of Providence and the influence of the Holy Scripture, as well as to answer the question of why Porphyrogenitus constantly stresses the importance of divine providence throughout Basil’s life if the Byzantines perceived emperors as appointed by God himself. Our research has shown that the author, wishing to support the idea that God’s will played a key role in every aspect of Basil’s life, used the Holy Scripture as a source from which he extracted quotes or lexical and phraseological parallels and incorporated them into the descriptions of important moments in Basil’s life in order to present his grandfather as a pious man, obedient to God’s will, which consequently led him to the throne. Additionally, he aimed to describe Basil’s personal traits, more precisely, justice, piety and mercy, as Christian virtues which marked his politics, as well as to highlight his sobriety and prudence in the face of most difficult family circumstances, one of which was surely the death of his son Constantine. With the same intention the author used the exempla when comparing Basil to the biblical figures of Samson, Abraham and the father from the Parable of the prodigal son, or biblical metaphors of the storm and the shepherd and his flock, when illustrating the dangers of war and depicting Basil as a ruler. Although the use of quotes and stylistic devices usually follows the rhetorical conventions of a given period of time and genre standards, and in this case the genre we are dealing with is an encomium written in honour of a
"Rera": historia de una palabra
Fradejas Lebrero, José
2011-01-01
Se analiza una palabra que es un hapax legomenon que solo se documenta en la Vita Beata de Juan de Lucena y se establece, a partir de ella, que el étimo propuesto para algunos derivados es erróneo. It is analyzed a word that is only attested in Juan de Lucena's Vita Beata, and it is established that the proposed etymon for some of it reflexes is mistaken.
Agha, Riaz; Whitehurst, Katharine; Jafree, Daniyal; Devabalan, Yadsan; Koshy, Kiron; Gundogan, Buket
2017-01-01
A medical curriculum vitae remains an important document that has 2 main roles: to distinguish candidates applying for various positions, whether that be jobs, posts, grants and it provides a means of keeping an up-to-date record of all your achievements and skills gained thus far. This article provides detailed guidance on how to structure an effective curriculum vitae to maximize your chances of success when applying for these positions.
Agha, Riaz; Whitehurst, Katharine; Jafree, Daniyal; Devabalan, Yadsan; Koshy, Kiron; Gundogan, Buket
2017-07-01
A medical curriculum vitae remains an important document that has 2 main roles: to distinguish candidates applying for various positions, whether that be jobs, posts, grants and it provides a means of keeping an up-to-date record of all your achievements and skills gained thus far. This article provides detailed guidance on how to structure an effective curriculum vitae to maximize your chances of success when applying for these positions.
A CONTRIBUTION TOWARDS A REVISION OF THE AQUATIC ...
African Journals Online (AJOL)
in the rather small number of papers dealing with the fauna of Africa, including Madagascar. New material has ... u ced b y Sa b in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted. 2010). ...... flora and fauna. Trans. roy. Soc.
AN INVESTIGATION OF PYURA STOLONIFBRA (TUNICATA) FROM ...
African Journals Online (AJOL)
towards the branchial siphon in P. st%ni/era from South Africa (Figure 2), whereas the ... in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted. 2010). ...... The constitution of the intertidal fauna and flora of South Mrica, part 2.
Evaluation of Two Models of Non-Penetrating Captive Bolt Devices for On-Farm Euthanasia of Turkeys.
Woolcott, Caitlin R; Torrey, Stephanie; Turner, Patricia V; Serpa, Lilia; Schwean-Lardner, Karen; Widowski, Tina M
2018-03-20
On-farm euthanasia is a critical welfare issue in the poultry industry and can be particularly difficult to perform on mature turkeys due to their size. We evaluated the efficacy of two commercially available non-penetrating captive bolt devices, the Zephyr-EXL and the Turkey Euthanasia Device (TED), on 253 turkeys at three stages of production: 4-5, 10, and 15-20 weeks of age. Effectiveness of each device was measured using both ante- and post-mortem measures. Application of the Zephyr-EXL resulted in a greater success rate (immediate abolishment of brainstem reflexes) compared to the TED (97.6% vs. 89.3%, p = 0.0145). Times to last movement ( p = 0.102) and cardiac arrest ( p = 0.164) did not differ between devices. Ante- and post-mortem measures of trauma and hemorrhage were highly correlated. Skull fractures and gross subdural hemorrhage (SDH) were present in 100% of birds euthanized with both the Zephyr-EXL and TED devices. Gross SDH scores were greater in birds killed with the Zephyr-EXL than the TED ( p < 0.001). Microscopic SDH scores indicated moderate to severe hemorrhage in 92% of turkeys for the Zephyr-EXL and 96% of turkeys for the TED, with no difference between devices ( p = 0.844). Overall, both devices were highly effective inducing immediate insensibility through traumatic brain injury and are reliable, single-step methods for on-farm euthanasia of turkeys.
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. [ed.
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration (ER) and waste management (WN) problems at the Oak Ridge K-25 Site. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remediation, decontamination, and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This volume 3 B provides the Technology Evaluation Data Sheets (TEDS) for ER/WM activities (Remedial Action Robotics and Automation, Waste Management) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than each technology in Vol. 2. The TEDS are arranged alphanumerically by the TEDS code number in the upper right corner of each data sheet. Volume 3 can be used in two ways: (1) technologies that are identified from Vol. 2 can be referenced directly in Vol. 3 by using the TEDS codes, and (2) technologies and general technology areas (alternatives) can be located in the index in the front of this volume.
Oak Ridge K-25 Site Technology Logic Diagram
Energy Technology Data Exchange (ETDEWEB)
Fellows, R.L. (ed.)
1993-02-26
The Oak Ridge K-25 Technology Logic Diagram (TLD), a decision support tool for the K-25 Site, was developed to provide a planning document that relates environmental restoration (ER) and waste management (WN) problems at the Oak Ridge K-25 Site. The TLD technique identifies the research necessary to develop these technologies to a state that allows for technology transfer and application to waste management, remediation, decontamination, and decommissioning activities. The TLD consists of four separate volumes-Vol. 1, Vol. 2, Vol. 3A, and Vol. 3B. Volume 1 provides introductory and overview information about the TLD. Volume 2 contains logic diagrams. Volume 3 has been divided into two separate volumes to facilitate handling and use. This volume 3 B provides the Technology Evaluation Data Sheets (TEDS) for ER/WM activities (Remedial Action Robotics and Automation, Waste Management) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than each technology in Vol. 2. The TEDS are arranged alphanumerically by the TEDS code number in the upper right corner of each data sheet. Volume 3 can be used in two ways: (1) technologies that are identified from Vol. 2 can be referenced directly in Vol. 3 by using the TEDS codes, and (2) technologies and general technology areas (alternatives) can be located in the index in the front of this volume.
Nucleation, growth and dissolution of extended defects in implanted Si: impact on dopant diffusion
International Nuclear Information System (INIS)
Claverie, A.; Giles, L.F.; Omri, M.; Mauduit, B. de; Ben Assayag, G.; Mathiot, D.
1999-01-01
Transient Enhanced Diffusion (TED) of boron in silicon is driven by the large supersaturations of self-interstitial silicon atoms left after implantation which also often lead to the nucleation and subsequent growth, upon annealing, of extended defects. In this paper we review selected experimental results and concepts concerning boron diffusion and/or defect behavior which have recently emerged with the ion implantation community and briefly indicate how they are, or will be, currently used to improve 'predictive simulations' softwares aimed at predicting TED. In a first part, we focus our attention on TED and on the formation of defects in the case of 'direct' implantation of boron in silicon. In a second part, we review our current knowledge of the defects and of the diffusion behavior of boron when annealing preamorphised Si. In a last part, we try to compare these two cases and to find out what are the reasons for some similarities and many differences in defect types and thermal evolution depending on whether boron is implanted in crystalline or amorphous silicon. While rising many more questions, we propose a 'thermodynamical' vision of the nucleation and growth of clusters and extended defects and stress the interactions between these defects and the free Si self-interstitial atoms which surround them and are the source for TED in all cases. A pragmatic approach to the simulation of TED for various experimental conditions is proposed
[Effect of Ti bonder on the bond strength between porcelain and titanium].
Yao, Hai; Luo, Xiao-ping
2009-12-01
To investigate the influence of GC Initial Ti Bonder on bond strength between Vita Titankeramik porcelain and titanium. Forty titanium samples were prepared and randomly assigned to 4 groups with 10 samples in each group. Samples in each group were subjected to one of the following surface treatments, burnishing (Group B), sandblasting (Group S), firing GC Initial Ti Bonder after burnishing (Group BG) and firing GC Initial Ti Bonder after sandblasting (Group SG). Vita Titankeramik porcelain were fired on the surface of each sample in the middle. Three-point bending tests were conducted on each sample according to the ISO 9693. The fracture patterns of all specimens were recorded using zoom stereo microscope (ZSM) and the fracture surfaces were observed under scanning electron microscope (SEM). With fired GC Initial Ti Bonder, the bond strength of Vita Titankeramik porcelain to titanium in Group BG and Group SG were (32.72 +/- 4.46) and (34.25 +/- 6.52) MPa respectively, which reach the ISO 9693 standard for clinical use and were significantly higher than those in Group B [(20.70 +/- 3.15) MPa] and Group S [(23.92 +/- 5.02) MPa]. GC Initial Ti Bonder can significantly improve bond strength between Vita Titankeramik porcelain and titanium.
Non scholae, sed vitae discimus!
Directory of Open Access Journals (Sweden)
Ursula Mulley
2013-12-01
Full Text Available "We want our young people exposed to ICT in school from the very beginning, and we want teachers who are confident to share their knowledge", mit diesen Aussagen der EU-Kommissarin for Education, Nellie Kroes (Europäische Kommision, 2013, wird deutlich, dass LehrerInnen aufgefordert sind, den ihnen anvertrauten Kindern einen sinnvollen Umgang mit Medien nahe zu bringen. Wie wichtig das Ausbilden dieser Fähigkeiten und das Erwerben der Kenntnisse in diesem Bereich ist, kann durch die Tatsache, dass die Europäische Union digitale Kompetenz zu einer der acht Schlüsselkompetenzen zählt und von der Europäischen Kommission in ihrer "Digitalen Agenda" (Europäische Kommission, 2006 nachweislich eingefordert wird, erkannt werden. Studien, wie beispielsweise die 3. Oö. Kinder-Medien-Studie (Oö. Kinder-Medien-Studie, 2012 belegen, dass Kinder bereits vor dem Schuleintritt mit neuen Technologien und dem Internet Erfahrungen sammeln. Diese Erkenntnisse führen zur Fragestellung, welche Maßnahmen im schulischen Kontext gesetzt werden müssen, um SchülerInnen im Bereich der Medienbildung zu unterstützen und auf den individuellen und kollektiven Habitus im Bereich der Medienbildung einzugehen. Eine Arbeitsgruppe mit ExpertInnen (digi.komp, 2013a erstellte im Auftrag des Bundesministeriums für Unterricht, Kunst und Kultur zu diesem Zweck einen Referenzrahmen für digitale Kompetenzen für SchülerInnen des Primarbereichs. Dieses digitale Kompetenzmodell mit zahlreichen Anwendungsbeispielen ermöglicht allen SchulpartnerInnen in Österreich eine Orientierung beim Arbeiten mit "Neuen" Medien. Es soll SchülerInnen dazu befähigen, dass sie am Ende der vierten Schulstufe Kompetenzen im Bereich der ICT aufweisen.
TBT recommends : Doctor Rockit. Vitas
2005-01-01
Eksperimentaalse elektroonilise muusika produtsent Matthew Herbert oma Big Bändiga 5. märtsil Tallinnas Sakala keskuses. Vene laulja Vitase heliplaadi "The Songs of My Mother" esitluskontsertidest 14. märtsil Vilniuses, 19. märtsil Riias ja 20. märtsil Tallinnas Vene Kultuurikeskuses
Experimental Physical Sciences Vitae 2017
Energy Technology Data Exchange (ETDEWEB)
Kippen, Karen Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Del Mauro, Diana [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Patterson, Eileen Frances [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Fronzak, Hannah Kristina [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Cruz, James Michael [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kramer, Robert W. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Martin, Genevieve [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Robinson, Richard Cecil [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Trujillo, Carlos Genaro [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Valdez, Sandra M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-01-18
Frequently our most basic research experiments stimulate solutions for some of the most intractable national security problems, such as nuclear weapons stewardship, homeland security, intelligence and information analysis, and nuclear and alternative energy. This publication highlights our talented and creative staff who deliver solutions to these complex scientific and technological challenges by conducting cutting-edge multidisciplinary physical science research.
Collaborative Undergraduate HBCU Student Summer Prostate Cancer Training Program
2010-03-01
Maternal Morbidity & Mortality Infant Mortality & Low Birth Weight Immunizations children and adult Asthma STD’s including HIV Cancer Obesity Diabetes...TA, co-taught, or taught. “Course of Life” is the Latin translation of Curriculum Vitae. Tips on Preparing a Curriculum Vitae (CV) Conference...is the most common non-skin cancer in America , and affects 1 in 6 men. In 2009, more than 192,000 men will be diagnosed with prostate cancer, and
Ibi et cor tuum: The Twin Perils of Studium and Otium in English Renaissance Intellectual Culture
Obi, Gertrude
2016-01-01
My dissertation, “Ibi et cor tuum: The Twin Perils of Studium and Otium in English Renaissance Intellectual Culture,” investigates the ways in which the temptations posed by intellectual labor were conceptualized and navigated by English Renaissance humanists. The competition pitting the vita activa against the vita contemplativa, which every age—including ours—must resolve anew, generated a spate of writings engaging with the mixed legacy of classical and medieval Christian attitudes towards...
Directory of Open Access Journals (Sweden)
Shuang Rong
2015-12-01
Full Text Available Aiming to relieve the large amount of wind power curtailment during the heating period in the North China region, a thermal-electric decoupling (TED approach is proposed to both bring down the constraint of forced power output of combined heat and power plants and increase the electric load level during valley load times that assist the power grid in consuming more wind power. The operating principles of the thermal-electric decoupling approach is described, the mathematical model of its profits is developed, the constraint conditions of its operation are listed, also, an improved parallel conjugate gradient is utilized to bypass the saddle problem and accelerate the optimal speed. Numerical simulations are implemented and reveal an optimal allocation of TED which with a rated power of 280 MW and 185 MWh heat storage capacity are possible. This allocation of TED could bring approximately 16.9 billion Yuan of economic profit and consume more than 80% of the surplus wind energy which would be curtailed without the participation of TED. The results in this article verify the effectiveness of this method that could provide a referential guidance for thermal-electric decoupling system allocation in practice.
Understanding and controlling transient enhanced dopant diffusion in silicon
International Nuclear Information System (INIS)
Stolk, P.A.; Gossmann, H.J.; Eaglesham, D.J.; Jacobson, D.C.; Poate, J.M.; Luftman, H.S.
1995-01-01
Implanted B and P dopants in Si exhibit transient enhanced diffusion (TED) during initial annealing which arises from the excess interstitials generated by the implant. In order to study the mechanisms of TED, the authors have used B doping marker layers in Si to probe the injection of interstitials from near-surface, non-amorphizing Si implants during annealing. The in-diffusion of interstitials is limited by trapping at impurities and has an activation energy of ∼3.5 eV. Substitutional C is the dominant trapping center with a binding energy of 2--2.5 eV. The high interstitial supersaturation adjacent to the implant damage drives substitutional B into metastable clusters at concentrations below the B solid solubility limit. Transmission electron microscopy shows that the interstitials driving TED are emitted from {311} defect clusters in the damage region at a rate which also exhibits an activation energy of 3.6 eV. The population of excess interstitials is strongly reduced by incorporating substitutional C in Si to levels of ∼10 19 /cm 3 prior to ion implantation. This provides a promising method for suppressing TED, thus enabling shallow junction formation in future Si devices through dopant implantation
Track-etched detectors for the dosimetry of the radiation of cosmic origin
International Nuclear Information System (INIS)
Spurny, F.; Turek, K.
2004-01-01
Cosmic rays contribute to the exposure on the Earth's surface as well as in its surroundings. At the surface and/or at aviation altitudes, there are mostly secondary particles created through the cosmic rays interaction in the atmosphere, which contribute to this type of exposure. Onboard a spacecraft, the exposure comes mostly from primary cosmic rays. Track-etched detectors (TED) are able to characterise both these types of exposure. The contribution of neutrons, of cosmic origin, on the Earth's surface was studied at altitudes from few hundreds to 3000 m using TED in a moderator sphere. The results obtained are compared with other data on this type of natural radiation background. The results of studies performed onboard aircraft and/or spacecraft are presented afterwards. We used TED-based neutron dosemeter, as well as a spectrometer of linear energy transfer based on a chemically etched TED. The results of studies performed onboard aircraft, as well as spacecraft, are presented and discussed, including an attempt to estimate a neutron component onboard the spacecraft. It was found that they correlate with the results of other independent investigations. (authors)
Tracce di sé: il rito del commiato laico tra commemorazione e narrazione
Directory of Open Access Journals (Sweden)
Marina Brancato
2006-09-01
Full Text Available Far risuonare la situazione luttuosa in un valore di memoria, in un valore morale: valorizzare le sfumature, la ricchezza e la pluralità delle esperienze e di insegnamenti che abbiamo ricevuto in quel meraviglioso e variegato percorso che è la nostra vita. La profonda esigenza di un rito volto a commemorare la persona quale era in vita risponde alla cultura della nostra epoca, attribuendo in tal modo un'importanza nodale all'individualità di ciascuno.
