WorldWideScience

Sample records for vienna pee dee

  1. Inventory and Monitoring Plan for Pee Dee National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The purpose of this Inventory and Monitoring Plan (IMP) is to describe and recommend what natural resource surveys will be conducted at the Pee Dee National Wildlife...

  2. Pee Dee National Wildlife Refuge: Comprehensive Conservation Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This Comprehensive Conservation Plan (CCP) was written to guide management on Pee Dee National Wildlife Refuge for the next 15 years. This plan outlines the Refuge...

  3. Freshwater Mussel Surveys Of The Pee Dee River Basin in South Carolina

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Pee Dee River Basin is a major drainage of the Atlantic slope in the southeastern United States. The 10,755 sq mile drainage area incorporates portions of...

  4. Indians, slaves, and freedmen in the the Pee Dee region of South Carolina

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This record is an unpublished report about the history of Native Americans, slaves and freedmen in the Pee Dee. It is a historical report but intended for use as...

  5. Hydraulic model and flood-inundation maps developed for the Pee Dee National Wildlife Refuge, North Carolina

    Science.gov (United States)

    Smith, Douglas G.; Wagner, Chad R.

    2016-04-08

    A one-dimensional step-backwater model was developed by the U.S. Geological Survey (USGS) in cooperation with the U.S. Fish and Wildlife Service, Pee Dee National Wildlife Refuge, North Carolina, to provide a means for predicting flood-plain inundation. The model was developed for selected reaches of the Pee Dee River, Brown Creek, and Rocky River, using the U.S. Army Corps of Engineers Hydrologic Engineering Center River Analysis System (HEC-RAS) software. Multiple cross sections were defined on each modeled stream, and hydrologic data were collected between August 2011 and August 2013 at selected locations on the Pee Dee River and on its tributaries Brown Creek, Rocky River, and Thoroughfare Creek. Cross-section, stage, and flow data were used to develop the model and simulate water-surface profiles at 1.0-foot increments at the USGS streamgage Pee Dee River at Pee Dee Refuge near Ansonville, N.C. The profiles were produced for 31 selected water levels that ranged from approximately 193.0 feet to 223.0 feet in elevation at the Pee Dee River at Pee Dee Refuge streamgage.

  6. Biomonitoring of Environmental Status and Trends (BEST) Program: Environmental contaminants, health indicators, and reproductive biomarkers in fish from the Mobile, Apalachicola-Chattahoochee-Flint, Savannah, and Pee Dee River Basins

    Science.gov (United States)

    Hinck, Jo Ellen; Blazer, Vicki; Denslow, Nancy D.; Echols, Kathy R.; Gale, Robert W.; May, Tom W.; Claunch, Rachael; Wieser, Carla; Anderson, Patrick J.; Coyle, James J.; Gross, Timothy S.; Tillitt, Donald E.

    2007-01-01

    Largemouth bass (Micropterus salmoides) and common carp (Cyprinus carpio) were collected from 13 sites in 4 river basins in the southeastern United States to document spatial trends in accumulative contaminants, health indicators, and reproductive biomarkers. Organochlorine residues, 2,3,7,8- tetrachlorodibenzo-p-dioxin-like activity (TCDD-EQ), and elemental contaminants were measured in composite samples of whole fish, grouped by species and gender, from each site. Fish were field-examined for external and internal anomalies, selected organs were weighed to compute somatic indices, and tissue and fluid samples were preserved for fish health and reproductive biomarker analyses. Mercury concentrations in bass samples from all sites exceeded toxicity thresholds for mammals [>0.1 micrograms per gram wet weight (ug/g ww)], fish (>0.2 ug/g ww), and birds (>0.3 ug/g ww) and were greatest (>0.5 ug/g ww) in samples from the Alabama River at Eureka Landing, Alabama; the Mobile River at Bucks, Alabama; the Apalachicola River at Blountstown, Florida; the Savannah River at Sylvania, Georgia; and the Pee Dee River at Bucksport, South Carolina. Selenium concentrations were relatively high (>0.75 ug/g ww) in fish from the Tombigbee River at Lavaca, Alabama; the Mobile River at Bucks; and the Chattahoochee River at Omaha, Georgia compared to those from other sites. Concentrations of 2,2-bis (p-chlorophenyl)- 1,1-dichloroethylene (p,p'-DDE) were high in fish from the Chattahoochee River at Omaha and the Mobile River near Bucks, which was near a 2,2-bis (p-chlorophenyl)-1,1- dichloroethylene (DDT) formulating facility that historically discharged into the lower Mobile River. Toxaphene concentrations in fish from the Flint River near Albany, Georgia (60-100 nanograms per gram (ng/g) ww) may pose a risk to fish. Concentrations of other formerly used (total chlordanes, dieldrin, endrin, aldrin, mirex, and hexachlorobenzene) and currently used (pentachlorobenzene, pentachloroanisole

  7. Hazardous Material / Waste Site Assessment: US 701 Bridge Replacement Project Over the Great Pee Dee River, Pee Dee River Overflow, and Lake Yauhannah Horry & Georgetown Counties, South Carolina

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This record is an unpublished report evaluating the hazardous material / waste management impacts of a future bridge replacement project on highway 701 at Yauhannah...

  8. One dee at a time

    CERN Multimedia

    2008-01-01

    In July, the four endcap modules of the CMS electromagnetic calorimeter were lowered underground and installed in the experimental cavern. Each dee is divided into two quadrants made up of 5 x 5 crystal blocks called supercrystals. Each block weighs some 45 kilograms. The dees (so called because of their shape) are positioned in pairs around the beam pipe, forming two discs closing the barrel calorimeter (see Bulletin nº 43/44 from October 2007). The electromagnetic calorimeter will measure the energies of electrons, positrons and photons. Due to the extreme fragility of the 15,000 crystals that make up the dees (see Bulletin nº 18/19 from April 2008), the technicians have had to work with the greatest caution. The dees were transported from the assembly site in Prévessin to the experiment site at a speed of 5 kilometres per hour, before dawn to avoid disrupting the traffic. To watch the video of the installation, go to http://cd...

  9. CMS ECAL Endcap (EE) Dee Assembly - SC mounting on Dee 1

    CERN Multimedia

    Cockerill, D

    2007-01-01

    Protection panels on back of Dee 1, Completion of SC mounting, 03/10/2007: Completion of SC mounting (aart from the inner 3-2-1)on the first quadrant of Dee 1 and subsequent survey. 22-28/08/2007: The first supercrystals on Dee1, Dee1 in 867 with the first column of SCs ready for mounting, Dee1 with its protection panels over the laser monitoring fibre system

  10. Relating stream function and land cover in the Middle Pee Dee River Basin, SC

    Directory of Open Access Journals (Sweden)

    A.D. Jayakaran

    2016-03-01

    New hydrological insights for the region: Modifications to the landscape, hydrologic regime, and alteration to channel morphology, are major threats to the functioning of riparian ecosystem functions but can rarely be linked to a single common stressor. Results from the study showed that in the MPDRB, wetland cover in the riparian corridor was an important factor, correlating significantly with stream flashiness, channel enlargement, and bed substrate character. It was also shown that a combination of stream geomorphological characteristics when combined with landscape variables at specific spatial scales were reasonable predictors of all three indices of streamflow. The study also highlights an innovative statistical methodology to relate land cover data to commonly measured metrics of streamflow and fluvial geomorphology.

  11. Vienna - Chicago

    Science.gov (United States)

    Luan, Xianghong; Diekwisch, Thomas G.H.