Il rischio tecnologico vantaggi e svantaggi del progresso scientifico
Lewis, H W
1995-01-01
I rischi della vita ; misurare il rischio ; la percezione del rischio ; la politica del rischio ; la valutazione del rischio ; la gestione del rischio ; il valore della vita ; qual è il livello "sufficiente" di sicurezza? ; incertezza, causalità, rilevabilità ; le delusioni della cautela ; sostanze chimiche tossiche ; sostanze chimiche cancerogene ; sicurezza sulle autostrade ; trasporto aereo ; radiazioni ionizzanti ; conbustibili fossili ; l'inverno nucleare ; radiazioni non ionizzanti ; quanto basta di statistica e di teoria delle probabilità ; epilogo : cosa significa tutto questo?.
Gold, Katherine G; Scofield, Stacy; Isaacson, Steven R; Stewart, Michael W; Kazim, Michael
To evaluate the effectiveness of orbital radiotherapy (ORT) in the treatment of thyroid eye disease (TED)-compressive optic neuropathy. A retrospective review of patients with corticosteroid-responsive compressive optic neuropathy due to TED treated with ORT. Study was conducted in compliance with Health Insurance Portability and Accountability Act. One hundred four patients (163 orbits) with a mean age of 61.7 years met inclusion criteria. Seventy-four percent (77/104) were female, and 32.7% (34/104) were current or previous smokers. A total absorbed dose of 2000 cGy fractionated in 10 treatment doses over the course of 2 weeks was administered to the retroocular tissues according to a standard protocol. The primary end point was failure of ORT, defined as persistent optic neuropathy following completion of radiotherapy that mandated urgent orbital decompression surgery. Ninety-eight of 104 (94%) patients or 152 of 163 (93.3%) orbits did not require orbital decompression surgery during the acute phase. Patients who responded successfully to ORT had similar improvements in visual acuity, color vision, Humphrey threshold visual field testing, and afferent pupillary defects compared with patients who failed ORT and underwent urgent decompression surgery. Only 36.7% of successfully treated patients ultimately underwent elective surgery, including orbital decompression, strabismus, or eyelid surgery, during the inactive phase of TED. The data from this study, the largest retrospective review reported to date, supports the use of ORT in eyes with corticosteroid-responsive TED-compressive optic neuropathy. ORT may favorably alter the natural history of active-phase TED by preventing recurrent compressive optic neuropathy after withdrawal of corticosteroids.
EFFICIENCY OF THE USE OF AUTHENTIC WEB-RESOURCES IN TRANSLATORS TRAINING
Iryna M. Drobit; Nataliia V. Rak
2013-01-01
The article deals with pedagogical assumptions and efficiency of the use of Information and Communication Technologies, especially authentic web-resources, while teaching language for specific purposes (translators and interpreters). Accuracy, content, and functionality of web-resource TED, which contains examples of authentic speech in English, have been outlined. It has been demonstrated that usage of multimedia and communication facilities of the TED web-resource provides favourable opport...
Inherently Offensive: Airpower and the Dialectic with Defense
2017-06-01
detailed definition up front. Ted Hopf, writing in The American Political Science Review, argues, “the offense-defense balance consists of three elements...technology contributed to air power’s ability to maintain overwhelming offensive 12 Hopf, Ted . "Polarity...fighters and surface-to-air missile systems. John Patterson explains why this is true, “most fighter aircraft operate in the X - and Ku-bands because
75 FR 44144 - Washington: Final Authorization of State Hazardous Waste Management Program Revisions
2010-07-28
...)(c)(ix)(K), 400(3)(c)(ix)(L), 400(3)(c)(x), 400(3)(c)(xi)(A), 400(3)(c)(xii)(B), 400(3)(a)(xiii), 400.... definition--Upda ted to match Federal rule. 040 Staging Pile 260.10. definition--Upda ted to match Federal... test methods to latest revision date. 110(3)(g)(x) Duplicate deleted 260.11(15). [see 110(3)(g)(vii...
ENVIRONMENT AND AMPHIBIAN DISTRIBUTION IN ZULULAND ...
African Journals Online (AJOL)
Although the fauna of north-eastern Zululand has yet to be fully surveyed, our present knowledge shows that this area is populated by an essentially East African ... b in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted. 2010). .... The tropical flora becomes impoverished and progressively replaced to the.
Stability of metal organic frameworks and interaction of small gas molecules in these materials
Tan, Kui
The work in this dissertation combines spectroscopy ( in-situ infrared absorption and Raman), powder X-ray diffraction and DFT calculations to study the stability of metal organic frameworks materials (MOFs) in the presence of water vapor and other corrosive gases (e.g., SO 2, NO2 NO), and the interaction and competitive co-adsorption of several gases within MOFs by considering two types of prototypical MOFs: 1) a MOF with saturated metal centers based on paddlewheel secondary building units: M(bdc)(ted)0.5 [M=Cu, Zn, Ni, Co, bdc = 1,4-benzenedicarboxylate, ted = triethylenediamine], and 2) a MOF with unsaturated metal centers: M2(dobdc) [M=Mg2+, Zn2+, Ni2+, Co2+ and dobdc = 2,5-dihydroxybenzenedicarboxylate]. We find that the stability of MOFs to water vapor critically depends on their structure and the specific metal cation in the building units. For M(bdc)(ted)0.5, the metal-bdc bond is the most vulnerable for Cu(bdc)(ted)0.5, while the metal-ted bond is first attacked for the Zn and Co analogs. In contrast, Ni(bdc)(ted)0.5 remains stable under the same conditions. For M2(dobdc), or MOF-74, the weak link is the dobdc-metal bond. The water molecule is dissociatively adsorbed at the metal-oxygen group with OH adsorption directly on the metal center and H adsorption on the bridging O of the phenolate group in the dobdc linker. Other technologically important molecules besides water, such as NO, NO2, SO2, tend to poison M2(dobdc) through dissociative or molecular adsorption onto the open metal sites. A high uptake SO2 capacity was measured in M(bdc)(ted)0.5, attributed to multipoint interactions between the guest SO2 molecule and the MOF host. In the case of competitive co-adsorption between CO2 and other small molecules, we find that binding energy alone is not a good indicator of molecular site occupation within the MOF (i.e., it cannot successfully predict and evaluate the displacement of CO2 by other molecules). Instead, we show that the kinetic barrier for the
US progress on the development of CR-39 based neutron dosimeters
International Nuclear Information System (INIS)
Hadlock, D.E.
1987-06-01
Historically at US nuclear facilities, two types of personnel neutron dosimeters have been in routine use: nuclear track emulsion-Type A (NTA) film and thermoluminescent dosimeter (TLD)-albedo. Both of these dosimeters have energy-dependent responses. Therefore, the neutron energy spectra must be known, to interpret the dosimeter results properly. A new state-of-the-art dosimetry system has been developed within the US Department of Energy (US DOE) Personnel Neutron Dosimeter Evaluation and Upgrade Program. This system is called the combination thermoluminescent dosimeter/track etch dosimeter (TLD/TED). This paper briefly describes US DOE research currently being conducted to further enhance the TED portion of the combination TLD/TED system. The research areas involved include dose sensitivity, neutron energy range, specialized radiators, self-developing dosimeters, and neutron spectrometry. 1 fig., 1 tab
Computer-aided design of broad band reflection type amplifiers
DEFF Research Database (Denmark)
Hammershaimb, Edgar; Jeppesen, Palle; Schjær-Jacobsen, Hans
1974-01-01
Microwave negative resistance reflection type amplifiers using stable transferred electron devices (TED's) are optimized by numerical optimization techniques programmed for an interactive graphic datascreen. The small signal impedance of packaged TED's is measured on an automatic network analyzer....... At the same time the impedance of unpackaged devices are obtained by on-line correction for the package parasitics. The microwave circuit chosen is a multiple slug coaxial cavity, that is modelled by sections of lossy transmission lines including step susceptances. The measured small signal impedance...... of the packaged TED's and the cavity model are used in a direct optimization procedure, in which the calculated minimum gain in the prescribed frequency range is progressively maximized by adjusting the lengths, characteristic impedances and positions of the slugs. The computed results are displayed...
[Comparison of machinability of two types of dental machinable ceramic].
Fu, Qiang; Zhao, Yunfeng; Li, Yong; Fan, Xinping; Li, Yan; Lin, Xuefeng
2002-11-01
In terms of the problems of now available dental machinable ceramics, a new type of calcium-mica glass-ceramic, PMC-I ceramic, was developed, and its machinability was compared with that of Vita MKII quantitatively. Moreover, the relationship between the strength and the machinability of PMC-I ceramic was studied. Samples of PMC-I ceramic were divided into four groups according to their nucleation procedures. 600-seconds drilling tests were conducted with high-speed steel tools (Phi = 2.3 mm) to measure the drilling depths of Vita MKII ceramic and PMC-I ceramic, while constant drilling speed of 600 rpm and constant axial load of 39.2 N were used. And the 3-point bending strength of the four groups of PMC-I ceramic were recorded. Drilling depth of Vita MKII was 0.71 mm, while the depths of the four groups of PMC-I ceramic were 0.88 mm, 1.40 mm, 0.40 mm and 0.90 mm, respectively. Group B of PMC-I ceramic showed the largest depth of 1.40 mm and was statistically different from other groups and Vita MKII. And the strength of the four groups of PMC-I ceramic were 137.7, 210.2, 118.0 and 106.0 MPa, respectively. The machinability of the new developed dental machinable ceramic of PMC-I could meet the need of the clinic.
Awuni, Victoria; Alhassan, Martha Wunnam; Amagloh, Francis Kweku
2017-01-01
Abstract Refining food recipes with orange‐fleshed sweet potato (OFSP) has the potential to improve dietary intake of vitamin A. The objectives of this study were to utilize OFSP in the development of two composite bread types and to assess their contribution to dietary intake of vitamin A using the dietary reference intake of lactating mothers. Two composite OFSP–wheat flour bread recipes—vita butter bread and vita tea bread—were developed by incorporating 46% OFSP puree in existing 100% whe...
Zoology Department, University of Cape Town
African Journals Online (AJOL)
Patella coneolor occurs on the east coast of South Africa and predominates in the baJanoid ... the cold west coast fauna is distinct from the warmer south coast element and the ... in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted. 2010). ..... The constitution of the intertidal fauna and flora of South Mrica.
Some studies of lead and iron adsorption on the W(100) surface by field emission microscopy
International Nuclear Information System (INIS)
Jones, J.P.; Roberts, E.W.
1978-01-01
The behaviour of lead and iron adsorbed on the W(100) surface has been studied by probe hole field emission microscopy, field desorption, and by measurement of the total energy distribution (TED) of field-emitted electrons. Lead adsorbed at 300 K which reduces the work function of W(100) can be completely removed at 78 K by field desorption below 3.2 V A -1 and the resulting surface has both the work function and TED, which are characteristic of the clean plane. Condensation at 800 K followed by field desorption, results in a plane surface of work function 4.17 eV and an altered TED. This effect is attributed to the microfacetting, which is observed by LEED. The Swanson peak in the W(100) TED which is removed by submonolayer amounts of lead re-emerges at monolayer coverage when lead adopts the (1 X 1) structure. Such behaviour is consistent with the model proposed by Kar and Soven. A spectral peak observed when lead is adsorbed on the reconstructed W(100) surface is thought to derive for the atomic 1 D state. Adsorption of iron on a W(100) surface reduces phi considerably due to dipole formation and efficiently quenches the Swanson peak. (Auth.)
DEFF Research Database (Denmark)
Milana, Marcella
Education policies stress the need for all individuals to acquire and develop Life Skills in order to handle the complexity of modern life. Everyday Problem Solving is one of these skills. What are the implications for educationalists and researchers engaged in defining, measuring and supporting ...
DEFF Research Database (Denmark)
Milana, Marcella
Education policies stress the need for all individuals to acquire and develop Life Skills in order to handle the complexity of modern life. Everyday Problem Solving is one of these skills. What are the implications for educationalists and researchers engaged in defining, measuring and supporting...... the development of Life Skills through Adult Education? The book, based on a Ph.D. study, investigate these questions. Volume I introduces the theoretical framework while Volume II presents two empirical studies on the identification and assessment of Everyday Problem Solving Skills....
Nonlinear optical properties of systems based on ruthenium(II) tetra-15-crown-5-phthalocyaninate
International Nuclear Information System (INIS)
Grishina, A.D.; Gorbunova, Yu.G.; Enakieva, Yu.Yu.; Krivenko, T.V.; Savel'ev, V.V.; Vannikov, A.V.; Tsivadze, A.Yu.
2008-01-01
The third-order nonlinear optical properties of the ruthenium (II) complex with tetra-15-crown-5-phthalocyanine and axially coordinated triethylenediamine molecules (R 4 Pc)Ru(TED) 2 were analyzed by means of the z-scanning technique. A solution of (R 4 Pc)Ru(TED) 2 in tetrachloroethane was exposed to nanosecond laser pulses at a wavelength of 1064 nm. It was found that the third-order molecular polarizability of the Ru(II) complex is 4.5 x 10 -32 cm 4 /C (esu). The polarizability per molecule increases by a factor of 3.6 when the single molecule occurs in a supramolecular assembly of (R 4 Pc)Ru(TED) 2 complexes. The photoelectric and photorefractive properties at 1064 nm of polymer composites, determined by the supramolecular assemblies that exhibits optical absorption and photoelectric sensitivity in the near IR region, are reported [ru
Short-range order parameters in amorphous YBaS4X7(X-S, SE, TE) films
International Nuclear Information System (INIS)
Hajiyev, E.S.
2005-01-01
Full text : Electron scattering intensity curves from amorphous YbAs 4 X 7 (X-S, SE, TE) films have ben obtained by the transmission electron diffraction (TED) method with rotation sector before screen up. The energy of electrons was 100 keV. Amorphous samples were crystallized and the composition of the products were measured by TED. The atomic radial distribution function has been calculated by the Fourier synthesis of intensities in the TED of amorphous YbAs 4 X 7 (X-S, SE, TE) films. The interatomic average distances of As - S (Se, Te) and As-Yb + 2 and partial coordination numbers have been estimated in these thilms. Based on these numbers, chemical orders in these films differ. This difference is due to differing topological order in the amorphous YbAs 4 X 7 (X-S, SE, TE) films
Larraín, Demetrio; Suárez, Francisco; Braun, Hernán; Chapochnick, Javier; Diaz, Lidia; Rojas, Iván
2018-06-05
To describe our experience with the multidisciplinary management of both thoracic/diaphragmatic endometriosis (TED), applying a broadened definition of the “thoracic endometriosis syndrome (TES)” to define cases. We present a retrospective series of consecutive patients affected by pathology-proven TED, treated at our institution, during a period of 7 years. Five women were included. Two cases were referred due to catamenial chest/shoulder pain, one due to recurrent catamenial pneumothorax, one due to new-onset diaphragmatic hernia. One patient had not thoracic symptoms, and diaphragmatic endometriosis was found during gynecologic laparoscopy for pelvic endometriosis. Endometriosis was histologically confirmed in all cases. After follow-up all patients remain asymptomatic. Broadened TES criteria could increase the incidence of TED and determine better knowledge of this condition. Multidisciplinary, minimally invasive surgery is effective and safe, but should be reserved to tertiary referral centers.
Toponimia: una preziosa eredità
Crivelli, Ruggero
2013-01-01
Nel 2008, Mauro Corona pubblica un libro il cui titolo è I fantasmi di pietra. In questo suo libro, l’autore racconta storie di vita del suo villaggio, Erto, nella regione del Vajont, distrutto dall’alluvione del 1963 e praticamente abbandonato da allora. Con il pretesto di una visita sui luoghi della sua infanzia, di cui non restano che le rovine delle case e delle piazze, lo scrittore si sofferma in questo o in quel luogo e racconta: racconta spezzoni di una vita passata i cui protagonisti ...
Studies on Mineralogy, Micromorphology and Relationships of
African Journals Online (AJOL)
ced b y Sa b in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted. 2012) ... Acrisols), Itogoro (Eutric G leysols, .... '43. 19. 38. 0.59. 9.4. 7.5. 1.3. 0.61. 10.64. 0.56. 42.3. 2.8. 31.1. 91. Ck3 ..... ified by Soil Survey Staff (1990) for.
Plasma proteins of Barbus holubi and Clarias gariepinus
African Journals Online (AJOL)
The supernatant fluids were subsequently examined by gel electrophoresis. Control experiments showed that the 3-hour exposure as such had no effect on the electrophoretogram. Zoo/oglca A!ricana 9(2):185-193 (1974). 185. R ep ro d u ced b y Sa b in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted.
distributional trends of four species of freshwater snails in south ...
African Journals Online (AJOL)
rivers. Topographically it is divided into an interior plateau and a diversified tract of country. • Paper read at Symposium on Malacology and Parasitology, Copenhagen, Denmark, August 1965. Zoologica Africana 2 (1): 95-109. 95. R ep rod u ced b y Sa b in et G a tew a. y u n d er licen ce gra n ted b y th e P u b lish er (d a ted.
Network-Capable Application Process and Wireless Intelligent Sensors for ISHM
Figueroa, Fernando; Morris, Jon; Turowski, Mark; Wang, Ray
2011-01-01
Intelligent sensor technology and systems are increasingly becoming attractive means to serve as frameworks for intelligent rocket test facilities with embedded intelligent sensor elements, distributed data acquisition elements, and onboard data acquisition elements. Networked intelligent processors enable users and systems integrators to automatically configure their measurement automation systems for analog sensors. NASA and leading sensor vendors are working together to apply the IEEE 1451 standard for adding plug-and-play capabilities for wireless analog transducers through the use of a Transducer Electronic Data Sheet (TEDS) in order to simplify sensor setup, use, and maintenance, to automatically obtain calibration data, and to eliminate manual data entry and error. A TEDS contains the critical information needed by an instrument or measurement system to identify, characterize, interface, and properly use the signal from an analog sensor. A TEDS is deployed for a sensor in one of two ways. First, the TEDS can reside in embedded, nonvolatile memory (typically flash memory) within the intelligent processor. Second, a virtual TEDS can exist as a separate file, downloadable from the Internet. This concept of virtual TEDS extends the benefits of the standardized TEDS to legacy sensors and applications where the embedded memory is not available. An HTML-based user interface provides a visual tool to interface with those distributed sensors that a TEDS is associated with, to automate the sensor management process. Implementing and deploying the IEEE 1451.1-based Network-Capable Application Process (NCAP) can achieve support for intelligent process in Integrated Systems Health Management (ISHM) for the purpose of monitoring, detection of anomalies, diagnosis of causes of anomalies, prediction of future anomalies, mitigation to maintain operability, and integrated awareness of system health by the operator. It can also support local data collection and storage. This
Sonié, Sandrine; Kassai, Behrouz; Pirat, Elodie; Masson, Sandrine; Bain, Paul; Robinson, Janine; Reboul, Anne; Wicker, Bruno; Chevallier, Coralie; Beaude-Chervet, Véronique; Deleage, Marie-Hélène; Charvet, Dorothée; Barthélémy, Catherine; Rochet, Thierry; Tatou, Mohamed; Arnaud, Valérie; Manificat, Sabine
2011-04-01
No tools are currently available in France, for the detection of autism without mental retardation (high functioning autism and Asperger syndrome here referred as TED SDI). Use of screening tests by first-line clinicians would allow better detection of children who are likely to display such difficulties and to improve patients' care. In England, 3 questionnaires have been evaluated: Autism Spectrum Quotient (AQ), Empathy Quotient (EQ), and Systemizing Quotient (SQ). This is the translation and evaluation of 3 questionnaires in France for TED SDI and control adolescents. The translation of the questionnaires into French required two simultaneous translations, two back-translations and two consensus meetings. This is a cross-sectional study comparing scores obtained with the three AQ, EQ and SQ questionnaires. These questionnaires were completed by the parents of four groups of adolescents 11-18 years: 100 TED SDI adolescents (50 with IQ ≥ 85 and 50 with 70≤IQ<85), 50 adolescents with another psychiatric disorder (TP) and 200 control adolescents (T). 580 questionnaires have been sent to 40 recruiting centres. By the 28th of February, 2010, 277 completed questionnaires were received completed (TED SDI: 70 (70%); TP: 25 (50%) et T: 182 (91%)). In the control group, 92 girls (mean 14.4±1.7 years) and 66 boys (14.5±1.7 years) were recruited. In the TED SDI group, 4 girls (14.3±2.4 years) and 42 boys (14.5±1.7 years) were recruited. One girl (81) and 6 boys (72.2±7.7) have an IQ between 70 and 85, and 3 girls (95.3±4.2) and 36 boys (102.9±12) have an IQ higher than 85. In the TP group, 9 girls (15.9±1.7 years) and 4 boys (15.8±1.9 years) were recruited. The aim of this study is to make the AQ, EQ and SQ questionnaires available in French for French speaking clinicians. This study will allow a rigorous evaluation of the usefulness of the AQ questionnaire in the screening of TED SDI in adolescents. Copyright © 2010 Elsevier Masson SAS. All rights reserved.
McMillen, Robert; Shackelford, Signe
2012-10-01
There is no safe level of exposure to tobacco smoke. More than 60 Mississippi communities have passed smoke-free ordinances in the past six years. Opponents claim that these ordinances harm local businesses. Mississippi law allows municipalities to place a tourism and economic development (TED) tax on local restaurants and hotels/motels. The objective of this study is to examine the impact of these ordinances on TED tax revenues. This study applies a pre/post quasi-experimental design to compare TED tax revenue before and after implementing ordinances. Descriptive analyses indicated that inflation-adjusted tax revenues increased during the 12 months following implementation of smoke-free ordinances while there was no change in aggregated control communities. Multivariate fixed-effects analyses found no statistically significant effect of smoke-free ordinances on hospitality tax revenue. No evidence was found that smoke-free ordinances have an adverse effect on the local hospitality industry.
A trace display and editing program for data from fluorescence based sequencing machines.
Gleeson, T; Hillier, L
1991-12-11
'Ted' (Trace editor) is a graphical editor for sequence and trace data from automated fluorescence sequencing machines. It provides facilities for viewing sequence and trace data (in top or bottom strand orientation), for editing the base sequence, for automated or manual trimming of the head (vector) and tail (uncertain data) from the sequence, for vertical and horizontal trace scaling, for keeping a history of sequence editing, and for output of the edited sequence. Ted has been used extensively in the C.elegans genome sequencing project, both as a stand-alone program and integrated into the Staden sequence assembly package, and has greatly aided in the efficiency and accuracy of sequence editing. It runs in the X windows environment on Sun workstations and is available from the authors. Ted currently supports sequence and trace data from the ABI 373A and Pharmacia A.L.F. sequencers.
New Environmental Testing Capabilities at INTA
Olivo, Esperanza; Hernandez, Daniel; Garranzo, Daniel; Barandiaran, Javier; Reina, Manuel
2012-07-01
In this paper we aim to present and describe the facilities for aerospace environmental testing at INTA; the Spanish National Institute for Aerospace Technique with emphasis on the Thermal Vacuum testing facility with dimensions 4 m x 4 m x 4 m and a temperature range from +150oC to -175 oC and 10-6 vacuum conditions with the new Thermo Elastic Distortion (TED) measurement capability designed at INTA. It will be presented the validation data for the empty chamber, with specimens such a 3m diameter reflector and antenna towers for both, thermal cycling and TED measurements. For TED, it will be shown the feasibility study and the solution finally selected. Apart from those, it will be shown other complementary facilities for environmental testing such as 320 (2x160) kN dual shaker with a new 3 m x 3 m sliding table and other complementary facilities.
Upgrades to the SPS-to-LHC Transfer Line Beam Stoppers for the LHC High-Luminosity Era
Kain, Verena; Fraser, Matthew; Goddard, Brennan; Meddahi, Malika; Perillo Marcone, Antonio; Steele, Genevieve; Velotti, Francesco
2016-01-01
Each of the 3 km long transfer lines between the SPS and the LHC is equipped with two beam stoppers (TEDs), one at the beginning of the line and one close to the LHC injection point, which need to absorb the full transferred beam. The beam stoppers are used for setting up the SPS extractions and transfer lines with beam without having to inject into the LHC. Energy deposition and thermo-mechanical simulations have, however, shown that the TEDs will not be robust enough to safely absorb the high intensity beams foreseen for the high-luminosity LHC era. This paper will summarize the simulation results and limitations for upgrading the beam stoppers. An outline of the hardware upgrade strategy for the TEDs together with modifications to the SPS extraction interlock system to enforce intensity limitations for beam on the beam stoppers will be given.
Shams, Pari N; Ma, Roy; Pickles, Tom; Rootman, Jack; Dolman, Peter J
2014-06-01
To compare the risk of developing compressive optic neuropathy in patients with active thyroid eye disease (TED) treated with corticosteroids with or without orbital radiotherapy. Retrospective single-center case-control study. The clinical charts of 351 patients with active TED who received corticosteroids with or without orbital radiotherapy between 1999 and 2010 were reviewed. Patients with compressive optic neuropathy at the time of presentation were excluded. Group 1 received corticosteroids only and Group 2 received corticosteroids as well as orbital radiotherapy. The primary outcome measure was the development of compressive optic neuropathy. Secondary outcome measures were changes in other parameters indicating the activity of TED, including soft tissue inflammation, diplopia, ocular motility restriction, and appearance. There were 144 cases in Group 1 and 105 in Group 2. Both groups were matched for age, sex, and stability of thyroid function. The 2 groups differed only in the modality of treatment for active TED. The main indication for treatment in both groups was soft tissue inflammation. Corticosteroids were initiated an average of 2.6 months following symptom onset in Group 1 and 2.5 months in Group 2. Group 2 received orbital radiotherapy on average 4.2 months following the initiation of corticosteroid therapy and 8% (9/105) were intolerant to corticosteroids. At an average of 3.2 years follow-up, compressive optic neuropathy had developed in 17% (25/144) of Group 1 and 0% of Group 2 (P optic neuropathy was significantly lower and improvement in ocular motility greater in patients receiving orbital radiotherapy in addition to corticosteroids. Patients with active TED appear to have an effective and sustained response to orbital radiotherapy combined with corticosteroids that is protective against disease progression and the development of compressive optic neuropathy. Copyright © 2014 Elsevier Inc. All rights reserved.
Book review. Storie e geografie di un veterinario di campagna. Raffaele Mastrocola
Directory of Open Access Journals (Sweden)
Manuel Graziani
2013-12-01
Full Text Available Una raccolta di racconti, o meglio di "storie" ma anche di "geografie" riprendendo l'azzeccato titolo scelto dal dott. Raffaele Mastrocola per la sua prima opera di narrativa autobiografica. Racconti di vita professionale e squarci di vita rurale nel solco del veterinario-scrittore britannico James Herriot. Qui, però, non siamo nell'elegante campagna inglese bensì in quella abruzzese, forte, gentile e certamente più genuina. Tra aneddoti comici, un'ironia delicata e a tratti debordante, l'autore ci racconta la sua vita professionale circondata da clienti pittoreschi, per lo più anziani, di un'umanità rurale oramai quasi dimenticata, con un'attenzione nostalgica per il periodo dell'infanzia e la formazione universitaria a Bologna (compresi i "rapporti" telefonici con Vasco Rossi e le cene "Da Vito". Una lettura gradevole e, perché no, utile ai giovani veterinari che troveranno tra le pagine consigli su diagnosi e terapie convalidate attraverso una lunga esperienza condotta sul campo, anche a beneficio umano, come nel caso del sedano selvatico che l'autore definisce un "antibiotico naturale, un toccasana per le vie urinarie". Un altro racconto di particolare interesse è quello intitolato "Quel benedetto femore" con Mastrocola che narra con trasporto come è riuscito a trovare la soluzione ad un caso complesso non attingendo ad un manuale di scienza veterinaria, bensì ad un libro di narrativa di James Herriot, suo vero e proprio faro personale: "Ho sempre avuto simpatie per i racconti di vita professionale. Il mio grande ispiratore è stato James Herriott! Oggi a distanza di oltre trenta anni dall'inizio della mia attività, sento la necessità di condividere le mie esperienze, le mie emozioni ed i miei ricordi con altri. La miscellanea dei miei racconti è una raccolta di 'ricordi giovanili', vita professionale ed il diario di un mio viaggio in moto d'epoca fatto in Australia." Sì perché l'autore, tra i suoi mille interessi, ha anche
General aspects of anxiety manifestations in persons with musculoskeletal disorders
Directory of Open Access Journals (Sweden)
Vitaliy Bezsheiko
2018-06-01
Full Text Available Background. Sed vulputate luctus tortor, facilisis rutrum quam accumsan sed. Aenean nec aliquet nisl, convallis finibus elit. Suspendisse posuere neque eu euismod tempor. Curabitur eleifend massa vitae ex placerat gravida. Nam consequat magna eget elit dignissim consequat. Duis lacinia, libero eu eleifend interdum, ex lacus mattis urna, in dapibus nibh nibh id risus. Suspendisse potenti. Methods. Mauris ut nulla ante. Fusce pharetra aliquet neque, id efficitur ex consequat sit amet. Proin sollicitudin eu est at faucibus. Vivamus eu risus lacus. Ut nec orci vitae leo fermentum facilisis non blandit risus. Nunc non arcu ac neque sagittis malesuada. Duis quis mauris vitae lorem rutrum dapibus blandit at ipsum. Sed tortor nibh, aliquet et mauris a, pellentesque gravida arcu. Cras tristique nisi ultricies, gravida tortor quis, pretium metus. Results. Vivamus arcu ante, iaculis feugiat feugiat vitae, aliquam ac purus. Donec ex turpis, hendrerit vel ultricies id, iaculis a odio. Fusce congue pretium ante, in feugiat nulla elementum in. Donec turpis felis, porta ac tempus eget, accumsan nec libero. Etiam rutrum, tortor et varius bibendum, nisi dolor molestie lectus, volutpat euismod dui justo a diam. Aliquam sapien mauris, molestie a lacus a, fermentum suscipit nunc. Sed eros lectus, hendrerit sit amet aliquet sit amet, mollis vitae purus. Morbi urna nulla, ultrices id facilisis sit amet, placerat eget tellus. Proin semper nisi eget bibendum euismod. Proin dignissim in mauris vel accumsan. Sed nec sodales metus. Mauris suscipit erat sed dui consectetur auctor. Quisque eget ex tortor. In molestie, urna id ullamcorper sagittis, libero risus gravida massa, in efficitur sapien urna lacinia sem. Donec interdum libero at tempor auctor. Conclusion. Ut a lorem non libero semper euismod in ut tellus. Aenean aliquam congue enim nec porttitor. Ut mauris libero, auctor sed finibus ac, gravida et mauris. Nullam vel mattis tortor, sit amet vestibulum ipsum. Nulla
Lorem ipsum dolor sit amet, consectetur adipiscing elit
Directory of Open Access Journals (Sweden)
Vitaliy Bezsheiko
2018-06-01
Full Text Available Background. Sed vulputate luctus tortor, facilisis rutrum quam accumsan sed. Aenean nec aliquet nisl, convallis finibus elit. Suspendisse posuere neque eu euismod tempor. Curabitur eleifend massa vitae ex placerat gravida. Nam consequat magna eget elit dignissim consequat. Duis lacinia, libero eu eleifend interdum, ex lacus mattis urna, in dapibus nibh nibh id risus. Suspendisse potenti. Methods. Mauris ut nulla ante. Fusce pharetra aliquet neque, id efficitur ex consequat sit amet. Proin sollicitudin eu est at faucibus. Vivamus eu risus lacus. Ut nec orci vitae leo fermentum facilisis non blandit risus. Nunc non arcu ac neque sagittis malesuada. Duis quis mauris vitae lorem rutrum dapibus blandit at ipsum. Sed tortor nibh, aliquet et mauris a, pellentesque gravida arcu. Cras tristique nisi ultricies, gravida tortor quis, pretium metus. Results. Vivamus arcu ante, iaculis feugiat feugiat vitae, aliquam ac purus. Donec ex turpis, hendrerit vel ultricies id, iaculis a odio. Fusce congue pretium ante, in feugiat nulla elementum in. Donec turpis felis, porta ac tempus eget, accumsan nec libero. Etiam rutrum, tortor et varius bibendum, nisi dolor molestie lectus, volutpat euismod dui justo a diam. Aliquam sapien mauris, molestie a lacus a, fermentum suscipit nunc. Sed eros lectus, hendrerit sit amet aliquet sit amet, mollis vitae purus. Morbi urna nulla, ultrices id facilisis sit amet, placerat eget tellus. Proin semper nisi eget bibendum euismod. Proin dignissim in mauris vel accumsan. Sed nec sodales metus. Mauris suscipit erat sed dui consectetur auctor. Quisque eget ex tortor. In molestie, urna id ullamcorper sagittis, libero risus gravida massa, in efficitur sapien urna lacinia sem. Donec interdum libero at tempor auctor. Conclusion. Ut a lorem non libero semper euismod in ut tellus. Aenean aliquam congue enim nec porttitor. Ut mauris libero, auctor sed finibus ac, gravida et mauris. Nullam vel mattis tortor, sit amet vestibulum ipsum. Nulla
The curriculum vitae: gateway to academia.
Christenbery, Tom L
2014-01-01
A CV serves as formal documentation of the applicant’s career path and provides necessary demographic and historical information for career change or advancement. Therefore, each section of the CV should be a thorough accounting of the applicant’s academic, work, and professional responsibilities and attainments. The guidelines in this column also are relevant for nurse educators applying for positions in schools of nursing.