    2009-01-01

    The discussion over the roles of genes and environment on the phenotypical specification of organisms has held a central role in science philosophy since the late 19th century and has re-emerged in today’s debate over genetic determinism and developmental plasticity. In fin-de-siecle Vienna, this debate coincided with a philosophical debate over empiricism/materialism versus idealism/vitalism. Turn-of-the-century Vienna’s highly interdisciplinary environment was also the birthplace for the model system of the unopposed molar. The un-opposed molar system features new tissue formation at the roots of teeth and tooth drift once opposing teeth are lost. The un-opposed molar model system was revived by a group of Viennese scientists that left Vienna during the Nazi period to address Vienna’s questions about evolution and heredity and about genes and environment in Chicago’s post-WWII scientific exile community. Here we are using the colorful history of the un-opposed molar to investigate the role of culture and method in the scientific evolution of a model system. PMID:17621674

  12. Tribute to Dr Dee McGonigle

    National Research Council Canada - National Science Library

    Jack Yensen

    2014-01-01

      In all that time, Dee has been an exemplar of an enthusiast and advocate for nursing and health informatics and has consistently shown unflagging energy, commitment and drive in pursuit of a flagship...

  13. Communal peeing: a new mode of flood control in ants

    Science.gov (United States)

    Maschwitz, Ulrich; Moog, J.

    The behavioral response of the obligate bamboo-nesting ant Cataulacus muticus to nest flooding was studied in a perhumid tropical rainforest in Malaysia and in the laboratory. The hollow internodes of giant bamboo, in which C. muticus exclusively nests, are prone to flooding by heavy rains. The ants showed a two-graded response to flooding. During heavy rain workers block the nest entrances with their heads to reduce water influx. However, rainwater may still intrude into the nest chamber. The ants respond by drinking the water, leaving the nest and excreting water droplets on the outer stem surface. This cooperative 'peeing' behavior is a new survival mechanism adaptive to the ants' nesting ecology. Laboratory experiments conducted with two other Cataulacus species, C. catuvolcus colonizing small dead twigs and C. horridus inhabiting rotten wood, did not reveal any form of water-bailing behavior.

  14. Poly Ethoxy Ethyl Glycinamide (PEE-G) Dendrimers: Dendrimers Specifically Designed for Pharmaceutical Applications.

    Science.gov (United States)

    Toms, Steven; Carnachan, Susan M; Hermans, Ian F; Johnson, Keryn D; Khan, Ashna A; O'Hagan, Suzanne E; Tang, Ching-Wen; Rendle, Phillip M

    2016-08-05

    Poly ethoxy ethyl glycinamide (PEE-G) dendrimers have been specifically designed and synthesized with the aim of providing a readily available dendrimer scaffold that can be used to make products that can meet the stringent requirements of pharmaceutical applications. The synthesis has been refined to produce dendrimers that are of high HPLC purity. The suitability of PEE-G dendrimers for their designed use has been verified by subsequent measurements to demonstrate that they are of high stability, high aqueous solubility, low cytotoxicity, low immunogenicity and with low in vivo toxicity in an escalating-dose rat study. PEE-G dendrimers therefore provide a useful scaffold for researchers wanting to develop dendrimer-based drug candidates. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. VFC: The Vienna Fortran Compiler

    Directory of Open Access Journals (Sweden)

    Siegfried Benkner

    1999-01-01

    Full Text Available High Performance Fortran (HPF offers an attractive high‐level language interface for programming scalable parallel architectures providing the user with directives for the specification of data distribution and delegating to the compiler the task of generating an explicitly parallel program. Available HPF compilers can handle regular codes quite efficiently, but dramatic performance losses may be encountered for applications which are based on highly irregular, dynamically changing data structures and access patterns. In this paper we introduce the Vienna Fortran Compiler (VFC, a new source‐to‐source parallelization system for HPF+, an optimized version of HPF, which addresses the requirements of irregular applications. In addition to extended data distribution and work distribution mechanisms, HPF+ provides the user with language features for specifying certain information that decisively influence a program’s performance. This comprises data locality assertions, non‐local access specifications and the possibility of reusing runtime‐generated communication schedules of irregular loops. Performance measurements of kernels from advanced applications demonstrate that with a high‐level data parallel language such as HPF+ a performance close to hand‐written message‐passing programs can be achieved even for highly irregular codes.

  16. Kant and Eastern Europe in Vienna 2015

    Directory of Open Access Journals (Sweden)

    Sandra Zákutná

    2016-11-01

    Full Text Available The text deals with the theme of Kant and Eastern Europe at the University of Vienna in 2015. Except the section of contributions to the theme “Kant and Eastern Europe” at the 12th International Kant Congress, it focuses on other activities of the organizers connected with the theme, namely the exhibition and publication “Detours. Approaches to Immanuel Kant in Vienna, in Austria, and in Eastern Europe”.

  17. The ViennaRNA web services.

    Science.gov (United States)

    Gruber, Andreas R; Bernhart, Stephan H; Lorenz, Ronny

    2015-01-01

    The ViennaRNA package is a widely used collection of programs for thermodynamic RNA secondary structure prediction. Over the years, many additional tools have been developed building on the core programs of the package to also address issues related to noncoding RNA detection, RNA folding kinetics, or efficient sequence design considering RNA-RNA hybridizations. The ViennaRNA web services provide easy and user-friendly web access to these tools. This chapter describes how to use this online platform to perform tasks such as prediction of minimum free energy structures, prediction of RNA-RNA hybrids, or noncoding RNA detection. The ViennaRNA web services can be used free of charge and can be accessed via http://rna.tbi.univie.ac.at.

  18. The Royal Typographer and the Alchemist: John Dee, Willem Silvius, and the Diagrammatic Alchemy of the Monas Hieroglyphica.

    Science.gov (United States)

    Clucas, Stephen

    2017-05-01

    John Dee's Monas Hieroglyphica (1564) was a work which involved a close collaboration between its author and his "singular friend" the Antwerp printer Willem Silvius, in whose house Dee was living whilst he composed the work and saw it through the press. This article considers the reasons why Dee chose to collaborate with Silvius, and the importance of the intellectual culture - and the print trade - of the Low Countries to the development of Dee's outlook. Dee's Monas was probably the first alchemical work which focused exclusively on the diagrammatic representation of the alchemical process, combining diagrams, cosmological schemes, and various forms of tabular grid. It is argued that in the Monas the boundaries between typography and alchemy are blurred as the diagrams "anatomising" his hieroglyphic sign (the "Monad") are seen as revealing truths about alchemical substances and processes.

  19. How Can We Explain Poverty? Case Study of Dee Reveals the Complexities

    Science.gov (United States)

    Seccombe, Karen

    2011-01-01

    Many theories have been offered to explain why people are impoverished. This article by Karen Seccombe uses the case study of "Dee," a newly single mother, to explore four of the most common: individualism, social structuralism, the culture of poverty, and fatalism. She concludes that poverty is a highly complex phenomenon, and it is likely that…

  20. 46 CFR 160.052-3a - Materials-Dee ring and snap hook assemblies and other instruments of closure for buoyant vests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials-Dee ring and snap hook assemblies and other... Materials—Dee ring and snap hook assemblies and other instruments of closure for buoyant vests. (a) Specifications. Dee ring and snap hook assemblies and other instruments of closure for buoyant vests may have...

  1. 46 CFR 160.060-3a - Materials-Dee ring and snap hook assemblies and other instruments of closure for buoyant vests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials-Dee ring and snap hook assemblies and other....060-3a Materials—Dee ring and snap hook assemblies and other instruments of closure for buoyant vests. (a) Specifications. Dee ring and snap hook assemblies and other instruments of closure for buoyant...

  2. 46 CFR 160.047-3a - Materials-Dee ring and snap hook assemblies and other instruments of closure for buoyant vests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials-Dee ring and snap hook assemblies and other... Materials—Dee ring and snap hook assemblies and other instruments of closure for buoyant vests. (a) Specifications. Dee ring and snap lock assemblies and other instruments of closure for buoyant vests may have...

  3. Application of the PEE Model to essay composition in an IELTS preparation class

    Directory of Open Access Journals (Sweden)

    Ender Orlando Velasco Tovar

    2015-01-01

    Full Text Available Based on two case studies, this study investigates the application of the Point, Explanation, Example (PEE model to essay composition in a multi-lingual IELTS preparation class. This model was incorporated into an eight-week programme of instruction to ESL adults in London, England. Students preparing for the IELTS exam were asked to write pre and post instruction essays on a given topic within 40 minutes. Employing the IELTS band descriptors (IELTS, 2013b and analyses of coherence and cohesion in line with Systemic Functional Linguistic concepts (Halliday and Matthiessen, 2004; McCarthy, 1991, samples of students’ writing were analysed. Data from students’ pre and post instruction interviews was also gathered and analysed. The findings of this study suggest that the PEE model is to some extent effective in improving the essay composition performance of IELTS students, in particular in the area of cohesion and coherence. Students find the PEE model useful in regard to the clarity and structure that the model seems to add to their essays.

  4. Heatwaves in Vienna: effects on mortality.

    Science.gov (United States)

    Hutter, Hans-Peter; Moshammer, Hanns; Wallner, Peter; Leitner, Barbara; Kundi, Michael

    2007-01-01

    The hot summer of 2003 brought about increased mortality in southern and western Europe, highlighting the health impact of heatwaves. No Austrian mortality data have yet been reported for this summer period. Daily mortality data for Vienna between 1998 and 2004 were obtained from Statistics Austria and meteorological data from the Austrian Central Institute for Meteorology and Geodynamics. Heatwaves were defined using the Kysely criterion. Daily mortality for May to September was predicted by a generalized additive model considering over-dispersion with Poisson deviates and a log link. Seasonal trend was accounted for by a natural spline, weekdays were modeled by dummy variables and heatwave days were included as dichotomous predictor. The average seasonal temperature for May to September in Vienna has increased by more than 1.7 degrees C during the last 35 years. In 2003 there was an excess of heatwave days, 44 overall, that resulted in an increased number of deaths, approximately 180, most of which were not due to 'harvesting'. Heatwave days between 1998 and 2004 were associated with a significantly increased relative mortality risk of 1.13 [95% confidence interval 1.09-1.17]. This increase was stronger in females than in males. Although excess mortality was seen in all age groups, it reached significance only in the elderly population over 65 years. An impact of heatwaves on mortality was apparent in Vienna, although not as pronounced as in France and south-western Europe. In 2003 at least 130 heatwave-related deaths in Vienna could have been avoided by prompt medical assistance and proper advice about how to cope with excessive thermal conditions. Preventive programs are warranted during heatwaves, especially to target elderly people, because the likelihood of heatwaves as a consequence of global warming is increasing.

  5. PEE-PEO block copolymer exchange rate between micelles is detergent and temperature activated

    Science.gov (United States)

    Schantz, Allen; Saboe, Patrick; Lee, Hee-Young; Sines, Ian; Butler, Paul; Bishop, Kyle; Maranas, Janna; Kumar, Manish

    We examine the kinetics of polymer chain exchange between polymer/detergent micelles, a system relevant to the synthesis of protein-containing biomimetic membranes. Although chain exchange between polymer aggregates in water is too slow to observe, adding detergent allows us to determine chain exchange rates using time-resolved small-angle neutron scattering (TR-SANS). We examine a membrane-protein-relevant, vesicle-forming ultra-short polymer, Poly(ethyl ethylene)20-Poly(ethylene oxide)18 (PEE20-PEO18). PEE20-PEO18 is solubilized in mixed micelles with the membrane-protein-compatible non-ionic detergent octyl- β -D-glucoside (OG). We show that OG activates block copolymer exchange, and obtain rate constants at two detergent concentrations above the CMC (critical micellar concentration) of OG. We find that chain exchange increases two orders of magnitude when temperature increases from 308 to 338 K, and that even a 1 mg/mL increase in OG concentration leads to a noticeable increase in exchange rate. We also calculate the activation energy for chain exchange and find that it is much higher than for lipid exchange. These findings explain the need for high detergent concentration and/or temperature to synthesize densely packed polymer/protein membranes.

  6. ViennaRNA Package 2.0

    Directory of Open Access Journals (Sweden)

    Lorenz Ronny

    2011-11-01

    Full Text Available Abstract Background Secondary structure forms an important intermediate level of description of nucleic acids that encapsulates the dominating part of the folding energy, is often well conserved in evolution, and is routinely used as a basis to explain experimental findings. Based on carefully measured thermodynamic parameters, exact dynamic programming algorithms can be used to compute ground states, base pairing probabilities, as well as thermodynamic properties. Results The ViennaRNA Package has been a widely used compilation of RNA secondary structure related computer programs for nearly two decades. Major changes in the structure of the standard energy model, the Turner 2004 parameters, the pervasive use of multi-core CPUs, and an increasing number of algorithmic variants prompted a major technical overhaul of both the underlying RNAlib and the interactive user programs. New features include an expanded repertoire of tools to assess RNA-RNA interactions and restricted ensembles of structures, additional output information such as centroid structures and maximum expected accuracy structures derived from base pairing probabilities, or z-scores for locally stable secondary structures, and support for input in fasta format. Updates were implemented without compromising the computational efficiency of the core algorithms and ensuring compatibility with earlier versions. Conclusions The ViennaRNA Package 2.0, supporting concurrent computations via OpenMP, can be downloaded from http://www.tbi.univie.ac.at/RNA.

  7. Model of Dees and Rotco for the 600 MeV SC

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

  8. The Ideal of a Knowledge Society in Dee's Monas Hieroglyphica (1564) and Other Productions by Willem Silvius.

    Science.gov (United States)

    Vanden Broecke, Steven

    2017-05-01

    It is well known that John Dee presented the Monas Hieroglyphica (1564) as the basis for a wholesale transformation of early modern knowledge culture - a claim that raises obvious issues of epistemic credibility. This paper discusses the social techniques that Dee proposed as a solution to these issues. First, our reconstruction of the "socio-epistemic imaginary" that Dee conveyed in the Monas shows how the marriage between a traditional rhetoric of secrecy and a courtly politicising of natural philosophy allowed Dee to invent social distinctions between credible and false purveyors of true knowledge. Second, a comparison with Willem Silvius's other scientific print productions of the 1560s shows how Dee's socio-epistemic solutions to the problem of knowledge were also promoted by local Galenic physicians taking in hand the challenges of the medical marketplace. However, it also had to contend with alternative socio-epistemic imaginaries, promoted by Paracelsian physicians and more lowly alchemists, which primarily defined knowledge communities as moral communities of Christian charity.