Alfred Kubin: un sognatore a vita
Directory of Open Access Journals (Sweden)
Simona Argentieri
2010-12-01
Full Text Available Il saggio considera l’opera grafica e narrativa di Alfred Kubin (1877-1959, artista boemo ai margini del movimento espressionista, che con i suoi scritti fantastici e i suoi disegni onirici ha suscitato infiniti spunti di interpretazione psicologica. Secondo l’autrice, la qualità e l’originalità delle creazioni di Kubin non si può però cercare nella decifrazione simbolica dei contenuti, considerandoli a priori spie di materiali psichici profondi sgorgati dall’inconscio. Più interessante semmai tentare di far ordine tra i diversi livelli di intenzionalità e di coscienza che si intrecciano nelle sue creazioni. Freud e Kubin sono contemporanei; vivono entrambi nel cuore della mitteleuropa, parlano la stessa lingua, respirano lo stesso fervido clima culturale, ma si sono reciprocamente ignorati. Le loro differenze sono irriducibili fin dal piano teorico, poiché per Freud il sogno è solo la via -sia pure regia- per scrutare l’inconscio, ma è in sé materia bruta, ipoevoluta. Per Kubin invece è un fenomeno ipervalutato, un principio creativo autonomo e superiore, quasi metafisico. E’ invece profondamente aderente al più moderno spirito psicoanalitico il metodo secondo il quale Kubin dice come vorrebbe essere guardato: “Il vero fruitore, così come io lo desidero, dovrà guardare i miei fogli non solo apprezzandoli e criticandoli, ma come animato da sensazioni segrete, dovrebbe rivolgere la sua attenzione anche alla ricchissima camera oscura della propria coscienza onirica.” Cioè, detto nei nostri più attuali termini psicoanalitici, lo “spazio transizionale” dell’opera è abitato da artista e fruitore, che vi attribuiscono significati potenzialmente infiniti, più o meno condivisi, ma che comunque nell’incontro con l’altro acquistano senso attivando circuiti sinestetici affettivi e cognitivi.
Forme di vita e relazione educativa
Directory of Open Access Journals (Sweden)
Viviana Segreto
2015-05-01
Full Text Available The aim of this paper is to show that the main object of pedagogical research is relationship among people who share the same context. The analysis follows a linguistic approach, from a theoretical and metaphysical kind of language to a language of forms of life. After the linguistic turn, particularly in Ludwig Wittgenstein, forsaking a Platonic language means throwing language in forms of life, and blending it with people and their lives. So an educational process has to leave the unique, traditional pattern to open itself to different voices of life.
Ars longa, vita brevis... / Leelo Tamm
Tamm, Leelo
1998-01-01
16. veebr. 1998 avati Aegviidu rahvamajas maalikunstnik Valdur Ohaka 65 taiesest koosnev õlimaalide näitus, kus on töid aastaist 1943-1998. Samal päeval asus manalateele teoste looja. Aegviidu olulisusest Valdur Ohaka jaoks. Kunstniku viimastest maalidest.
Vita contemplativa: a life in part
Clegg, S.R.
2005-01-01
Life, art and science are irremediably intertwined: how, where and with whom one shares the brief moments of existence necessarily affect what one thinks, how one writes, and what one will address. Being a scholar is a vocation, as Weber knew only too well, in which science, ethics and art blend;
Vita e morte sulla scena invisibile
Directory of Open Access Journals (Sweden)
Caporale Mariangela
2013-06-01
Full Text Available “The scene of the woman who is the clarity of death. The theatre of the maid who is the mistery of life”: this is the axis the article focuses on. Through the analysis of two dance performances – Praeparatio mortis by Jan Fabris and Kore by Virgilio Sieni – the article examines the nature of knowledge conceived as ideal vision of the truth. The reflection on life and death’s dance allows to criticize this approach, clarifying the limits of an epistemology that sclerotizes the philosophy as knowledge that is astonished before the truth. These are the limits of the science that derive from this epistemological tradition. The exemplar condition to know the being as the existence of the simply existent (Schelling is the experience of the childbirth and maternity. Finally the article criticizes the scientific model that exalts every kind of artificial fecundation believed as the perfect opportunity to fulfill completely women’s freedom and her dignity.
Pandie, Zaahid; Shepherd, Mike; Lamont, Tony; Walsh, Mark; Phillips, Mark; Page, Colin
2010-08-01
Paediatric patients with suspected cervical spine injury (CSI) are routinely immobilised on a firm surface using a hard collar, which results in excessive flexion of the cervical spine due to the relatively large size of the occiput. The objective of this study was to determine whether the use of a thoracic elevation device (TED) results in a more neutral cervical spine position and reduces the occurrence of cervical spine hyperflexion. A prospective cohort study was conducted at two Emergency Departments (sites A and B) from January 2006 to May 2007. Children TED and those at site B did not. x-Rays from both sites were analysed for flexion, extension or neutrality of the cervical spine as defined by the Cobb angle. A total of 76 patients were identified at site A and site B. There were four exclusions at each site for poor quality images. 51 patients in the site A group were found to be in neutral position (71%), compared to 29 patients in the site B group (43%) (p=0.001). One patient (1%) who had a TED was found to be hyperflexed (>10 degrees), whereas 12 (18%) patients at site B were hyperflexed (p=0.001). The use of a TED appears to produce a greater proportion of neutral cervical spine films in children < or =10 years of age presenting for suspected CSI.
Differential Colonization Dynamics of Cucurbit Hosts by Erwinia tracheiphila.
Vrisman, Cláudio M; Deblais, Loïc; Rajashekara, Gireesh; Miller, Sally A
2016-07-01
Bacterial wilt is one of the most destructive diseases of cucurbits in the Midwestern and Northeastern United States. Although the disease has been studied since 1900, host colonization dynamics remain unclear. Cucumis- and Cucurbita-derived strains exhibit host preference for the cucurbit genus from which they were isolated. We constructed a bioluminescent strain of Erwinia tracheiphila (TedCu10-BL#9) and colonization of different cucurbit hosts was monitored. At the second-true-leaf stage, Cucumis melo plants were inoculated with TedCu10-BL#9 via wounded leaves, stems, and roots. Daily monitoring of colonization showed bioluminescent bacteria in the inoculated leaf and petiole beginning 1 day postinoculation (DPI). The bacteria spread to roots via the stem by 2 DPI, reached the plant extremities 4 DPI, and the plant wilted 6 DPI. However, Cucurbita plants inoculated with TedCu10-BL#9 did not wilt, even at 35 DPI. Bioluminescent bacteria were detected 6 DPI in the main stem of squash and pumpkin plants, which harbored approximately 10(4) and 10(1) CFU/g, respectively, of TedCu10-BL#9 without symptoms. Although significantly less systemic plant colonization was observed in nonpreferred host Cucurbita plants compared with preferred hosts, the mechanism of tolerance of Cucurbita plants to E. tracheiphila strains from Cucumis remains unknown.
2015-02-16
Elon Musk , the well-known founder of Tesla and Space-X. His life’s work focuses on developing the means to find and get to...nat_arctic_strategy.pdf 58. Elon Musk , “ Elon Musk -The man behind Tesla, Space X, Solar City…” (Filmed February 2013, TED video, 21:04. Posted March 2013) https...Exploitation. London, UK: Reaktion Books Ltd., 2012. Musk , Elon . “ Elon Musk -The man behind Tesla, Space X, Solar City…” Filmed February 2013, TED
Roughness, surface energy, and superficial damages of CAD/CAM materials after surface treatment.
Strasser, Thomas; Preis, Verena; Behr, Michael; Rosentritt, Martin
2018-02-05
The aim of this study was to examine the effects of surface pre-treatment on CAD/CAM materials including ceramics, zirconia, resin-infiltrated ceramic, and resin-based composite. Specimens were made of ten CAD/CAM materials (Celtra Duo, Degudent, D; Vita Suprinity, Vita, D; E.max CAD, Ivoclar-Vivadent, FL; E.max ZirCAD, Ivoclar-Vivadent, FL; Vita Enamic, Vita, D; Cerasmart, GC, B; LAVA Ultimate, 3M, D; SHOFU Block HC, SHOFU, US; Grandio Blocs, VOCO, D; BRILLIANT Crios, Coltene, CH) and pretreated to represent clinical procedures (Hf 20 s/5%; phosphoric acid 20 s/37%; Monobond etch and prime (Ivoclar-Vivadent, FL); water-cooled diamond bur (80 μm; 4 μm); Al 2 O 3 -blasting (50 μm/1 bar, 50 μm/2 bar, 120 μm/1 bar, 120 μm/2 bar); untreated; manufacturer's instructions). SEM-analysis (Phenom, FEI, NL) of the surfaces was performed (magnifications ≤ 10,000×). Roughness values R a , R z (KJ 3D, Keyence, J), and surface energy SE (OCA15 plus, SCA20, DataPhysics, D) were determined (statistics: non-parametric Mann-Whitney U test/Kruskal-Wallis test for independent specimen, α = 0.05). Kruskal-Wallis revealed significant (p CAD/CAM materials require individual pre-treatment for optimized and protective surface activation. Cementation is a key factor for clinical success. Given the variety of available CAD/CAM materials, specific procedures are needed.
Serum total IgG and IgG4 levels in thyroid eye disease
Directory of Open Access Journals (Sweden)
Sy A
2016-10-01
Full Text Available Aileen Sy, Rona Z Silkiss Department of Ophthalmology, California Pacific Medical Center, San Francisco, CA, USA Purpose: To investigate the relationship between immunoglobulin G (IgG4-related disease (IgG4-RD and thyroid eye disease (TED with respect to IgG levels. Patients and methods: A retrospective review of total IgG, IgG subclass, and thyroid stimulating immunoglobulin (TSI levels in 24 patients with TED. Results: Five patients (20.8% demonstrated serum IgG4 levels consistent with IgG4-RD without any additional systemic disease. Total IgG and IgG subclass levels were found to be an inadequate proxy for TSI elevation. Conclusion: There may be a subtype of TED patients with elevated IgG4 in the absence of IgG4-RD systemic findings. Keywords: thyroid eye disease, IgG subclass, IgG4, Graves’ disease, Graves’ ophthalmopathy, IgG4-RD
Ngau, Julie L.; Griffin, Peter B.; Plummer, James D.
2001-08-01
Recent work has indicated that the suppression of boron transient enhanced diffusion (TED) in carbon-rich Si is caused by nonequilibrium Si point defect concentrations, specifically the undersaturation of Si self-interstitials, that result from the coupled out-diffusion of carbon interstitials via the kick-out and Frank-Turnbull reactions. This study of boron TED reduction in Si1-x-yGexCy during 750 °C inert anneals has revealed that the use of an additional reaction that further reduces the Si self-interstitial concentration is necessary to describe accurately the time evolved diffusion behavior of boron. In this article, we present a comprehensive model which includes {311} defects, boron-interstitial clusters, a carbon kick-out reaction, a carbon Frank-Turnbull reaction, and a carbon interstitial-carbon substitutional (CiCs) pairing reaction that successfully simulates carbon suppression of boron TED at 750 °C for anneal times ranging from 10 s to 60 min.
International Nuclear Information System (INIS)
Ngau, Julie L.; Griffin, Peter B.; Plummer, James D.
2001-01-01
Recent work has indicated that the suppression of boron transient enhanced diffusion (TED) in carbon-rich Si is caused by nonequilibrium Si point defect concentrations, specifically the undersaturation of Si self-interstitials, that result from the coupled out-diffusion of carbon interstitials via the kick-out and Frank--Turnbull reactions. This study of boron TED reduction in Si 1-x-y Ge x C y during 750 o C inert anneals has revealed that the use of an additional reaction that further reduces the Si self-interstitial concentration is necessary to describe accurately the time evolved diffusion behavior of boron. In this article, we present a comprehensive model which includes {311} defects, boron-interstitial clusters, a carbon kick-out reaction, a carbon Frank--Turnbull reaction, and a carbon interstitial-carbon substitutional (C i C s ) pairing reaction that successfully simulates carbon suppression of boron TED at 750 o C for anneal times ranging from 10 s to 60 min. copyright 2001 American Institute of Physics
Increase of the electrical resistance of thin copper film due to 14 MeV neutron irradiation
International Nuclear Information System (INIS)
Agrawal, S.K.; Kumar, U.; Nigam, A.K.; Singh, S.P.
1981-01-01
The variation in the electrical resistance of thin copper film (500 A 0 thick), grown on the glass slide has been measured with increasing 14 MeV neutron irradiation time. The electrical resistance vs irradiation time curve shows an interesting behaviour after an irradiation of 40 minutes. However, there is a net increase in the electrical resistance with increasing neutron dose. The maximum increase in the observed electrical resistance after an irradiation of 115 mins, is 4.45%. The microstructural studies of irradiated film were made using TEM and TED techniques. The TEM patterns up to an irradiation time of 1.00 hr do not show any appreciable change in the microstructure. The TED patterns also do not show any appreciable change in the diffraction pattern up to an irradiation time of 1.0 hr. But after an irradiation time of 1.5 hrs, two extra rings appear in the TED pattern which disappear with increasing neutron irradiation time
Advances in the development of Cr-39 based neutron dosimeters
International Nuclear Information System (INIS)
Hadlock, D.E.; Parkhurst, M.A.
1987-12-01
A combination thermoluminescent dosimeter (TLD) and track etch dosimeter (TED), which can be used for detecting neutrons over a wide energy range, has been developed through recent research in passive neutron dosimetery. This dosimeter uses Li-600 TLDs to detect thermal and low energy neutrons reflected from the body, and the TED polymer of CR-39, to detect fast neutrons from proton recoil interactions with the polyethylene radiator or with CR-39 itself. Some form of the combination dosimeter is currently in use at several US Department of Energy (DOE) facilities, and its use is expected to expand over the next year to include all DOE facilities where significant neutron exposures may occur. The extensive research conducted on the TED component over the past six years has continually focused on material improvements, reduction in processing time and dosimeter handling, and ease of sample readout with the goal of automating the process as much as possible. 1 fig
Abha Eli Phoboo
2013-01-01
CERN hosted the second TEDx European Organisers meeting last week with around 80 organisers attending from all over Europe. They were given an introduction to CERN and a tour of the LHC experiments. The participants of the TEDx European Organisers meeting held at CERN last week. Among the attendees was Bruno Giussani, European director of TED, who delivered the welcome address. The TEDx European organisers shared their experiences in workshops and brainstormed about how to work on different aspects of organising a TEDx event, and about improving the relationship between TEDx and TED. “The goal of this meeting was for veteran TEDx organisers to help younger ones, help each other, bring the community together and have better quality events,” said Claudia Marcelloni, head of TEDxCERN. TEDx is an independently organised TED (Technology, Entertainment, Design) talk event, which has grown exponentially all over the world. There are hundreds of TEDx events every day and it n...
International Symposium for Thyroid Eye Disease (June 2016, London
Directory of Open Access Journals (Sweden)
Natalia Y. Sviridenko
2017-03-01
Full Text Available In June 2016, an International Symposium dedicated to the cutting edge research and achievements in Thyroid Eye Disease (TED diagnosis and treatment was held in London. The symposium was organized by the International Thyroid Eye Disease (ITEDs. It was attended EUGOGO, North American Neuro-Ophthalmological Society (NANOS and Orbit Society members. The symposium was attended by leading experts in the field of ophthalmology, orbital surgery and endocrinology: Rebecca S. Bahn, Maarten Mourits, Claudio Marcocci, George Kahaly, Mario Salvi, Antony Weetman, Anja Eckstein, Daniel Rootman, Geoffrey Rose, Robert Goldberg and Susanne Pitz, as well as doctors, specializing in the field of endocrinology, ophthalmology, radiology and other specialties. The symposium program was focused on the discussion of TED pathogenesis, classification and new therapeutic and surgical approaches. TED problems discussed by more than 300 professionals (65% ophthalmologists, 18% ophthalmic surgeons and 17% endocrinologists. North America was represented by 50 delegates. Representation of other continents was not less impressive.
Mitigation of Confined Explosion Effects by Placing Water in Proximity of Explosives
1992-08-01
fo rced conc re t e wa l l s and equlpment door; a s loped , f r a n g i b l e , cor ruga ted metal roof; and a smal l a t t ached s t r...r b lanket a re shown i n F igure 1. b. Replace t h e e x i s t i n g cor ruga ted metal roof wi th a p r e c a s t , R/concrete roo f
1991-12-27
with deductive (Prolog-like) facilities. An interesting example of this architecture is POSTGRES , a further development of the DBMS INGRES (Post Ingres...15,16. POSTGRES is a tightly-coupled KBMS developed at the University of Southern California, Berkeley. The main aims of the project are to uphold...FI EDIUNLIMI TED q L UNC LASS I F I ED / UNL I M I TED B.2.5 ACI243(Panel 11)TP/1 The most revolutionary aspect of POSTGRES is the use of rules and
National Debate and Public Confidence in Sweden
International Nuclear Information System (INIS)
Lindquist, Ted
2014-01-01
Ted Lindquist, coordinator of the Association of Swedish Municipalities with Nuclear Facilities (KSO), closed the first day of conferences. He showed what the nuclear landscape was in Sweden, and in particular that through time there has been a rather good support from the population. He explained that the reason could be the confidence of the public in the national debate. On a more local scale, Ted Lindquist showed how overwhelmingly strong the support was in towns where the industry would like to operate long-term storage facilities
Directory of Open Access Journals (Sweden)
Katalin Susztak
2005-02-01
Full Text Available Diabetic nephropathy (DNP is a common complication of type 1 and type 2 diabetes mellitus and the most common cause of kidney failure. While DNP manifests with albuminuria and diabetic glomerulopathy, its progression correlates best with tubular epithelial degeneration (TED and interstitial fibrosis. However, mechanisms leading to TED in DNP remain poorly understood.We found that expression of scavenger receptor CD36 coincided with proximal tubular epithelial cell (PTEC apoptosis and TED specifically in human DNP. High glucose stimulated cell surface expression of CD36 in PTECs. CD36 expression was necessary and sufficient to mediate PTEC apoptosis induced by glycated albumins (AGE-BSA and CML-BSA and free fatty acid palmitate through sequential activation of src kinase, and proapoptotic p38 MAPK and caspase 3. In contrast, paucity of expression of CD36 in PTECs in diabetic mice with diabetic glomerulopathy was associated with normal tubular epithelium and the absence of tubular apoptosis. Mouse PTECs lacked CD36 and were resistant to AGE-BSA-induced apoptosis. Recombinant expression of CD36 in mouse PTECs conferred susceptibility to AGE-BSA-induced apoptosis.Our findings suggest a novel role for CD36 as an essential mediator of proximal tubular apoptosis in human DNP. Because CD36 expression was induced by glucose in PTECs, and because increased CD36 mediated AGE-BSA-, CML-BSA-, and palmitate-induced PTEC apoptosis, we propose a two-step metabolic hit model for TED, a hallmark of progression in DNP.