  9. ECG manifestations of multiple electrolyte imbalance: peaked T wave to P wave ("tee-pee sign").

    Science.gov (United States)

    Johri, Amer M; Baranchuk, Adrian; Simpson, Christopher S; Abdollah, Hoshiar; Redfearn, Damian P

    2009-04-01

    The surface electrocardiogram (ECG) is a useful instrument in the detection of metabolic disturbances. The accurate characterization of these disturbances, however, may be considerably more difficult when more than one metabolic abnormality is present in the same individual. While "classic" ECG presentations of common electrolyte disturbances are well described, multiple electrolyte disturbances occurring simultaneously may generate ECG abnormalities that are not as readily recognizable. We report a case of hyperkalemia, with concurrent hypocalcemia and hypomagnesemia resulting in (1) peaking of the T wave, (2) a prominent U wave, and (3) prolongation of the descending limb of the T wave such that it overlapped with the next P wave. In this particular ECG from a patient with combined electrolyte imbalance, we have dubbed the unusual appearance of the segment between the peak of the T wave to the next P wave as the "tee-pee" sign.

  10. Transient controls on estuarine SPM fluxes: case study in the Dee Estuary, UK.

    Science.gov (United States)

    Amoudry, Laurent; Williams, Megan; Todd, David

    2017-04-01

    Estuaries are a critical interface between land and coastal ocean across which freshwater, suspended particulate matter (SPM), and consequently terrestrial carbon, nutrients and anthropogenic contaminants are exchanged. Suspended particulate matter is closely linked to estuarine turbidity; it affects water quality and estuarine ecology; and it contributes to overall estuarine sediment budgets. However, predicting the response of estuarine ecosystems to climate change and human interventions remains difficult partly due to a lack of comprehensive understanding of SPM concentrations and fluxes across time scales from intratidal to seasonal and interannual variability. We investigate the dynamics of suspended sediment and suspended particulate matter in a hypertidal estuary with a maximum tidal range in excess of 10 m and tidal currents reaching over 1 m/s: the Dee Estuary. This estuary is located in northwest England and outflows in Liverpool Bay, itself in the eastern Irish Sea. The Dee Estuary is a funnel-shaped, coastal plain estuary, which is about 30 km long with a maximum width of 8.5 km at the mouth, and consists of mixed sediments. We focus on field observations, collected during several campaigns in the channels of the Dee Estuary from 2004 to 2009 using acoustic and optical instrumentation, which provide intratidal measurements of flow velocity and suspended sediment, and thus sediment fluxes, over approximately a month. Measurements in February-March 2008 highlight three distinct hydrodynamic regimes: a current dominant regime at neap tides (14-21 February); a combined wave-current regime at spring tides (21-29 February); and a wave dominant regime at neap tide (1-4 March). While analysis of tidal distortion and dominance predicts weak ebb dominant channels, the observations yield flood dominant sediment transport. The net sediment flux exhibits a two-layer structure - import near the bed, export near the surface - that is consistent with the residual

  11. Diagenesis of Malmian Marlstones, Vienna Basin

    Science.gov (United States)

    Schicker, A.; Gier, S.

    2009-04-01

    Burial diagenetic processes of pelitic sediments have been the subject of mineralogical investigations in Tertiary basins all over the world. Because of oil exploration, the investigations were focused on the Gulf Coast region in the United States. The diagenetic reaction from smectite to illite can be related to petroleum migration processes. The aim of this study is to characterize the diagenetic development of the Jurassic marls of the Mikulov Formation in the Vienna Basin. The Vienna Basin is located in the NE part of Austria and extends into Slovakia and the Czech Republic. It is a Tertiary pull-apart basin along the junction of the Eastern Alps and the Western Carpathians. The evolution of the basin started during the early Miocene with subsidence along NE trending sinistral faults. It is underlain by alpine thrusted nappes and autochthonous Mesozoic sediments. The clay mineralogy of 46 core samples from nine different wells was analyzed with X-ray diffraction and quantified. The wells penetrate the Mikulov Formation over a depth range of 1000 m to 8500 m which gives a unique opportunity to study the diagenetic changes of one formation from shallow to deep burial. Also, by following a single formation to depth, it is possible to minimize variations which might result from differences in provenance and depositional environment. For separation of the < 2 µm fraction the carbonate was dissolved with a 0.1 M EDTA-solution before sedimentation. The clay fraction contains a prominent illite/smectite (I/S) mixed-layer mineral, illite, chlorite and kaolinite. The amounts of I/S and kaolinite decrease with depth, illite and chlorite increase with depth. A diagenetic overprint was revealed, involving a gradual transformation of smectite to illite through mixed-layer I/S intermediates. The illite content in I/S ranges from 25% for the shallowest sample to 90% for the deepest sample. The ordering of the mixed layer I/S changes with increasing depth from R0 (25% illite

  12. The construction of the CMS electromagnetic calorimeter: delivery of the 3rd and 4th endcap "Dees" and Ring Flanges to CERN

    CERN Multimedia

    2006-01-01

    Delivery of the 3rd and 4th Dees and Ring Flanges of the CMS-ECAL endcaps to CERN. The pictures show also an endcap crystal with its VPT (Vacuum PhotoTriode), the aluminium blackplates of the endcap Dees and four mock supercrystals (5x5 crystals) attached in their position on the backplate, along with 138 positional spacers. Finally, endcap assembly in the CMS construction hall in Cessy (neighbouring France) is also shown.

  13. Acoustic mechanisms of a species-based discrimination of the chick-a-dee call in sympatric black-capped (Poecile atricapillus and mountain chickadees (P. gambeli

    Directory of Open Access Journals (Sweden)

    Lauren M Guillette

    2010-12-01

    Full Text Available Previous perceptual research with black-capped and mountain chickadees has demonstrated that these species treat each other’s namesake chick-a-dee calls as belonging to separate, open-ended categories. Further, the terminal dee portion of the call has been implicated as the most prominent species marker. However, statistical classification using acoustic summary features suggests that all note-types contained within the chick-a-dee call should be sufficient for species classification. The current study seeks to better understand the note-type based mechanisms underlying species-based classification of the chick-a-dee call by black-capped and mountain chickadees. In two, complimentary, operant discrimination experiments, both species were trained to discriminate the species of the signaller using either entire chick-a-dee calls, or individual note-types from chick-a-dee calls. In agreement with previous perceptual work we find that the D note had significant stimulus control over species based discrimination. However, in line with statistical classifications, we find that all note-types carry species information. We discuss reasons why the most easily discriminated note-types are likely candidates to carry species based cues.

  14. Estimation of the sustainable geothermal potential of Vienna

    Science.gov (United States)

    Tissen, Carolin; Benz, Susanne A.; Keck, Christiane A.; Bayer, Peter; Blum, Philipp

    2017-04-01

    Regarding the limited availability of fossil fuels and the absolute necessity to reduce CO2 emissions in order to mitigate the worldwide climate change, renewable resources and new energy systems are required to provide sustainable energy for the future. Shallow geothermal energy holds a huge untapped potential especially for heating and hot water, which represent up to 50% of the global energy demand. Previous studies quantified the capacity of shallow geothermal energy for closed and open systems in cities such as Vienna, London (Westminster) and Ludwigsburg in Germany. In the present study, these approaches are combined and also include the anthropogenic heat input by the urban heat island (UHI) effect. The objective of the present study is therefore to estimate the sustainable geothermal potential of Vienna. Furthermore, the amount of energy demand for heating and hot water that can be supplied by open and closed geothermal systems will be determined. The UHI effect in Vienna is reflected in higher ground water temperatures within the city centre (14 ˚ C to 18 ˚ C) in comparison to lower ones in rural areas (10 ˚ C to 13 ˚ C). A preliminary estimation of the anthropogenic heat flow into the ground water caused by elevated basement temperatures and land surface temperatures is 3,5 × 108 kWh/a. This additional heat flow leads to a total geothermal potential which is 2.5 times larger than the estimated annual energy demand for heating and hot water in Vienna.