EFFICIENCY OF THE USE OF AUTHENTIC WEB-RESOURCES IN TRANSLATORS TRAINING
Directory of Open Access Journals (Sweden)
Iryna M. Drobit
2013-06-01
Full Text Available The article deals with pedagogical assumptions and efficiency of the use of Information and Communication Technologies, especially authentic web-resources, while teaching language for specific purposes (translators and interpreters. Accuracy, content, and functionality of web-resource TED, which contains examples of authentic speech in English, have been outlined. It has been demonstrated that usage of multimedia and communication facilities of the TED web-resource provides favourable opportunity to involve students in such professional activities as translation and proofreading, and also to improve the level of their language skills.
Edgar Frank Codd e o Banco de Dados Relacional: uma contribuição para a História da Computação
Souza, Odécio
2015-01-01
No presente ensaio, pretendemos analisar a participação de Edgar Frank Ted Codd na organização das bases teóricas que permitiram a criação do "Objeto Tecnológico" conhecido como "Sistema Gerenciador de Banco de Dados Relacional", oferecendo assim uma contribuição para a História da Computação In this essay, we intend to analyze the participation of Edgar Frank "Ted" Codd in the organization of the theoretical foundations that allowed the creation of the "Technologica...
Modeling of extended defects in silicon
International Nuclear Information System (INIS)
Law, M.E.; Jones, K.S.; Earles, S.K.; Lilak, A.D.; Xu, J.W.
1997-01-01
Transient Enhanced Diffusion (TED) is one of the biggest modeling challenges present in predicting scaled technologies. Damage from implantation of dopant ions changes the diffusivities of the dopants and precipitates to form complex extended defects. Developing a quantitative model for the extended defect behavior during short time, low temperature anneals is a key to explaining TED. This paper reviews some of the modeling developments over the last several years, and discusses some of the challenges that remain to be addressed. Two examples of models compared to experimental work are presented and discussed
Padova, Ted
2011-01-01
The classic Acrobat and PDF reference, updated to cover the latest release. Consistently the most authoritative and comprehensive resource on Acrobat and PDF format, this standard reference returns with in-depth coverage of the newest version of Acrobat. Written by bestselling author Ted Padova, this book is packed with real-world insights and techniques gained from Padova's daily use of Acrobat and PDF under deadline constraints. You'll discover everything there is to know about using Acrobat and PDF for print prepress, the Internet, CD-ROMs, and other forms of media.: Popular author Ted Pado
Effectiveness of the AAOS Leadership Fellows Program for Orthopaedic Surgeons.
Day, Charles S; Tabrizi, Shervin; Kramer, Jeffrey; Yule, Arthur C; Ahn, Brian S
2010-11-17
Effective physician leadership is critical to the future success of healthcare organizations. The American Academy of Orthopaedic Surgeons (AAOS) Leadership Fellows Program is a one-year program designed to train young orthopaedic surgeons to become future leaders in orthopaedics. The purpose of this study was to evaluate the impact of the AAOS Leadership Fellows Program on the leadership skills and achievements of its participants. Graduates of the Leadership Fellows Program were compared with a control group of previous applicants who were not accepted to the program (applicants) in a retrospective cohort comparison study. A subjective survey of leadership skills was used to assess the confidence of the two cohorts in eight areas of leadership. In addition, an updated curriculum vitae from each of sixty leadership fellows from the classes of 2003 through 2009 and from each of forty-seven applicants was retrospectively reviewed for evidence of leadership. The updated curriculum vitae of the leadership fellows was evaluated for leadership activity attained prior to and following participation in the program, while the updated curriculum vitae of applicants was evaluated for leadership activity attained prior to and following the last year of application to the program. Curricula vitae were assessed for demonstration of national leadership, academic rank, hospital administrative rank, and research experience. On the leadership survey, the graduates of the Leadership Fellows Program scored higher than the applicants in seven of eight categories. The review of the curricula vitae demonstrated that, prior to the Leadership Fellows Program, the leadership fellows were more likely than the applicants to have an academic practice and hold an academic rank. The difference between the two cohorts in administrative rank and leadership of national committees was not significant. Following the program, the leadership fellows were more likely to chair national committees (p
Fung, Ka Wai; Wright, David W; Gor, Jayesh; Swann, Marcus J; Perkins, Stephen J
2016-12-01
During the activation of complement C4 to C4b, the exposure of its thioester domain (TED) is crucial for the attachment of C4b to activator surfaces. In the C4b crystal structure, TED forms an Arg 104 -Glu 1032 salt bridge to tether its neighbouring macroglobulin (MG1) domain. Here, we examined the C4b domain structure to test whether this salt bridge affects its conformation. Dual polarisation interferometry of C4b immobilised at a sensor surface showed that the maximum thickness of C4b increased by 0.46 nm with an increase in NaCl concentration from 50 to 175 mM NaCl. Analytical ultracentrifugation showed that the sedimentation coefficient s 20,w of monomeric C4b of 8.41 S in 50 mM NaCl buffer decreased to 7.98 S in 137 mM NaCl buffer, indicating that C4b became more extended. Small angle X-ray scattering reported similar R G values of 4.89-4.90 nm for C4b in 137-250 mM NaCl. Atomistic scattering modelling of the C4b conformation showed that TED and the MG1 domain were separated by 4.7 nm in 137-250 mM NaCl and this is greater than that of 4.0 nm in the C4b crystal structure. Our data reveal that in low NaCl concentrations, both at surfaces and in solution, C4b forms compact TED-MG1 structures. In solution, physiologically relevant NaCl concentrations lead to the separation of the TED and MG1 domain, making C4b less capable of binding to its complement regulators. These conformational changes are similar to those seen previously for complement C3b, confirming the importance of this salt bridge for regulating both C4b and C3b. © 2016 The Author(s).
Li, Keying; Gor, Jayesh; Perkins, Stephen J
2010-10-01
Component C3 is the central protein of the complement system. During complement activation, the thioester group in C3 is slowly hydrolysed to form C3u, then the presence of C3u enables the rapid conversion of C3 into functionally active C3b. C3u shows functional similarities to C3b. To clarify this mechanism, the self-association properties and solution structures of C3 and C3u were determined using analytical ultracentrifugation and X-ray scattering. Sedimentation coefficients identified two different dimerization events in both proteins. A fast dimerization was observed in 50 mM NaCl but not in 137 mM NaCl. Low amounts of a slow dimerization was observed for C3u and C3 in both buffers. The X-ray radius of gyration RG values were unchanged for both C3 and C3u in 137 mM NaCl, but depend on concentration in 50 mM NaCl. The C3 crystal structure gave good X-ray fits for C3 in 137 mM NaCl. By randomization of the TED (thioester-containing domain)/CUB (for complement protein subcomponents C1r/C1s, urchin embryonic growth factor and bone morphogenetic protein 1) domains in the C3b crystal structure, X-ray fits showed that the TED/CUB domains in C3u are extended and differ from the more compact arrangement of C3b. This TED/CUB conformation is intermediate between those of C3 and C3b. The greater exposure of the TED domain in C3u (which possesses the hydrolysed reactive thioester) accounts for the greater self-association of C3u in low-salt conditions. This conformational variability of the TED/CUB domains would facilitate their interactions with a broad range of antigenic surfaces. The second dimerization of C3 and C3u may correspond to a dimer observed in one of the crystal structures of C3b.
Chemin, K; Rezende, M; Loguercio, A D; Reis, A; Kossatz, S
To evaluate the risk for and intensity of tooth sensitivity and color change of at-home dental bleaching with 4% and 10% hydrogen peroxide (HP). For this study, 78 patients were selected according to the inclusion and exclusion criteria and randomized into two groups: HP 4 (White Class 4%, FGM) and HP 10 (White Class 10%, FGM). In both groups, the at-home bleaching was performed for a period of 30 minutes twice a day for two weeks. The color was assessed by Vita Classical, Vita Bleachedguide 3D-MASTER and spectrophotometer Vita Easyshade (Vita Zahnfabrik) at baseline, during bleaching (first and second weeks) and after bleaching (one month). Patients recorded their tooth sensitivity using a numeric rating scale (0-4) and visual analog scale (0-10). Data from color change (DeltaE data) was submitted to two-way analysis of variance. The color change data in Delta SGU from the two shade guide units were compared with the Mann Whitney test. The risk of tooth sensitivity was evaluated by χ 2 test and the intensity of tooth sensitivity from both scales was evaluated by a Mann-Whitney test (α=0.05). The absolute risk and intensity of tooth sensitivity was higher in the group that used HP 10 than the one that used HP 4. Data from change in the number of shade guide units and color variation after one month of bleaching for both groups showed significant whitening, with no difference between groups. At-home bleaching is effective with 4% and 10% HP concentrations, but 10% HP increased the absolute risk and intensity of tooth sensitivity during at-home bleaching.
Comparative in vitro evaluation of CAD/CAM vs conventional provisional crowns.
Abdullah, Adil Othman; Tsitrou, Effrosyni A; Pollington, Sarah
2016-01-01
This study compared the marginal gap, internal fit, fracture strength, and mode of fracture of CAD/CAM provisional crowns with that of direct provisional crowns. An upper right first premolar phantom tooth was prepared for full ceramic crown following tooth preparation guidelines. The materials tested were: VITA CAD-Temp®, Polyetheretherketone "PEEK", Telio CAD-Temp, and Protemp™4 (control group). The crowns were divided into four groups (n=10), Group1: VITA CAD-Temp®, Group 2: PEEK, Group 3: Telio CAD-Temp, and Group 4: Protemp™4. Each crown was investigated for marginal and internal fit, fracture strength, and mode of fracture. Statistical analysis was performed using GraphPad Prism software version 6.0. The average marginal gap was: VITA CAD-Temp® 60.61 (±9.99) µm, PEEK 46.75 (±8.26) µm, Telio CAD-Temp 56.10 (±5.65) µm, and Protemp™4 193.07(±35.96) µm (PCAD-Temp® 124.94 (±22.96) µm, PEEK 113.14 (±23.55) µm, Telio CAD-Temp 110.95 (±11.64) µm, and Protemp™4 143.48(±26.74) µm. The average fracture strength was: VITA CAD-Temp® 361.01 (±21.61) N, PEEK 802.23 (±111.29) N, Telio CAD-Temp 719.24 (±95.17) N, and Protemp™4 416.40 (±69.14) N. One-way ANOVA test showed a statistically significant difference for marginal gap, internal gap, and fracture strength between all groups (p0.05). CAD/CAM fabricated provisional crowns demonstrated superior fit and better strength than direct provisional crowns.
The effect of glazing and aging on the surface properties of CAD/CAM resin blocks.
Tekçe, Neslihan; Fidan, Sinan; Tuncer, Safa; Kara, Dilan; Demirci, Mustafa
2018-02-01
To investigate the effect of accelerated aging on surface properties of glazed CAD/CAM resin blocks using a 2D surface profilometer and a 3D non-contact optical profilometer. Three types of CAD/CAM resin restorative materials, LAVA Ultimate (3M ESPE, St Paul, MN, USA), VITA Enamic (Vita Zahnfabrik H. Rauter, Bad Säckingen, Germany), and Cerasmart (GC Corparation, Tokyo, Japan) were used for this study. CAD/CAM blocks were cut in 3-mm thickness slabs and divided into three groups; Group 1: control group (specimens polished with 600 grit SCI paper); Group 2: specimens sandblasted, silanized, and glazed with Optiglaze Color (GC); Group 3: glazed specimens subjected to 5000 thermocycles (n=15). The surface roughness (R a and R z ) was evaluated using a profilometer and a 3D scanning instrument. Data were analyzed using two-way ANOVA and Tukey's post-hoc test ( P .05). For VITA and Cerasmart, the specimens in Group 1 exhibited significantly higher R a values than Group 2 ( P .05). Glaze material Optiglaze Color makes CAD/CAM resin surfaces smooth and glazed CAD/CAM surfaces seem resistant to deterioration under 5000 thermocycles.
Comparative in vitro evaluation of CAD/CAM vs conventional provisional crowns
Directory of Open Access Journals (Sweden)
Adil Othman ABDULLAH
Full Text Available ABSTRACT Objective This study compared the marginal gap, internal fit, fracture strength, and mode of fracture of CAD/CAM provisional crowns with that of direct provisional crowns. Material and Methods An upper right first premolar phantom tooth was prepared for full ceramic crown following tooth preparation guidelines. The materials tested were: VITA CAD-Temp®, Polyetheretherketone “PEEK”, Telio CAD-Temp, and Protemp™4 (control group. The crowns were divided into four groups (n=10, Group1: VITA CAD-Temp®, Group 2: PEEK, Group 3: Telio CAD-Temp, and Group 4: Protemp™4. Each crown was investigated for marginal and internal fit, fracture strength, and mode of fracture. Statistical analysis was performed using GraphPad Prism software version 6.0. Results The average marginal gap was: VITA CAD-Temp® 60.61 (±9.99 µm, PEEK 46.75 (±8.26 µm, Telio CAD-Temp 56.10 (±5.65 µm, and Protemp™4 193.07(±35.96 µm (P0.05. Conclusions CAD/CAM fabricated provisional crowns demonstrated superior fit and better strength than direct provisional crowns.
[Equipment design for magnetic therapy and "Polus" devices].
Viktorov, V A; Malkov, Iu V
1994-01-01
Low-frequency magnetotherapy is among the most original therapeutical techniques since it is effective in treating most diseases and has practically no contraindications. Due to atraumaticity of a low-frequency electromagnetic field, the application of magnetotherapy is indicated in geriatric care, in particular. The VNIIMP-VITA Joint-Stock Company has developed a family of the Polyus system equipment for magnetotherapy, whereby all the well-known therapeutical procedures of low-frequency magnetotherapy can be performed. The magnetotherapeutic room equipped with Polyus-2D, Polyus-3, and Polyus-4 ensures a complete set of magneto-therapeutical exposure. The rooms are supplied by the VNIIMP-VITA Joint-Stock Company.
Shade selection performed by novice dental professionals and colorimeter.
Klemetti, E; Matela, A-M; Haag, P; Kononen, M
2006-01-01
The objective of this study was to test inter-observer variability in shade selection for porcelain restorations, using three different shade guides: Vita Lumin Vacuum, Vita 3D-Master and Procera. Nineteen young dental professionals acted as observers. The results were also compared with those of a digital colorimeter (Shade Eye Ex; Shofu, Japan). Regarding repeatability, no significant differences were found between the three shade guides, although repeatability was relatively low (33-43%). Agreement with the colorimetric results was also low (8-34%). In conclusion, shade selection shows moderate to great inter-observer variation. In teaching and standardizing the shade selection procedure, a digital colorimeter may be a useful educational tool.
Commissioning of the LHCb Silicon Tracker using data from the LHC injection tests
Knecht, M; Blanc, F; Bettler, M-O; Conti, G; Fave, V; Frei, R; Gauvin, N; Haefeli, G; Keune, A; Luisier, J; Muresan, R; Nakada, T; Needham, M; Nicolas, L; Perrin, A; Potterat, C; Schneider, O; Tran, M; Bauer, C; Britsch, M; Hofmann, W; Maciuc, F; Schmelling, M; Voss, H; Anderson, J; Buechler, A; Chiapolini, N; Hangartner, V; Salzmann, C; Steiner, S; Steinkamp, O; Van Tilburg, J; Tobin, M; Vollhardt, A; Adeva, B; Fungueiri no Pazos, J; Gallas, A; Pazos-Alvarez, A; Pérez-Trigo, E; Pló-Casasus, M; Rodriguez Perez, P; Saborido, J; Vázquez, P; Iakovenko, V; Okhrimenko, O; Pugatch, V
2011-01-01
LHCb is a single-arm forward spectrometer dedicated to the study of the CP-violation and rare decays in the b-quark sector. An efficient and high precision tracking system is a key requirement of the experiment. The LHCb Silicon Tracker Project consists of two sub-detectors that make use of silicon micro-strip technology: the Tracker Turicensis located upstream of the spectrometer magnet and the Inner Tracker which covers the innermost part of the tracking stations after the magnet. In total an area of 12 m^2 is covered by silicon. In September 2008 and June 2009, injection tests from the SPS to the LHC were performed. Bunches of order 5x10^9 protons were dumped onto a beam stopper (TED) located upstream of LHCb. This produced a spray of ~10 GeV muons in the LHCb detector. Though the occupancy in this environment is relatively large, these TED runs have allowed a first space and time alignment of the tracking system. Results of these studies together and the overall detector performance obtained in the TED ru...