  15. A New Campus of Vienna University of Economics and Business

    Directory of Open Access Journals (Sweden)

    Tsyredar Dagdanova

    2016-11-01

    Full Text Available The article deals with the issues of building of modern university campuses through the example of a new campus of Vienna University of Economics and Business – a successful project that facilitates the improvement of education quality and provides conditions for harmonious development of the individual.

  16. Boys who pee the farthest have a large hollow head, a thin skin, and medium-size manhood

    Science.gov (United States)

    Attinger, Daniel; Lee, Vincent

    2016-11-01

    Following a recent trend of scientific studies on artwork, we study here the thermodynamics of a jetting thermometer made of ceramic, related to the Chinese tea culture. The thermometer represents a boy who "urinates" shortly after hot water is poured onto his head. Long jetting distance indicates if the water temperature is hot enough to brew tea. Here, a thermofluid model describes the jetting phenomenon of that pee-pee boy. The study demonstrates how thermal expansion of an interior air pocket causes jetting. The validity of assumptions underlying the Hagen-Poiseuille flow is discussed for urethra of finite length. A thermodynamic potential is shown to define maximum jetting velocity. Seven optimization criteria to maximize jetting distance are provided, including two dimensionless numbers. The dimensionless numbers are obtained by comparing the time scales of the internal pressure buildup due to heating, with that of pressure relief due to jetting. Optimization results show that longer jets are produced by large individuals, with low body mass index, with a boyhood of medium size inclined at an angle π/4. Analogies are drawn with pissing contests among humans and lobsters. The study ends by noting similitudes of working principle between that politically incorrect thermometer and Galileo Galilei's thermoscope.

  17. Analysis of large Danube flood events at Vienna since 1700

    Science.gov (United States)

    Kiss, Andrea; Blöschl, Günter; Hohensinner, Severin; Perdigao, Rui

    2014-05-01

    Whereas Danube water level measurements are available in Vienna from 1820 onwards, documentary evidence plays a significant role in the long-term understanding of Danube hydrological processes. Based on contemporary documentary evidence and early instrumental measurements, in the present paper we aim to provide an overview and a hydrological analysis of major Danube flood events, and the changes occurred in flood behaviour in Vienna in the last 300 years. Historical flood events are discussed and analysed according to types, seasonality, frequency and magnitude. Concerning historical flood events we apply a classification of five-scaled indices that considers height, magnitude, length and impacts. The rich data coverage in Vienna, both in terms of documentary evidence and early instrumental measurements, provide us with the possibility to create a relatively long overlap between documentary evidence and instrumental measurements. This makes possible to evaluate and, to some extent, improve the index reconstruction. While detecting causes of changes in flood regime, we aim to provide an overview on the atmospheric background through some characteristic examples, selected great flood events (e.g. 1787). Moreover, we also seek for the answer for such questions as in what way early (pre-instrumental period) human impact such as water regulations and urban development changed flood behaviour in the town, and how much it might have an impact on flood classification.

  18. Accident scenarios of the TRIGA Mark II reactor in Vienna

    Energy Technology Data Exchange (ETDEWEB)

    Villa, Mario, E-mail: mvilla@ati.ac.a [Vienna University of Technology, Atominstitut, Stadionallee 2, 1020 Wien (Austria); Haydn, Markus [Vienna University of Technology, Atominstitut, Stadionallee 2, 1020 Wien (Austria); Steinhauser, Georg, E-mail: georg.steinhauser@ati.ac.a [Vienna University of Technology, Atominstitut, Stadionallee 2, 1020 Wien (Austria); Boeck, Helmuth [Vienna University of Technology, Atominstitut, Stadionallee 2, 1020 Wien (Austria)

    2010-12-15

    The safety report of the TRIGA Mark II reactor in Vienna includes three accident scenarios and their deterministic dose consequences to the environment. The destruction of the cladding of the most activated fuel element, the destruction of all fuel elements and a plane crash were considered scenarios in that report. The calculations were made in 1978 with the software program named STRISK. In this paper, the program package PC Cosyma was applied on the TRIGA Mark II reactor in Vienna and the deterministic consequences of the scenarios to the environment were updated. The fission product inventories of all fuel elements were calculated with ORIGEN2. To get meteorological data of the atmospheric condition around the release area, a weather station was installed. The release parameters were taken from the safety report or were replaced by worst case parameters. This paper focuses on two accident scenarios: the destruction of the cladding of the fuel element with the highest activity content and the case of a large plane crash. The current accident scenarios show good agreement with the calculations from 1978, hence no technical modifications in the safety report of the TRIGA reactor Vienna were necessary. Even in the very worst case scenario - complete destruction of all fuel elements in a large plane crash - the expected doses in the Atominstitut's neighborhood remain moderate.

  19. Optimizing Urban Tree Soil Substrate for the City of Vienna

    Science.gov (United States)

    Murer, Erwin; Strauss, Peter; Schmidt, Stefan

    2015-04-01

    Many of the city garden managements in Central Europe encounter problems with the sustainable growing of trees in the cities. Tree root space is more and more limited by pavements and roads and is polluted by salt application during winter time. Thus, the life expectancy of the city trees is decreasing because the trees become more susceptible to diseases. Diseased trees are a safety risk. These challenges are additionally enforced by lower budgets to re-establish new trees. To actively react on this challenge a new soil substrate for city trees has been developed and tested combining cost effectiveness with improved characteristics for water retention and nutrient delivery on one side and drainage capabilities on the other side. The new substrate should be inexpensive, easy and simple to produce and well miscible. Therefore, easily available materials have been tested which are river sediments that are delivered by annual floods; compost produced by a city owned composting plant and low cost dolomite chippings from quarries near Vienna. The final composition of the new Vienna tree substrate consists of 3 mineral components and one organic component. These are mixed in a relationship of 4 parts dolomite chippings, 3 parts sand and 3 parts of fluvial fine sediment and 2 parts of compost. After a laboratory phase to develop the new substrate, field testing of the newly developed substrate is presently carried out in three different types of field experiments consisting of 20 implementation sites distributed over the city of Vienna, with annual checking for the growth of trees, 2 implementation sites with sensors to measure the water and salt balance and 6 city lysimeters with implementation of enhanced facilities to monitor substrate and water behaviour. These facilities will be used to relate the growing factors in connection with the site properties, to developing of a fertilizer recommendation for urban trees and to make tests for the compatibility of the trees

  20. Geodynamics in Modular Course System at Vienna High School

    Science.gov (United States)

    Pitzl-Reinbacher, Robert

    2017-04-01

    In Austria there are currently some major reforms concerning high school education underway. At our school, the Bundesgymnasium and Bundesrealgymnasium Draschestrasse, a school belonging to the Vienna Bilingual Schooling branch, we have developed a course system in which pupils can select courses and determine individually which areas of study they want to focus on. Specially devised courses have been developed which fit within the framework of natural and applied sciences but go beyond the basic curriculum in physics. Geodynamics is the title of one of these courses, with an emphasis on weather, climate and geodynamic processes of the earth's crust. The course „The restless earth" deals specifically with plate tectonics, vulcanism, formation of mountains and processes such as ocean currents and the physics involved. Apart from theoretical basics we use manifold media and approaches concerning visualization: graphics, map data taken from Google Maps, satellite pictures, and others. The knowledge acquired in this course is broadened and consolidated by means of excursions to the Vienna Natural History Museum where additional instructional materials and visual aids are on display. Based on this experience pupils are requested to hold presentations (individually or in groups) at the end of the course.