Ombuds' Corner: Time and Stress Management
Vincent Vuillemin
2010-01-01
In this series, the Bulletin aims to explain the role of the Ombuds at CERN by presenting practical examples of misunderstandings that could have been resolved by the Ombuds if he had been contacted earlier. Please note that, in all the situations we present, the names are fictitious and used only to improve clarity. Ted* had been working in the Organization for many years. Thanks to his expertise, he was promoted to a position where, in addition to his usual daily tasks, he also had to manage strategic projects involving close contacts with people in different Departments. At the same time, the personnel in his unit had been reduced, so Ted had to deal with many urgent requests from people bursting into his office at all hours of the day. Ted found himself in a stressful situation, having to manage his strategic projects, which required deep thought and reflection, while constantly being interrupted by people needing his help, even for a few minutes. His professional conscience...
Microdosimetry for a carbon ion beam using track-etched detectors
International Nuclear Information System (INIS)
Ambrozova, I.; Ploc, O.; Davidkova, M.; Vondracek, V.; Sefl, M.; Stepan, V.; Pachnerova Brabcova, K.; Incerti, S.
2015-01-01
Track-etched detectors (TED) have been used as linear energy transfer (LET) spectrometers in heavy ion beams for many years. LET spectra and depth -dose distribution of a carbon ion beam were measured behind polymethylmethacrylate degraders at Heavy Ion Medical Accelerator in Chiba, Japan. The measurements were performed along monoenergetic beam with energy 290 MeV u -1 in different positions: (1) at beam extraction area, (2) at beginning, (3) maximum and (4) behind the Bragg peak region (0, 117, 147 and 151 mm of water-equivalent depth, respectively). The LET spectra inside and outside of the primary ion beam have been evaluated. TED record only heavy charged particles with LET above 8 -10 keV μm -1 , while electrons and ions with lower LET are not detected. The Geant4 simulation toolkit version 4.9.6.P01 has been used to estimate the contribution of non-detected particles to absorbed dose. Presented results demonstrate the applicability of TED for microdosimetry measurements in therapeutic carbon ion beams. (authors)
Coulomb scattering in field and photofield emission
International Nuclear Information System (INIS)
Donders, P.J.; Lee, M.J.G.
1987-01-01
An anomalous high-energy tail has been observed in the measured total energy distribution (TED) in photofield emission from tungsten. The strength of this tail is proportional to the product of the photofield emission current and the total emission current. Similar high- and low-energy tails in the TED's in field emission, which have previously been reported by several workers, are also observed. In any given measurement, the fraction of the total photofield-emission current in the anomalous photofield-emission tail is approximately equal to the fraction of the total field-emission current in the anomalous field-emission tail. Measurements of both the absolute strengths and energy dependences of the anomalous tails are reported. The experimental observations are consistent with the predictions of a classical calculation of the energy transfer that results from the Coulomb interaction between electrons in the vacuum near the field emitter. The various internal mechanisms that have previously been invoked to account for the tails in field-emission TED's do not appear to contribute significantly to the anomalous distributions observed in the present work
Gene : CBRC-PTRO-07-0045 [SEVENS
Lifescience Database Archive (English)
Full Text Available TED: hypothetical protein [Macaca mulatta] 7e-96 66% MEVSEPMMKAVLVSEPALEGVEVSEPVVQAVLVSEPEVEAVVVSEPAVEAVVVSEPSIEAVVVSELSVEVVMVVSEP...AVEAGMVSEPAVETVVVSEAVVEATVVSEFSMKTVVILELAVETLVVSEPMVEAIVVSEPMVDAMVVSELVVEAEVVSEPVVEAEVVSEPVVEAEVVSEPSVESVVVSEP...VMEAVVISEPSVEVVVVSEPVVETLVVSEPVMETVVVPEPSVETVVVSEPVADTVVVSEPSVEVMVVSEP...VVETMVVSDSVVETVVVSEPSVEAVVVSELVVEAVVVSEPVVEAEVVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKPPVRGR ...
Transient enhanced diffusion of dopants in preamorphized Si layers
International Nuclear Information System (INIS)
Claverie, A.; Bonafos, C.; Omri, M.; Mauduit, B. de; Ben Assayag, G.; Martinez, A.; Alquier, D.; Mathiot, D.
1997-01-01
Transient Enhanced Diffusion (TED) of dopants in Si is the consequence of the evolution, upon annealing, of a large supersaturation of Si self-interstitial atoms left after ion bombardment. In the case of amorphizing implants, this supersaturation is located just beneath the c/a interface and evolves through the nucleation and growth of End-Of-Range (EOR) defects. For this reason, the authors discuss here the relation between TED and EOR defects. Modelling of the behavior of these defects upon annealing allows one to understand why and how they affect dopant diffusion. This is possible through the development of the Ostwald ripening theory applied to extrinsic dislocation loops. This theory is shown to be readily able to quantitatively describe the evolution of the defect population (density, size) upon annealing and gives access to the variations of the mean supersaturation of Si self-interstitial atoms between the loops and responsible for TED. This initial supersaturation is, before annealing, at least 5 decades larger than the equilibrium value and exponentially decays with time upon annealing with activation energies that are the same than the ones observed for TED. It is shown that this time decay is precisely at the origin of the transient enhancement of boron diffusivity through the interstitial component of boron diffusion. Side experiments shed light on the effect of the proximity of a free surface on the thermal behavior of EOR defects and allow us to quantitatively describe the space and time evolutions of boron diffusivity upon annealing of preamorphized Si layers
LENUS (Irish Health Repository)
Hayes-Ryan, D
2012-11-01
Thromboembolic disease (TED) has, for many years, consistently been identified as one of the leading causes of direct maternal mortality. In November 2009, the RCOG published a guideline on the prevention of TED that has been rapidly adopted by hospital trusts in the UK. The aim of our study was to determine the number and profile of women in our population that would require treatment with low molecular weight heparin (LMWH) and the cost implications of such treatment if these guidelines were implemented. A retrospective review of the first 100 women who delivered at the Coombe Women & Infants University Hospital (CWIUH) in 2010 was conducted and risk stratification applied at the relevant time points. A total of 51% were deemed to be at intermediate or high risk of TED at some point during pregnancy. In 35 of the 51 women (70%), this risk was attributable to factors such as age>35 years, parity≥3, BMI>30 kg\\/m2 or cigarette smoking. In our obstetric population, the percentage of women with these risk factors was: 25.5%, 8.5%, 19% and 16.7%, respectively. Implementation of this guideline would increase the hospital annual expenditure on LMWH by a factor of 17. The strategy of attributing risk by accumulating factors that individually have a low risk of TED and are prevalent in the population needs to be re-visited. The cost of implementation of these guidelines is not inconsiderable in the absence of data to indicate that clinical outcome is improved with their implementation.
Habicht, Juhan, 1954-
1991-01-01
Tutvustused: Kivisildnik, Sven. Dawa vita. Tallinn : Eesti Raamat, [1991]. Uustulnd, Albert. Acheroni kaldal. Tallinn : Eesti Raamat, 1991. Kivikas, Albert. Nimed marmortahvlil. Tallinn : Eesti Raamat, 1991
Stable Amplification and High Current Drop Bistable Switching in Supercritical GaAs Tills
DEFF Research Database (Denmark)
Izadpanah, S.H; Jeppsson, B; Jeppesen, Palle
1974-01-01
Bistable switching with current drops of 40% and switching times of 100 ps are obtained in pulsed operation of 10¿m supercritically doped n+ nn+ GaAs Transferred Electron Devices (TEDs). When CW-operated the same devices exhibit a 5-17 GHz bandwidth for the stable negative resistance.......Bistable switching with current drops of 40% and switching times of 100 ps are obtained in pulsed operation of 10¿m supercritically doped n+ nn+ GaAs Transferred Electron Devices (TEDs). When CW-operated the same devices exhibit a 5-17 GHz bandwidth for the stable negative resistance....
Maloney, Andrew G. P.; Wood, Peter A.
2016-01-01
PIXEL has been used to perform calculations of adsorbate-adsorbent interaction energies between a range of metal–organic frameworks (MOFs) and simple guest molecules. Interactions have been calculated for adsorption between MOF-5 and Ar, H2, and N2; Zn2(BDC)2(TED) (BDC = 1,4-benzenedicarboxylic acid, TED = triethylenediamine) and H2; and HKUST-1 and CO2. The locations of the adsorption sites and the calculated energies, which show differences in the Coulombic or dispersion characteristic of the interaction, compare favourably to experimental data and literature energy values calculated using density functional theory. PMID:28496380
La mortalitá infantile ebraica a Ferrara nell'800
Directory of Open Access Journals (Sweden)
C. Adamo
2003-05-01
Full Text Available
Obiettivi: per conoscere la qualità di vita e lo sviluppo di una collettività, tanto per il passato quanto per il presente, si ricorre sempre più spesso agli studi sulla mortalità infantile (I anno di vita. L’obiettivo del lavoro è quello di descrivere la mortalità infantile ottocentesca nella comunità ebraica di Ferrara.
Metodi: presso l’Archivio Storico del Comune di Ferrara sono conservati i registri di morte dal 1813 al 1902 della popolazione ebraica da cui si sono tratte le seguenti variabili: anno di morte, numero progressivo del registro, cognome e nome del deceduto, sesso, giorno e mese di morte, malattia o causa di morte, età alla morte (mesi, giorni, ore. Il sesso è desunto dal nome del deceduto. Come in precedenti lavori, il nostro gruppo di ricerca, per definire la classificazione delle cause di morte nel primo anno di vita ha utilizzato fino all’anno 1854 un lavoro di Silini G. basato sulle metodologie di studio delle cause di morte nel secolo XIX a Lovere (Bergamo adattandola al diverso contesto storico geografico. Per il periodo successivo si è adottato il criterio classificatorio ISTAT (IX revisione.
Risultati: dalle prime elaborazioni emerge, per il periodo 1813 1902, il seguente quadro: i morti nel primo anno di vita sono 552, di cui morti nella prima settimana 127 (23%, morti tra la prima settimana ed il primo mese 185 (33,5% ed oltre il primo mese 240 (43,5%. Gli aborti sono risultati complessivamente 194 ed i nati morti 96. Il 51% sono maschi ed il rimanente 49% femmine. Le cause di morte prevalenti sono “materia”, “infiammazione”, “inanizione” ed “epilessia”.
Emozione, discorso e politiche della vita quotidiana
Directory of Open Access Journals (Sweden)
Lila Abu-Lughod
2013-07-01
Full Text Available Le emozioni sono una di quelle nozioni considerate scontate sia dalla conoscenza specialistica che dal discorso quotidiano, che stanno ora diventando parte del dominio della ricerca antropologica. Nonostante che siano ancora principalmente appannaggio della filosofia e della psicologia all’interno delle discipline accademiche, le emozioni sono anche questioni ordinarie del discorso culturale popolare americano,la cui relazione con questi discorsi professionali è complessa e solo parzialmente indagata.
Using the Curriculum Vitae in Leadership Research
Bawazeer, Wazerah; Gunter, Helen M
2016-01-01
Professional biography research with those who hold formal positions in educational organizations is an established approach to researching leaders, leading and leadership. A key focus is on the oral account of a life story, and this can include family and wider life experiences. What is less of a feature is how the respondent codifies their…
Ars longa vita brevis / Endrik Mänd
Mänd, Endrik, 1972-
2011-01-01
EKA uue hoone ehitusloa menetlemisega seotud pöördumisest Tallinna Linnaplaneerimise Ametile. Linn represseerivat kinnisvaraomanikku, sest viimane ei nõustu kooskõlastama Eesti Kunstiakadeemia ehitusluba
Directory of Open Access Journals (Sweden)
Artur Costrino
2014-12-01
Full Text Available O artigo visa apresentar ao leitor uma tradução inédita em português da vida dos rétores (que é parte da obra De Grammaticis et Rhetoribus de Suetônio. Como introdução, discute-se o lugar do gênero Vita em relação ao gênero Historia. Ainda há uma explanação sobre o “prefácio” da obra, o qual Suetônio divide em: história da declamação e praeexercitamina, de modo que o “prefácio”, então, não se enquadra no gênero Vita.
Vitalità senza direzione. Nuovi scenari della psicopatologia
Directory of Open Access Journals (Sweden)
Ivan Formica
2016-12-01
Full Text Available L’articolo esplora le forme di psicopatologia emergenti nell’ottica di un pensiero complesso. L’obiettivo, più in particolare, è quello di analizzare le nuove forme di esistenza-nel-mondo nell’epoca della post-modernità evidenziandone il loro carattere di frammentarietà e di movimento incessante e continuamente ricorsivo. In questo modo, mentre si esplorano le forme del mondo esterno si disegnano le forme del mondo interno e, viceversa, con gli occhi del mondo interno si descrivono le forme del mondo esterno. Si propone, infine, la possibilità di riacquisire la propria autenticità e creatività a partire dalla ri-fondazione di un legame con la vita e con gli ambienti di vita.
Lim, Younghee; DeJohn, Tara V; Murray, Drew
2012-04-01
As the United States' economy continues to experience challenges, more families at or near the poverty level fall prey to predatory financial practices. Their vulnerability to these operations is increased by a lack of knowledge of asset-building resources and alternative financial services. This article focuses on Volunteer Income Tax Assistance (VITA)--a free income tax preparation program, which is a vital resource available to low-income families. Unfortunately, VITA is largely underused and often unknown to economically strained families and to the social workers and other professionals to whom these families turn for assistance. This article concludes with policy and practice implications for social workers and other professionals engaged in providing services to financially vulnerable families.
Transformational Leadership Using TED Talks
Rubenstein, Lisa DaVia
2013-01-01
There is an ongoing debate about the efficacy of professional development with the field of gifted education. While some studies have found a positive relationship between professional development and teachers' knowledge and attitudes toward gifted students, others found that such training had no effect on teachers' attitudes toward the gifted or…
Saksa planeerimisõiguse olulised põhijooned / Wolfgang Ewer
Ewer, Wolfgang
2006-01-01
Lisatud: väljavõtteid Saksamaa Liitvabariigi põhiseadusest, ehitusseadustikust, ruumilise planeerimise seadusest, ehitusliku maakasutuse määrusest. - Lisatud: W. Eweri curriculum vitae ja publikatsioonide nimestik
Social comparison 2.0: examining the effects of online profiles on social-networking sites.
Haferkamp, Nina; Krämer, Nicole C
2011-05-01
Through their features--such as profile photographs or the personal vita--online profiles on social-networking sites offer a perfect basis for social comparison processes. By looking at the profile photograph, the user gains an impression of a person's physical attractiveness, and the user's vita shows which career path the person is pursuing. Against the background of Festinger's Social Comparison Theory, the focus of this research is on the effects of online profiles on their recipients. Therefore, qualitative interviews (N = 12) and two online experiments were conducted in which virtual online profiles of either physically attractive or unattractive persons (N = 93) and profiles of users with either high or low occupational attainment (N = 103) were presented to the participants. Although qualitative interviews did not initially give reason to expect online profiles to constitute a basis for comparison processes, results of the experiments proved otherwise. The first study indicates that recipients have a more negative body image after looking at beautiful users than persons who were shown the less attractive profile pictures. Male participants of the second study, who were confronted with profiles of successful males, showed a higher perceived discrepancy between their current career status and an ideal vita than male participants who looked at profiles of less successful persons.
Shade variance in ceramic restoration and shade tab: An in vitro study
Directory of Open Access Journals (Sweden)
Pannaikadu Somasundaram Prabu
2012-01-01
Full Text Available Background: In clinical practice aesthetics for any restoration needs to consider the parameters of surface form, translucency and colour.To achieve ideal aesthetics the colour replication process for dental porcelain is the most important step which comprises of a shade selection phase followed by shade duplication. Materials and Methods: The ceramic brands Vita VMK95 (classic and Ivoclar classic V were used for comparison with Vita classic shade tab guide shades A2 and B2. The samples were made of specific shape, size, and were of the recommended dimensions from investing self-cure acrylic strips to casted NiCr specimens Objective. The objective of this study was to quantify the results in CIE AE units system for the colour differences between the Vita shade guide colours and two commercial porcelains for metal ceramic crowns. Results: The results indicated that the porcelains do not match the shade guides to which they are compared and shade variations exist between different lots of porcelain from the same and different manufacturer. Conclusion: Problems identified that porcelains do not match the shade guides to which they are compared and shade variations exist between different lots of porcelain from the same and different manufacturer
Buyuk, S Kutalmış; Kucukekenci, Ahmet Serkan
2018-03-01
To investigate the shear bond strength (SBS) of orthodontic metal brackets applied to different types of ceramic surfaces treated with different etching procedures and bonding agents. Monolithic CAD/CAM ceramic specimens (N = 120; n = 40 each group) of feldspathic ceramic Vita Mark II, resin nanoceramic Lava Ultimate, and hybrid ceramic Vita Enamic were fabricated (14 × 12 × 3 mm). Ceramic specimens were separated into four subgroups (n = 10) according to type of surface treatment and bonding onto the ceramic surface. Within each group, four subgroups were prepared by phosphoric acid, hydrofluoric acid, Transbond XT primer, and Clearfill Ceramic primer. Mandibular central incisor metal brackets were bonded with light-cure composite. The SBS data were analyzed using three-way analysis of variance (ANOVA) and Tukey HSD tests. The highest SBS was found in the Vita Enamic group, which is a hybrid ceramic, etched with hydrofluoric acid and applied Transbond XT Adhesive primer (7.28 ± 2.49 MPa). The lowest SBS was found in the Lava Ultimate group, which is a resin nano-ceramic etched with hydrofluoric acid and applied Clearfill ceramic primer (2.20 ± 1.21 MPa). CAD/CAM material types and bonding procedures affected bond strength ( P .05). The use of Transbond XT as a primer bonding agent resulted in higher SBS.
Tibby, S M; Hatherill, M; Murdoch, I A
2000-06-01
To ascertain if cardiac output (CO) could be derived from blood flow velocity measured in the descending aorta of ventilated children by transesophageal Doppler ultrasonography (TED) without the need for direct aortic cross sectional area measurement, and to evaluate the ability of TED to follow changes in CO when compared with femoral artery thermodilution. Prospective, comparison study. A 16-bed pediatric intensive care unit of a university hospital. A total of 100 ventilated infants and children aged 4 days to 18 yrs (median age, 27 months). Diagnoses included postcardiac surgery (n = 58), sepsis/multiple organ failure (n = 32), respiratory disease (n = 5), and other (n = 5). A total of 55 patients were receiving inotropes or vasodilators. When patients were hemodynamically stable, a TED probe was placed into the distal esophagus to obtain optimal signal, and minute distance (MD) was recorded. Five consecutive MD measurements were made concurrently with five femoral artery thermodilution measurements, and the concurrent measurements were averaged. CO was then manipulated by fluid administration or inotrope adjustment, and the readings were repeated. Femoral artery thermodilution CO ranged from 0.32 to 9.19 L/min, (median, 2.46 L/min), and encompassed a wide range of high and low flow states. Theoretical consideration revealed the optimal TED estimate for CO to be (MD x patient height2 x 10(-7)). Linear regression analysis yielded a power function model such that: estimated CO = 1.158 x (MD x height2 x 10(-7))(0.785), r2 = 0.879, standard error of the estimate = 0.266. Inclusion of a correction factor for potential changes in aortic cross-sectional area with hypo- and hypertension did not appreciably improve the predictive value of the model. MD was able to follow percentage changes in CO, giving a mean bias of 0.87% (95% confidence interval -0.85% to 2.59%), and limits of agreement of +/- 16.82%. The median coefficient of variation for MD was 3.3%. TED provides
Mao, Yujiang; Song, Jie; Wei, Jie; Wang, Manyi
2010-01-01
Unrecognized joint penetration (UJP) by screw penetration through the articular surface undetectable on routine anteroposterior (AP) and lateral radiographs can cause serious complications. We have developed a geometric model to analyze UJP, and methods for the prevention of the problem. A Steinmetz Solid (SS) is the overlapping portion between two identical, vertically intersecting cylinders. The AP and lateral radiographs of a femoral head (simplified as a sphere) are projections of two cylinder-shaped images. A screw that appears to be within the femoral head in fact only lies within the cylinder. A screw apparently within the femoral head on both AP and lateral images is only confined to the SS generated by two cylinders, but not necessarily confined to the femoral head itself. We have therefore analyzed UJP using a geometric model based on SS. The geometric basis of UJP lies in the fact that the SS is larger than the sphere (femoral head) with a volume ratio of 4: π. The theoretical risk of UJP for any screw therefore can be as high as 21.5% ((4-π)/4). In reality, screws are always carefully placed to ensure a distance between the screw's tip and the edge of femoral head (tip-to-edge distance, or TED). This TED effectively lowers the risk of UJP by reducing the size of the screw-confining SS. When the SS entirely fits into (internally tangential to) the femoral head, the risk of UJP approaches zero. A TED fulfilling this requirement can be regarded as safe (approximately 0.29 x femoral head radius). With a femoral head diameter of 5 cm, the safe TED is approximately 7 mm.
Kerley, Dan; Smith, Malcolm; Dunn, Jennifer; Herriot, Glen; Véran, Jean-Pierre; Boyer, Corinne; Ellerbroek, Brent; Gilles, Luc; Wang, Lianqi
2016-08-01
The Narrow Field Infrared Adaptive Optics System (NFIRAOS) is the first light Adaptive Optics (AO) system for the Thirty Meter Telescope (TMT). A critical component of NFIRAOS is the Real-Time Controller (RTC) subsystem which provides real-time wavefront correction by processing wavefront information to compute Deformable Mirror (DM) and Tip/Tilt Stage (TTS) commands. The National Research Council of Canada - Herzberg (NRC-H), in conjunction with TMT, has developed a preliminary design for the NFIRAOS RTC. The preliminary architecture for the RTC is comprised of several Linux-based servers. These servers are assigned various roles including: the High-Order Processing (HOP) servers, the Wavefront Corrector Controller (WCC) server, the Telemetry Engineering Display (TED) server, the Persistent Telemetry Storage (PTS) server, and additional testing and spare servers. There are up to six HOP servers that accept high-order wavefront pixels, and perform parallelized pixel processing and wavefront reconstruction to produce wavefront corrector error vectors. The WCC server performs low-order mode processing, and synchronizes and aggregates the high-order wavefront corrector error vectors from the HOP servers to generate wavefront corrector commands. The Telemetry Engineering Display (TED) server is the RTC interface to TMT and other subsystems. The TED server receives all external commands and dispatches them to the rest of the RTC servers and is responsible for aggregating several offloading and telemetry values that are reported to other subsystems within NFIRAOS and TMT. The TED server also provides the engineering GUIs and real-time displays. The Persistent Telemetry Storage (PTS) server contains fault tolerant data storage that receives and stores telemetry data, including data for Point-Spread Function Reconstruction (PSFR).
International Nuclear Information System (INIS)
Agarwal, A.; Gossmann, H.-.; Eaglesham, D.J.; Pelaz, L.; Jacobson, D.C.; Haynes, T.E.; Erokhin, Y.E.
1997-01-01
The reduction of transient enhanced diffusion (TED) with reduced implantation energy has been investigated and quantified. A fixed dose of 1x10 14 cm -2 Si + was implanted at energies ranging from 0.5 to 20 keV into boron doping superlattices and enhanced diffusion of the buried boron marker layers was measured for anneals at 810, 950, and 1050 degree C. A linearly decreasing dependence of diffusivity enhancement on decreasing Si + ion range is observed at all temperatures, extrapolating to ∼1 for 0 keV. This is consistent with our expectation that at zero implantation energy there would be no excess interstitials from the implantation and hence no TED. Monte Carlo modeling and continuum simulations are used to fit the experimental data. The results are consistent with a surface recombination length for interstitials of <10 nm. The data presented here demonstrate that in the range of annealing temperatures of interest for p-n junction formation, TED is reduced at smaller ion implantation energies and that this is due to increased interstitial annihilation at the surface. copyright 1997 American Institute of Physics
Sun, Cheng; Müller, Erich; Meffert, Matthias; Gerthsen, Dagmar
2018-04-01
Transmission electron microscopy (TEM) with low-energy electrons has been recognized as an important addition to the family of electron microscopies as it may avoid knock-on damage and increase the contrast of weakly scattering objects. Scanning electron microscopes (SEMs) are well suited for low-energy electron microscopy with maximum electron energies of 30 keV, but they are mainly used for topography imaging of bulk samples. Implementation of a scanning transmission electron microscopy (STEM) detector and a charge-coupled-device camera for the acquisition of on-axis transmission electron diffraction (TED) patterns, in combination with recent resolution improvements, make SEMs highly interesting for structure analysis of some electron-transparent specimens which are traditionally investigated by TEM. A new aspect is correlative SEM, STEM, and TED imaging from the same specimen region in a SEM which leads to a wealth of information. Simultaneous image acquisition gives information on surface topography, inner structure including crystal defects and qualitative material contrast. Lattice-fringe resolution is obtained in bright-field STEM imaging. The benefits of correlative SEM/STEM/TED imaging in a SEM are exemplified by structure analyses from representative sample classes such as nanoparticulates and bulk materials.
Turtle Hearing Capability Based on ABR Signal assessment
Directory of Open Access Journals (Sweden)
Raja Bidin Raja Hassan
2010-08-01
Full Text Available Sea turtles have existed for millions of years. International Union for Conservation of Nature (IUCN has reported that the Hawksbill Turtle (Eretmochelys imbricata is classified as critically endangered. Turtle excluder device (TED deployment on shrimpnet fisheries is needed for turtle conservation.TED using sound technique is challenge method in fisheries development.The knowledge on turtle hearing capability is limited. The auditory brainstem response (ABR assessment is method to determine turtle hearing capability. Turtle hearing assessment is basis to design TED. The objective of this paper is to determine turtle hearing cability by analyze its ABR spectral.The subject is Hawksbill turtle with number 2 turtles ie: 3 and 2 years. The measurement was taken at Pusat Pengurusan Penyu (Turtle Management Centre Padang Kemunting Masjid Tanah Melaka Malaysia. The results shows that turtle 3 years have peak power frequencies 50.78, 101.6, 152.3, 304.7, 355.5, 457, and 507.8Hz respectively whereas the spectral amplitude is ranging 0.03-32.44% spectral. Turtle 2 years has peak power at 457Hz in whole stimulus frequencies while the spectral amplitude is ranging 0.01-2.5% spectral.
Investigation on the Quality Factor Limit of the (111 Silicon Based Disk Resonator
Directory of Open Access Journals (Sweden)
Xin Zhou
2018-01-01
Full Text Available Quality factor is one of the most important parameters for a MEMS resonator. Most MEMS resonators are dominated by thermoelastic dissipation (TED. This paper demonstrates that the TED in a disk resonator that is made of (111 single-crystal silicon is surpassed by clamping loss. The stiffness-mass decoupling design method, combined with reducing the beam width, was used to engineer high QTED. Experiments show that Q of the (111 disk resonator have an upper boundary that is determined by the clamping loss caused by the unbalanced out-of-plane displacement. The origin of the out-of-plane displacement is explained by theory and simulation.
Carroll, M. S.; Chang, C.-L.; Sturm, J. C.; Büyüklimanli, T.
1998-12-01
In this letter, we show the ability, through introduction of a thin Si1-x-yGexCy layer, to eliminate the enhancement of enhanced boron diffusion in silicon due to an oxidizing surface or ion implant damage. This reduction of diffusion is accomplished through a low-temperature-grown thin epitaxial Si1-x-yGexCy layer which completely filters out excess interstitials introduced by oxidation or ion implant damage. We also quantify the oxidation-enhanced diffusion (OED) and transient-enhanced diffusion (TED) dependence on substitutional carbon level, and further report both the observation of carbon TED and OED, and its dependence on carbon levels.
Response of LET spectrometer based on track etching at some neutron sources
International Nuclear Information System (INIS)
Spurny, Frantisek; Brabcova, Katerina; Jadrnickova, Iva
2008-01-01
There is still need to develop upgrade, and test further methods able to characterise the external exposure to neutrons. This contribution presents further results obtained with the goal to enlarge and upgrade the possibility of neutron dosimetry and microdosimetry with a LET spectrometer based on the chemically etched track detectors (TED). As TED we have used several types of polyallyldiglycolcarbonates (PADC). The PADC detectors have been exposed in: high energy neutron beams at iThemba facility, Cape Town, South Africa, and in monoenergetic neutron beams at JRC Geel, Belgium. The studies have been performed in the frame of the ESA supported project DOBIES. (author)
International Nuclear Information System (INIS)
Vannikov, A.V.; Grishina, A.D.; Gorbunova, Yu.G.; Enakieva, Yu.Yu.; Krivenko, T.V.; Savel'ev, V.V.; Tsivadze, A.Yu.
2006-01-01
Photoelectric, non-linear optical, and photorefractive properties of aromatic polyimine doped with ruthenium(II) complex with tetra-15-crown-5-phthalocyanine and axially coordinated triethylenediamine molecules, (R 4 Pc)Ru(TED) 2 , where R 4 Pc 2- and TED denote 4,5,4',5',4'',5'',4''',5'''-tetrakis-(1,4,7,10,13- pentaoxatridecamethylene)phthalocyaninate ion and triethylenediamine molecule, respectively, were studied. It is established that supramolecular ensembles on the basis of the complex make an aromatic polyimide layer photoelectrically sensitive to 1064-nm Nd : YAG laser radiation, exhibit third-order susceptibility, and, consequently, impart photorefractive properties to the polymer layer at this wavelength [ru
Status of University of Cincinnati reactor-site nuclear engineering graduate programs
International Nuclear Information System (INIS)
Anno, J.N.; Christenson, J.M.; Eckart, L.E.
1993-01-01
The University of Cincinnati (UC) nuclear engineering program faculty has now had 12 yr of experience in delivering reactor-site educational programs to nuclear power plant technical personnel. Currently, with the sponsorship of the Toledo-Edison Company (TED), we are conducting a multiyear on-site graduate program with more than 30 participants at the Davis-Besse nuclear power plant. The program enables TED employees with the proper academic background to earn a master of science (MS) degree in nuclear engineering (mechanical engineering option). This paper presents a brief history of tile evolution of UC reactor-site educational programs together with a description of the progress of the current program
Lifescience Database Archive (English)
Full Text Available ted Amino Acid sequence lishmnlkqklvsn*lmqvvkhltrshi*meleipilqfhsiiqvvmvgkcmvhhqshgm klwqyqlk*qfkilkm*LNHSNL...kn*lcstistckkfiitlf** ink*iiyin Frame C: lishmnlkqklvsn*lmqvvkhltrshi*meleipilqfhsiiqvvmvgkcmvhhqshgm klwqyq
76 FR 59416 - Senior Executive Service Performance Review Board
2011-09-26
..., William Danelo, Daniel J. Davis, Delia Davis, Robert de Vallance, Brian Dean, Nicole DeVita, Charles Di..., Roberta Stern, Warren Stewart, Sharon Stinnett, Melanie S. Strack, Barbara L. Stroud, Dennie Michael...
SpaceVPX Switch-Controller, Phase I
National Aeronautics and Space Administration — Crossfield Technology proposes a SpaceVPX (VITA 78) Switch-Controller Module implemented in a state-of-the-art Field Programmable Gate Array (FPGA) System on Chip...
An extended five-stream model for diffusion of ion-implanted dopants in monocrystalline silicon
International Nuclear Information System (INIS)
Khina, B.B.
2007-01-01
Low-energy high-dose ion implantation of different dopants (P, Sb, As, B and others) into monocrystalline silicon with subsequent thermal annealing is used for the formation of ultra-shallow p-n junctions in modern VLSI circuit technology. During annealing, dopant activation and diffusion in silicon takes place. The experimentally observed phenomenon of transient enhanced diffusion (TED), which is typically ascribed to the interaction of diffusing species with non-equilibrium point defects accumulated in silicon due to ion damage, and formation of small clusters and extended defects, hinders further down scaling of p-n junctions in VLSI circuits. TED is currently a subject of extensive experimental and theoretical investigation in many binary and multicomponent systems. However, the state-of-the-art mathematical models of dopant diffusion, which are based on the so-called 'five-stream' approach, and modern TCAD software packages such as SUPREM-4 (by Silvaco Data Systems, Ltd.) that implement these models encounter severe difficulties in describing TED. Solving the intricate problem of TED suppression and development of novel regimes of ion implantation and rapid thermal annealing is impossible without elaboration of new mathematical models and computer simulation of this complex phenomenon. In this work, an extended five-stream model for diffusion in silicon is developed which takes into account all possible charge states of point defects (vacancies and silicon self-interstitials) and diffusing pairs 'dopant atom-vacancy' and 'dopant atom-silicon self-interstitial'. The model includes the drift terms for differently charged point defects and pairs in the internal electric field and the kinetics of interaction between unlike 'species' (generation and annihilation of pairs and annihilation of point defects). Expressions for diffusion coefficients and numerous sink/source terms that appear in the non-linear, non-steady-state reaction-diffusion equations are derived
Doan, Ninh; Gettins, Peter G W
2007-10-01
Human alpha2M (alpha2-macroglobulin) and the complement components C3 and C4 are thiol ester-containing proteins that evolved from the same ancestral gene. The recent structure determination of human C3 has allowed a detailed prediction of the location of domains within human alpha2M to be made. We describe here the expression and characterization of three alpha(2)M domains predicted to be involved in the stabilization of the thiol ester in native alpha2M and in its activation upon bait region proteolysis. The three newly expressed domains are MG2 (macroglobulin domain 2), TED (thiol ester-containing domain) and CUB (complement protein subcomponents C1r/C1s, urchin embryonic growth factor and bone morphogenetic protein 1) domain. Together with the previously characterized RBD (receptor-binding domain), they represent approx. 42% of the alpha2M polypeptide. Their expression as folded domains strongly supports the predicted domain organization of alpha2M. An X-ray crystal structure of MG2 shows it to have a fibronectin type-3 fold analogous to MG1-MG8 of C3. TED is, as predicted, an alpha-helical domain. CUB is a spliced domain composed of two stretches of polypeptide that flank TED in the primary structure. In intact C3 TED interacts with RBD, where it is in direct contact with the thiol ester, and with MG2 and CUB on opposite, flanking sides. In contrast, these alpha2M domains, as isolated species, show negligible interaction with one another, suggesting that the native conformation of alpha2M, and the consequent thiol ester-stabilizing domain-domain interactions, result from additional restraints imposed by the physical linkage of these domains or by additional domains in the protein.
Doan, Ninh; Gettins, Peter G. W.