  1. Report on botanical nomenclature—Vienna 2005. XVII International Botanical Congress, Vienna: Nomenclature Section, 12–16 July 2005

    Directory of Open Access Journals (Sweden)

    Christina Flann

    2015-02-01

    Full Text Available PrefaceThis is the official Report on the deliberations and decisions of the ten sessions of the Nomenclature Section of the XVII International Botanical Congress held in Vienna, Austria, from 12–16 July 2005. The meetings of the Section took place on these five consecutive days prior to the Congress proper. The Section meetings were hosted by the Institute of Botany, University of Vienna, Austria. Technical facilities included full electronic recording of all discussion spoken into the microphones. Text of all proposals to amend the Code was displayed on one screen allowing suggested amendments to be updated as appropriate. The team at the University of Vienna (Christopher Dixon, Jeong-Mi Park, Ovidiu Paun, Carolin A. Redernig and Dieter Reich ensured that the proceedings ran smoothly and enjoyably for all.A report of the decisions of the Section was published soon after the Congress (McNeill & al. in Taxon 54: 1057–1064. 2005. It includes a tabulation of the preliminary mail vote on the published proposals, specifying how the Section acted on each and detailing amendments and new proposals approved upon motions from the floor. It also includes the report of the Nominating Committee as well as the Congress resolution ratifying the Section’s decisions, neither reproduced here. The main result of the Section’s deliberations is the Vienna Code, which was published as Regnum Vegetabile 146, on 20 Sep 2006 (McNeill & al. in Regnum Veg. 146. 2006. It was also published online, on the same date (see http://www.iapt-taxon.org/nomen/main.php.The present report of the proceedings of the Vienna Nomenclature Section conveys, we believe, a true and lively picture of the event. It is primarily based on the MP3 electronic recordings, with, where necessary, supplementation by the comment slips submitted by most speakers and by reference to parallel tape-recording, particularly where there were gaps in the MP3 record. With these sources combined, and

  2. Analysis o Consular Affairs under the Vienna Convention (1963

    Directory of Open Access Journals (Sweden)

    Irisi TOPALLI

    2015-08-01

    Full Text Available Consular relations are based on the Vienna Convention on Consular Relations, signed on 24 April 1963 and entered into force four years later, in March of 1967. The preamble of the Convention on Consular Relations as content as well as form is very similar to Diplomatic Convention as part stems from it. This Convention is very detailed. It is divided into three chapters: the first chapter deals with consular relations in general and in two other chapters regulate the consular offices are headed respectively by career consuls (chapter two and they honor (chapter three. This topic will treat the appointment of consuls and the end of their functions, the consular functions and the consular immunity. The method used for the realization of this topic is that of the analysis and case studies.

  3. On the effect of Di-Ethyl-Ether (DEE) injection upon the cold starting of a biodiesel fuelled compression ignition engine

    Science.gov (United States)

    Clenci, Adrian; Niculescu, Rodica; Iorga-Simǎn, Victor; Tricǎ, Alina; Danlos, Amélie

    2017-02-01

    The use of biodiesel fuel in compression ignition engines has the potential to reduce CO2, which can lead to a reduction in global warming and environmental hazards. Biodiesel is an attractive fuel, as it is made from renewable resources. A major drawback associated with the use of biodiesel, however, is its poor cold flow properties, which have a direct influence on the cold starting performance of the engine. This paper is a consequence of a study on assessing the cold-starting performance of a compression ignition engine fueled with different blends of fossil diesel fuel and biodiesel. Through experimental investigations, it was found that the engine starting at -20°C was no longer possible in the case of using B50 (50% diesel + 50% biofuel made from sunflower oil). In order to "force" the engine starting in this particular situation, Di-Ethyl-Ether (DEE) was injected into the intake manifold. DEE being a highly flammable substance, the result was a sudden and explosive engine starting, the peak pressure in the monitored cylinder in the first successful engine cycle being almost twice the one which is usually considered as normal. Thus, to explain the observed phenomena, we launched this work relying on the analysis of the in-cylinder instantaneous pressure evolution, which was acquired during cranking, stabilizing and idling phases. Moreover, since the cause of the sudden and explosive engine starting was the DEE, by using a CFD approach, we also obtained results regarding the inter-cylinder distribution of the injected DEE.

  4. Complete Genome Sequences of Cluster A Mycobacteriophages BobSwaget, Fred313, KADY, Lokk, MyraDee, Stagni, and StepMih

    Science.gov (United States)

    Butela, Kristen A.; Gurney, Susan M. R.; LeBlanc-Straceski, Janine M.; Zimmerman, Anastasia M.; Conant, Stephanie B.; Freed, Nikki E.; Silander, Olin K.; Thomson, Joshua J.; Berkes, Charlotte A.; Bertolez, Cristina; Davies, Courtney G.; Elinsky, Amber; Hanlon, Alison J.; Nersesyan, Juliette; Patel, Payal; Sherwood, John; Tieu Ngo, Tiffany; Wisniewski, Kathryn A.; Yacoo, Kathrine; Arendse, Paul M.; Bowlen, Nathan W.; Cunmulaj, Jasmina; Downs, Julie L.; Ferrenberg, Charlee A.; Gassman, Alexandra E.; Gilligan, Cody E. R.; Gorkiewicz, Emily; Harness, Christopher; Huffman, Anthony; Jones, Christina; Julien, Anna; Kupic, Alexis E.; Latu, Sayonara F.; Manning, Thomas J.; Maxwell, Danielle; Meyer, Catherine E.; Reardon, Madeleine; Slaughter, Matthew; Swasey, Royce; Tennent, Rebecca I.; Torres, Victoria; Waller, Tamia; Worcester, Rachel M.; Yost, Brooke L.; Garlena, Rebecca A.; Jacobs-Sera, Deborah; Russell, Daniel A.; Hatfull, Graham F.

    2017-01-01

    ABSTRACT Seven mycobacteriophages from distinct geographical locations were isolated, using Mycobacterium smegmatis mc2155 as the host, and then purified and sequenced. All of the genomes are related to cluster A mycobacteriophages, BobSwaget and Lokk in subcluster A2; Fred313, KADY, Stagni, and StepMih in subcluster A3; and MyraDee in subcluster A18, the first phage to be assigned to that subcluster. PMID:29074662

  5. Effects of fruit thinning on fruit drop, leaf carbohydrates concentration, fruit carbohydrates concentration, leaf nutrient concentration and fruit quality in Pummelo cultivar Thong Dee

    OpenAIRE

    Pongnart Nartvaranant

    2016-01-01

    The effects of fruit thinning on fruit drop, leaf carbohydrates concentration, fruit carbohydrates concentration, leaf nutrient concentration and fruit quality in pummelo cultivar Thong Dee growing in Nakhon Pathom province, Thailand, were studied during January-August 2013. The results showed that 50% fruit thinning by hand at 1 month after fruit set increased percent of fruit retention throughout fruit development. At 2 month after fruit set, 50% fruit thinning gave 62% of fruit ...

  6. Gender, Politics, and Radioactivity Research in Interwar Vienna: The Case of the Institute for Radium Research

    National Research Council Canada - National Science Library

    Maria Rentetzi

    2004-01-01

    .... It argues that the politics of Red Vienna and the culture of radioactivity research specific to the Viennese setting encouraged exceptional gender politics within the Institute for Radium Research in the interwar years...

  7. MPC-SVM method for Vienna rectifier with PMSG used in Wind Turbine Systems

    DEFF Research Database (Denmark)

    Lee, June-Seok; Bak, Yeongsu; Lee, Kyo-Beum

    2016-01-01

    ) method for the Vienna rectifier used in WTS with a Permanent Magnet Synchronous Generator (PMSG). The proposed MPC method considers the feasible eight-voltage vectors of the Vienna rectifier. In addition, the voltage vectors, which are the center voltage vectors of two feasible adjacent voltage vectors......Using a Vienna rectifier as the machine-side rectifier of back-to-back converter is advantageous in terms of size and cost compared to three-level topologies and for this reason, the Vienna rectifier has been used in Wind Turbine Systems (WTS). This paper proposes a Model Predictive Control (MPC......, are taken into consideration to improve the performance of the MPC method. The optimized voltage vector for the ripple minimization of PMSG currents is determined by cost function. Then, the neutral-point voltage unbalancing problem is considered for selecting the final switching set, which is generated...

  8. FORUM: Enforcement Lessons from the Vienna Übahn.

    Science.gov (United States)

    SMITH

    1999-02-01

    / This paper combines a review of recent publications on the effectiveness of environmental enforcement in the United States with new data to address the question of what type of enforcement activity is most productive. Using data on 39 state National Pollutant Discharge Elimination System (NPDES) programs, the measures of effort and cost typically applied to environmental enforcement and inspection activities were tested for relationships with compliance outcomes. No statistically significant relationships were found. In the absence of any improving trend in traditional measures of compliance, this lack suggests all enforcement systems presently used by states are failing. To work, an environmental enforcement system needs to include maintenance and restoration of compliance, real deterrence, mobilization of public opinion, minimal obtrusiveness, conformity with legal search requirements, cost-effectiveness for all parties, effective primary role for skilled inspectors, self-monitoring, compatibility with environmental management systems (e.g., ISO 14000), environmental auditing, robustness in the face of changing strategies by permittees, segregation of technical assistance from enforcement, team orientation, adaptability to multimedia, and, most difficult of all, disconnection from today's timely, appropriate, proportionate standard. These goals can be achieved through a proposed new environmental enforcement approach built on infrequent, random, but thorough inspections leading to fully documented enforcement actions resulting in high penalties. The enforcement system used by the Vienna Übahn, or subway, can serve as a model for this type of environmental enforcement system. KEY WORDS: Enforcement; Deterrence; Environmental water quality; Discharge elimination systems

  9. "Dropbox-like" service for the University of Vienna

    CERN Multimedia

    CERN. Geneva

    2014-01-01

    The increasing popularity of dropbox and at the same time increasing awareness for data security did create the demand for an onsite "Dropbox-like" “sync and share” service at the University of Vienna. It has been decided that ownCloud would be a good start, since other academic institutions have been working on an ownCloud based solution as well. Based on ownCloud enterprise Version 6 the service is currently in test operation with campus wide availability for staff only planned for 12/2014. Major concerns were the scalability of the storage backend. So instead of using an enterprise storage solution we use Scality’s RING as backend. The RING is an object storage based solution using local storage nodes. Since the ownCloud architecture does so far not allow a RESTbased storage backend we use Scality’s FUSE connector to simulate a virtually limitless filesystem (POSIX). Based on the experiences reported by other academic facilities and our own, our main concerns have been database performance-scal...

  10. The risk of injury associated with body checking among Pee Wee ice hockey players: an evaluation of Hockey Canada's national body checking policy change.

    Science.gov (United States)

    Black, Amanda M; Hagel, Brent E; Palacios-Derflingher, Luz; Schneider, Kathryn J; Emery, Carolyn A

    2017-12-01

    In 2013, Hockey Canada introduced an evidence-informed policy change delaying the earliest age of introduction to body checking in ice hockey until Bantam (ages 13-14) nationwide. To determine if the risk of injury, including concussions, changes for Pee Wee (11-12 years) ice hockey players in the season following a national policy change disallowing body checking. In a historical cohort study, Pee Wee players were recruited from teams in all divisions of play in 2011-2012 prior to the rule change and in 2013-2014 following the change. Baseline information, injury and exposure data for both cohorts were collected using validated injury surveillance. Pee Wee players were recruited from 59 teams in Calgary, Alberta (n=883) in 2011-2012 and from 73 teams in 2013-2014 (n=618). There were 163 game-related injuries (incidence rate (IR)=4.37/1000 game-hours) and 104 concussions (IR=2.79/1000 game-hours) in Alberta prior to the rule change, and 48 injuries (IR=2.16/1000 game-hours) and 25 concussions (IR=1.12/1000 game-hours) after the rule change. Based on multivariable Poisson regression with exposure hours as an offset, the adjusted incidence rate ratio associated with the national policy change disallowing body checking was 0.50 for all game-related injuries (95% CI 0.33 to 0.75) and 0.36 for concussion specifically (95% CI 0.22 to 0.58). Introduction of the 2013 national body checking policy change disallowing body checking in Pee Wee resulted in a 50% relative reduction in injury rate and a 64% reduction in concussion rate in 11-year-old and 12-year-old hockey players in Alberta. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  11. VALD-2: Progress of the Vienna Atomic Line Data Base

    Science.gov (United States)

    Kupka, F.; Piskunov, N.; Ryabchikova, T. A.; Stempels, H. C.; Weiss, W. W.

    1999-07-01

    We describe the updated version of the Vienna Atomic Line Data Base (VALD, \\cite[Piskunov et al. 1995)]{pis95} which represents a considerable improvement over the first installation from 1994. The original line lists have been complemented with critically evaluated data obtained from experimental measurements and theoretical calculations which are necessary for computing state-of-the-art line opacities in stellar atmospheres, as well as for synthesizing spectra for high precision analyses. In this paper, we present new and improved data sets for neutral species and ions of Si, P, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Y, Zr, Ru, Xe, La, Ce, Pr, Nd, Sm, Eu, Gd, Dy, Ho, Er, Tm, Yb, Lu, Re, Pt, Au, Hg, and Pb. For some species data are available in VALD for the first time. We explain our choice of quality rankings by reviewing the literature for the new data and by comparison with source lists included into VALD. For some cases, we produced new line data by weighted averaging of data from different sources with individual error estimates in order to increase the reliability of VALD line lists. Software modifications allow remote users of VALD to specify individual extraction parameters as an alternative to the default settings of the VALD team and to have direct control over the quality ranking of line data. A World-Wide-Web interface is described which provides easy access to all new features. To simplify proper crediting of all authors of atomic data, VALD now includes a compilation of all publications used in each type of reply. Finally, we briefly discuss the future roadmap of VALD developments, including the incorporation of molecular transitions and integration with external data bases. http://www.astro.univie.ac.at/~vald http://www.astro.uu.se/~vald

  12. Extended effects of air pollution on cardiopulmonary mortality in Vienna

    Science.gov (United States)