2007-01-01
Human α2M (α2-macroglobulin) and the complement components C3 and C4 are thiol ester-containing proteins that evolved from the same ancestral gene. The recent structure determination of human C3 has allowed a detailed prediction of the location of domains within human α2M to be made. We describe here the expression and characterization of three α2M domains predicted to be involved in the stabilization of the thiol ester in native α2M and in its activation upon bait region proteolysis. The three newly expressed domains are MG2 (macroglobulin domain 2), TED (thiol ester-containing domain) and CUB (complement protein subcomponents C1r/C1s, urchin embryonic growth factor and bone morphogenetic protein 1) domain. Together with the previously characterized RBD (receptor-binding domain), they represent approx. 42% of the α2M polypeptide. Their expression as folded domains strongly supports the predicted domain organization of α2M. An X-ray crystal structure of MG2 shows it to have a fibronectin type-3 fold analogous to MG1–MG8 of C3. TED is, as predicted, an α-helical domain. CUB is a spliced domain composed of two stretches of polypeptide that flank TED in the primary structure. In intact C3 TED interacts with RBD, where it is in direct contact with the thiol ester, and with MG2 and CUB on opposite, flanking sides. In contrast, these α2M domains, as isolated species, show negligible interaction with one another, suggesting that the native conformation of α2M, and the consequent thiol ester-stabilizing domain–domain interactions, result from additional restraints imposed by the physical linkage of these domains or by additional domains in the protein. PMID:17608619
Stereotactic Radiotherapy for Locally Recurrent Nasopharyngeal Carcinoma
International Nuclear Information System (INIS)
Leung, T.-W.; Wong, Victy Y.W.; Tung, Stewart Y.
2009-01-01
Purpose: To study the treatment outcome in patients with locally recurrent nasopharyngeal carcinoma (NPC) who were treated with stereotactic radiotherapy (SRT). Methods and Materials: Thirty patients with non-metastatic, locally recurrent NPC who were treated with curative intent between 1998 and 2002 were retrospectively analyzed. The International Union Against Cancer T-stage distribution at recurrence (rT) was as follows: rT1-14, rT2-7, rT3-3, and rT4-6. All patients were treated with SRT with a daily fractional dose of 2.5-4.5 Gy (median, 3 Gy) in 8-22 fractions (median, 18 fractions). Total equivalent dose (TED) was calculated by the linear-quadratic formula without a time factor correction. Results: The 5-year actuarial overall survival rate, disease-specific survival rate, and local failure-free survival (LFFS) rate for the whole group were 40%, 41.4%, and 56.8%, respectively. The 3-year LFFS rates of rT1-2 and rT3-4 diseases were 65% and 66.7%, respectively. Seven of nine patients who received a TED <55 Gy recurred locally compared with 4 of 21 patients who received ≥55 Gy. Their corresponding 5-year LFFS rates were 22.2% and 75.8% (p = 0.005). The TED was the only factor significant in affecting the local control on univariate analyses. Conclusion: SRT is an effective treatment for locally recurrent NPC. TED ≥55 Gy should be given to secure a higher local control rate. The late complication rates were acceptable for patients with rT1-2 disease. For patients with rT3-4 disease, more works need to be done to further decrease the late complications.
Nuove prospettive di ricerca: il 'dentro' e il 'fuori' delle narrazioni
Directory of Open Access Journals (Sweden)
Maria Ermelinda De Carlo
2006-09-01
Full Text Available Tra le righe di uno scritto, attraverso le rappresentazioni e le interpretazioni, è possibile ritrovare schegge di un originale smarrito, ma non si può ricostruire oggettivamente e interamente la vita veramente vissuta. La scelta sintagmatica e paradigmatica, consapevole e/o inconsapevole, nasce infatti da un’impalcatura, da schemi mentali con cui l’uomo convive da sempre. Una storia e una frase dicono molto di più di quel che dicono. La densità di significazione e tutti i mondi che ci sono dietro ad alcuni sostantivi, verbi, avverbi, aggettivi restano il più delle volte un segreto. Il punto di vista narrativo si pone, dunque, come potenziale chiave euristica ed ermeneutica in grado di esplorare e recuperare patrimoni di esperienze di vita dei soggetti. La scrittura consente al soggetto di raccontarsi e di raccontare un io nascosto e rappresenta un tentativo di strapparsi quella ‘maschera di ferro’ che nasconde le emozioni, di andare ‘oltre la soglia’, di dare sfogo ad un’identità più o meno autentica, di comprendere orientamenti e percorsi di senso. Essa è l’esito di chi narra che, uscito dalla polarità dello schema lineare della vita, affianca se stesso in modo tale da avere uno sguardo sul sistema di insieme di cui è parte.
International Nuclear Information System (INIS)
Titiek Martati; June Mellawati
2010-01-01
Analysis of vita mine 812 in pharmaceutical preparations can be done by neutron activation method, because one molecule of vita mine 812 contains one atom of Co (4.35 %). The aim of research to know the ability of neutron activation method to analyze pharmaceutical preparations of vitamine 812 by test the precision and accuracy methods. It is expected that the method of neutron activation analysis can be an alternative method in the determination of vitamine 812 in pharmaceutical preparations. Samples were irradiated using thermal neutrons in the reactor during 30 minutes Siwabessy GA, and based on n, gamma reaction, the "6"0CO isotope formed then be identified using Gamma Spectrometer at 1173.5 and 1332.4 keV energy. Vitamine 812 concentration was obtained by calculating the ratio of vitamine 812 molecule to molecule Co. The results showed that the neutron activation method is good for determining 8_1_2 vitamin in low concentration (≥ 200 mg), but not for high concentrations ( ≥ 5000 mg). This method has a 99.11 to 99.52 % accuracy, and 96.52 to 104.95 % precision with a detection limit measures of vita mine 812184.36 mg. Recovery test obtained ranged between 98.19 to 101.07 % of vitamine 812 compared to levels specified in the label, so that still recommend the requirements of British Pharmacopoeia 2009 and the United States Pharmacopoeia 29. (author)
International Nuclear Information System (INIS)
Vegh, Janos; Major, Csaba; Horvath, Csaba; Hozer, Zoltan; Adorjan, Ferenc; Lux, Ivan; Horvath, Kristof
2002-01-01
The main design features, services, and human-machine interface characteristics are described of the CERTA VITA on-line plant information system developed and installed by KFKI AEKI at the Nuclear Safety Directorate (NSD) of the Hungarian Atomic Energy Authority (HAEA) in cooperation with experts from the NSD. The Center for Emergency Response, Training, and Analysis (CERTA) located at the headquarters of NSD, Budapest, Hungary, was established in 1997. The center supports the NSD installation, radiological monitoring, and advisory team in case of nuclear emergencies, with appropriate hardware and software for communication, diagnosis, prognosis, and prediction. The vital information transfer and analysis (VITA) system represents an important part of the CERTA, as it provides for the continuous remote inspection of the four VVER-440/V213 units of the Hungarian Paks nuclear power plant (NPP). The on-line information system maintains a continuous data link with the NPP through a managed leased line that connects CERTA to a gateway computer located at the Paks NPP. The present scope of the system is a result of a 4-yr development project: In addition to the basic safety parameter display functions, the VITA system now includes an on-line break parameter estimation module, an extensive training package based on simulated transients, and on-line data transfer capabilities to feed accident diagnosis/analysis codes
Repair bond strength of resin composite to bilayer dental ceramics
2018-01-01
PURPOSE The purpose of this study was to investigate the effect of various surface treatments (ST) on the shear bond strength of resin composite to three bilayer dental ceramics made by CAD/CAM and two veneering ceramics. MATERIALS AND METHODS Three different bilayer dental ceramics and two different veneering ceramics were used (Group A: IPS e.max CAD+IPS e.max Ceram; Group B: IPS e.max ZirCAD+IPS e.max Ceram, Group C: Vita Suprinity+Vita VM11; Group D: IPS e.max Ceram; Group E: Vita VM11). All groups were divided into eight subgroups according to the ST. Then, all test specimens were repaired with a nano hybrid resin composite. Half of the test specimens were subjected to thermocycling procedure and the other half was stored in distilled water at 37℃. Shear bond strength tests for all test specimens were carried out with a universal testing machine. RESULTS There were statistically significant differences among the tested surface treatments within the all tested fracture types (P.00125). CONCLUSION This study revealed that HF etching for glass ceramics and sandblasting for zirconia ceramics were adequate for repair of all ceramic restorations. The effect of ceramic type exposed on the fracture area was not significant on the repair bond strength of resin composites to different ceramic types. PMID:29713430
Ramakrishnaiah, Ravikumar; Alkheraif, Abdulaziz A.; Divakar, Darshan Devang; Matinlinna, Jukka P.; Vallittu, Pekka K.
2016-01-01
The current laboratory study is evaluating the effect of hydrofluoric acid etching duration on the surface characteristics of five silica-based glass ceramics. Changes in the pore pattern, crystal structure, roughness, and wettability were compared and evaluated. Seventy-five rectangularly shaped specimens were cut from each material (IPS e-max™, Dentsply Celtra™, Vita Suprinity™, Vita mark II™, and Vita Suprinity FC™); the sectioned samples were finished, polished, and ultrasonically cleaned. Specimens were randomly assigned into study groups: control (no etching) and four experimental groups (20, 40, 80 and 160 s of etching). The etched surfaces’ microstructure including crystal structure, pore pattern, pore depth, and pore width was studied under a scanning electron microscope, and the surface roughness and wettability were analyzed using a non-contact surface profilometer and a contact angle measuring device, respectively. The results were statistically analyzed using one-way analysis of variance (ANOVA) and the post hoc Tukey’s test. The results showed a significant change in the pore number, pore pattern, crystal structure, surface roughness, and wettability with increased etching duration. Etching for a short time resulted in small pores, and etching for longer times resulted in wider, irregular grooves. A significant increase in the surface roughness and wettability was observed with an increase in the etching duration. The findings also suggested a strong association between the surface roughness and wettability. PMID:27240353
Goryainova, Kristina E; Morokov, Egor S; Retinskaja, Marina V; Rusanov, Fedor S; Apresyan, Samvel V; Lebedenko, Igor Yu
2018-01-01
The aim of the present work was to compare the elastic properties and internal structure of 4 different CAD/CAM chairside materials, by the method of Scanning Impulse Acoustic Microscopy (SIAM). Four chairside CAD/CAM materials with different structures from hybrid ceramic (VITA Enamic, VITA Zahnfabrik), feldspatic ceramic (VITABlocs Mark II, VITA Zahnfabrik), leucite glass-ceramic (IPS Empress CAD, Ivoclar Vivadent) and PMMA (Telio CAD, Ivoclar Vivadent) were examined by Scanning Impulse Acoustic Microscope (SIAM). The results of micromorphological research of CAD/CAM chairside materials using SIAM method showed differences between the internal structures of these materials. The internal structure of feldspatic and glass-ceramic samples revealed the presence of pores with different sizes, from 10 to 100 microns; the structure of polymer materials rendered some isolated defects, while in the structure of hybrid material, defects were not found. Based on the results obtained from the present study, in cases of chairside production of dental crowns, it would be advisable to give preference to the blocks of hybrid ceramics. Such ceramics devoid of quite large porosity, glazing for CAD/CAM crowns made from leucite glass-ceramic and feldspatic ceramic may be an option. For these purposes, commercially available special muffle furnace for clinical and laboratory individualization and glazing of ceramic prostheses were provided. Further studies are needed to confirm the evidence emerging from the present research.
Influence of taurine and vitaiodurol on the development frequency of experimental stellate cataracts
International Nuclear Information System (INIS)
Fedorenko, B.S.; Kabachenko, A.N.; Vajnshtejn, E.S.; Yartsev, E.I.; Kolesnikov, Yu.A.
1978-01-01
Comparative investigations of medical efficiency of 4% solutions of taurine and vita-iodurol have been carried out using the model of experimental stellate cataract in mice. 140 male mice of CBAxC 57 BL 6 line with 14-16g mass were investigated. Animals of 3 groups (35 mice in each) were exposed to 300 rad dose gamma-radiation with Co 60 . Radiation intensity was 10 rad/s. The animals were examined before irradiation and each 4 weeks after irradiation. In 25 weeks after irradiation, when lenticular opacity was observed in more than half the mice, the animals of the first group were dropped in two eyes by 1 drop of 4% distilled water taurine solution during a month. Animals of the second group got instillations of vita-iodurol by the same method. The third group of animals was the irradiated control group. The fourth group of mice was used as the intact control group. Lenticular opacities developed were classified by the Christenberry and Furth method, suggested for evaluating stellate lenticular opacities in small laboratory animals. It was shown, that instillations of 4% taurine solution into animals with initial stellate cataract during a month result in reducing the frequency of lenticular opacities by 30%. Taurine in used concentration results in pronounced medical effect. Vita-iodurol hadn't any therapentic effect on the course of initial stellate catarat in mice
Sieverink, Floor; Kelders, Saskia M; Braakman-Jansen, Louise M A; van Gemert-Pijnen, Julia E W C
2014-03-01
The electronic personal health record (PHR) is a promising technology for improving the quality of chronic disease management. Until now, evaluations of such systems have provided only little insight into why a particular outcome occurred. The aim of this study is to gain insight into the navigation process (what functionalities are used, and in what sequence) of e-Vita, a PHR for patients with type 2 diabetes mellitus (T2DM), to increase the efficiency of the system and improve the long-term adherence. Log data of the first visits in the first 6 weeks after the release of a renewed version of e-Vita were analyzed to identify the usage patterns that emerge when users explore a new application. After receiving the invitation, 28% of all registered users visited e-Vita. In total, 70 unique usage patterns could be identified. When users visited the education service first, 93% of all users ended their session. Most users visited either 1 or 5 or more services during their first session, but the distribution of the routes was diffuse. In conclusion, log file analyses can provide valuable prompts for improving the system design of a PHR. In this way, the match between the system and its users and the long-term adherence has the potential to increase. © 2014 Diabetes Technology Society.
Vichi, A; Fonzar, R Fabian; Goracci, C; Carrabba, M; Ferrari, M
To assess the efficacy of dedicated finishing/polishing systems on roughness and gloss of VITA Suprinity and IPS e.max CAD. A total of 24 blocks of Suprinity and 24 of e.max were cut into a wedge shape using an InLab MC-XL milling unit. After crystallization, the 24 Suprinity wedges were divided into four subgroups: group A.1: Suprinity Polishing Set Clinical used for 30 seconds and group A.2: for 60 seconds; group A.3: VITA Akzent Plus Paste; and group A.4: spray. The 24 e.max wedges (group B) were divided into four subgroups according to the finishing procedure: group B.1: Optrafine Ceramic Polishing System for 30 seconds and group B.2: for 60 seconds; group B.3: IPS e.max CAD Crystall/Glaze paste; and group B.4: spray. After finishing/polishing, gloss was assessed with a glossmeter and roughness evaluated with a profilometer. Results were analyzed by applying a two-way analysis of variance for gloss and another for roughness (α=0.05). One specimen per each subgroup was observed with a scanning electron microscope. For roughness, materials and surface were significant factors ( pgloss, both material and surface treatment were significant factors ( pgloss than e.max. Also the Material-Surface Treatment interaction was statistically significant ( pgloss. VITA Suprinity displayed higher polishability than IPS e.max CAD.
Nokia müüki pärssis hinnasõda / Annika Matson
Matson, Annika, 1976-
2003-01-01
Nokia mobiiltelefonide müügitulemused võrreldes eelmise aastaga peaaegu ei muutunud. Ettevõtte hinnangul hävitas kasvu Aasia riikide odavate toodete hinnasurve. Diagramm: Nokia käive ja kasum langesid
Töö ning pidu Cannes ̀is / Jaak Lõhmus
Lõhmus, Jaak, 1955-
1998-01-01
Meeleoludest Cannes ̀i 51. filmifestivalil ja lühidalt Terry Gilliani filmist "Ratastel Las Vegasesse" ("Fear and Loathing in Las Vegas") ning Roberto Benigni filmist "Elu on ilus" ("La Vita é bella")
Czech Academy of Sciences Publication Activity Database
Suchomelová, Marcela
2004-01-01
Roč. 91, č. 4 (2004), s. 415-417 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z9058907 Keywords : the personal documentary fund * curriculum vitae Subject RIV: AC - Archeology, Anthropology, Ethnology
77 FR 65536 - Notice To Solicit Applications for the Ocean Exploration Advisory Board
2012-10-29
... evolution of the plan based on results and achievements; c. Annually review the quality and effectiveness of... solicited. Inclusion of a (maximum length 4 pages) resume or curriculum vitae is recommended, but not...
African Journals Online (AJOL)
... Moreno,J. , Ortiz M. , Marinoni G. , Vita P. , Vidari G. , Mellerio G. (1995) Importancia ... Contribuciones del Instituto Ecuatoriano de Ciencias ... and analgesic properties of Caesalpinia bonducella F. seed oil in experimental animal models.
United States Air Force Statistical Digest, Fiscal Year 1957. Twelfth Edition
1957-09-30
ACCIIENrS CAUSING FACTORS td AU" PRI AI.L PRJ ALL PRI ALL PRI ALL PRI ALL PRI SEcoND QI.IARTER (CONI" D) nmER • (CONT’D) Jet ~ (cant’d) B-52...unobllga:ted balancea tranaterred to the Treasury and \\Ulll~ted b&1&ncea at ~.1.ng ~tions tranaterred ’to "Mit account.a.. , td CUb tral:aterred traD...8217~ ~ 4 !!&f 5,806-----p:g6F . ,1 150 l,303 1,951 RT-33. 460 99 97 150 114 T-6. 9,733 l,2B1 2,928 2,416 3,108 T-33 . 3, l53 795 838 887 633 OURKEY 124