    Neuberger, Manfred; Rabczenko, Daniel; Moshammer, Hanns

    BackgroundCurrent standards for fine particulates and nitrogen dioxide are under revision. Patients with cardiovascular disease have been identified as the largest group which need to be protected from effects of urban air pollution. MethodsWe sought to estimate associations between indicators of urban air pollution and daily mortality using time series of daily TSP, PM 10, PM 2.5, NO 2, SO 2, O 3 and nontrauma deaths in Vienna (Austria) 2000-2004. We used polynomial distributed lag analysis adjusted for seasonality, daily temperature, relative humidity, atmospheric pressure and incidence of influenza as registered by sentinels. ResultsAll three particulate measures and NO 2 were associated with mortality from all causes and from ischemic heart disease and COPD at all ages and in the elderly. The magnitude of the effect was largest for PM 2.5 and NO 2. Best predictor of mortality increase lagged 0-7 days was PM 2.5 (for ischemic heart disease and COPD) and NO 2 (for other heart disease and all causes). Total mortality increase, lagged 0-14 days, per 10 μg m -3 was 2.6% for PM 2.5 and 2.9% for NO 2, mainly due to cardiopulmonary and cerebrovascular causes. ConclusionAcute and subacute lethal effects of urban air pollution are predicted by PM 2.5 and NO 2 increase even at relatively low levels of these pollutants. This is consistent with results on hospital admissions and the lack of a threshold. While harvesting (reduction of mortality after short increase due to premature deaths of most sensitive persons) seems to be of minor importance, deaths accumulate during 14 days after an increase of air pollutants. The limit values for PM 2.5 and NO 2 proposed for 2010 in the European Union are unable to prevent serious health effects.

  13. Viennese art, ugliness, and the Vienna school of art history: the vicissitudes of theory and practice

    Directory of Open Access Journals (Sweden)

    Kathryn Simpson

    2010-12-01

    Full Text Available Around 1900 in Vienna, the concept of ugliness developed a new significance in both the theories of the Vienna school of art history and in the artistic practices of figures like Gustav Klimt, Oskar Kokoschka, and Egon Schiele. Implicitly rejecting the classical and philosophical associations between beauty and truth, the Viennese avant-garde after Klimt seemed to instead connect truth with ugliness. Others, by contrast, identified ugliness as the symptom of modern cultural degeneration. This essay analyses specific links between the theories and practices of ugliness in the Vienna school and in contemporaneous Viennese art, and examines how the concept of ugliness also functioned discursively as a trope to represent modernity, Jewishness, truth, or sickness.

  14. ER-2 #809 on the SAGE III Ozone Loss and Validation Experiment (SOLVE) with pilot Dee Porter prepari

    Science.gov (United States)

    2000-01-01

    Lockheed Martin pilot Dee Porter climbs up the ladder wearing a heavy tan pressure suit, preparing to board NASA ER-2 #809 at Kiruna, Sweden, for the third flight in the SAGE III Ozone Loss and Validation Experiment. Assisting him is Jim Sokolik, a Lockheed Martin life support technician. Number 809, one of Dryden's two high-flying ER-2 Airborne Science aircraft, a civilian variant of Lockheed's U-2, and another NASA flying laboratory, Dryden's DC-8, were based north of the Arctic Circle in Kiruna, Sweden during the winter of 2000 to study ozone depletion as part of the SAGE III Ozone Loss and Validation Experiment (SOLVE). A large hangar built especially for research, 'Arena Arctica' housed the instrumented aircraft and the scientists. Scientists have observed unusually low levels of ozone over the Arctic during recent winters, raising concerns that ozone depletion there could become more widespread as in the Antarctic ozone hole. The NASA-sponsored international mission took place between November 1999 and March 2000 and was divided into three phases. The DC-8 was involved in all three phases returning to Dryden between each phase. The ER-2 flew sample collection flights between January and March, remaining in Sweden from Jan. 9 through March 16. 'The collaborative campaign will provide an immense new body of information about the Arctic stratosphere,' said program scientist Dr. Michael Kurylo, NASA Headquarters. 'Our understanding of the Earth's ozone will be greatly enhanced by this research.' ER-2s bearing tail numbers 806 and 809 are used as airborne science platforms by NASA's Dryden Flight Research Center. The aircraft are platforms for a variety of high-altitude science missions flown over various parts of the world. They are also used for earth science and atmospheric sensor research and development, satellite calibration and data validation. The ER-2s are capable of carrying a maximum payload of 2,600 pounds of experiments in a nose bay, the main

  15. Vienna E-Lecturing (VEL): Learning How to Learn Self-Regulated in an Internet-Based Blended Learning Setting

    Science.gov (United States)

    Schober, Barbara; Wagner, Petra; Reimann, Ralph; Spiel, Christiane

    2008-01-01

    The article describes the "Vienna E-Lecturing" (VEL), a complex internet-based blended-learning setting developed for students at the University of Vienna (Austria). As part of the introduction to research methods in psychology, VEL aids in imparting factual knowledge regarding research methods and evaluation, as well as promotes…

  16. Viktor Lowenfeld: Portrait of a Young Art Teacher in Vienna in the 1930s

    Science.gov (United States)

    Leshnoff, Susan K.

    2013-01-01

    Viktor Lowenfeld (1903-1960), one of the most influential art educators of the 20th century and author of "Creative and Mental Growth" (1947, 1952, 1957), barely talked or wrote about his early teaching experiences at the Chajes Realgymnasium, a secondary school for Jewish youth in Vienna, where he taught art and math for 14 years before…

  17. The Vienna Frailty Questionnaire for Persons with Intellectual Disabilities--Revised

    Science.gov (United States)

    Brehmer-Rinderer, Barbara; Zeilinger, Elisabeth Lucia; Radaljevic, Ana; Weber, Germain

    2013-01-01

    Frailty is a theoretical concept used to track individual age-related declines. Persons with intellectual disabilities (ID) often present with pre-existing deficits that would be considered frailty markers in the general population. The previously developed Vienna Frailty Questionnaire for Persons with ID (VFQ-ID) was aimed at assessing frailty in…

  18. [Karl Alfons Portele, Pathologist and first director of the Federal Pathologic-anatomical Museum Vienna].

    Science.gov (United States)

    Patzak, Beatrix; Winter, Eduard

    2013-07-01

    The importance of the work of Karl Alfons Portele (1912-1993) in his position as director of the Federal Museum of Pathology is discussed. Portele was commissioned with the museum in 1946 and separated it from university in 1974. The history of the Pathologic-anatomical Museum in Vienna is closely connected with the history of pathology.

  19. Vienna-Chicago: the cultural transformation of the model system of the un-opposed molar.

    Science.gov (United States)

    Luan, Xianghong; Diekwisch, Thomas G H

    2007-08-01

    The discussion over the roles of genes and environment on the phenotypical specification of organisms has held a central role in science philosophy since the late 19(th) century and has re-emerged in today's debate over genetic determinism and developmental plasticity. In fin-de-siecle Vienna, this debate coincided with a philosophical debate over empiricism/materialism versus idealism/vitalism. Turn-of-the-century Vienna's highly interdisciplinary environment was also the birthplace for the model system of the un-opposed molar. The un-opposed molar system features new tissue formation at the roots of teeth and tooth drift once opposing teeth are lost. The un-opposed molar model system was revived by a group of Viennese scientists who left Vienna during the Nazi period to address Vienna's questions about evolution and heredity and about genes and environment in Chicago's post-WWII scientific exile community. Here we are using the colorful history of the un-opposed molar to investigate the role of culture and method in the scientific evolution of a model system. (c) 2007 Wiley Periodicals, Inc.

  20. Education, Enlightenment and Positivism: The Vienna Circle's Scientific World-Conception Revisited

    Science.gov (United States)

    Uebel, Thomas E.

    2004-01-01

    The scientific world-conception is properly understood as an enlightenment philosophy only if the current reassessment of the historical Vienna Circle(as opposed to the caricature still prevalent in the popular philosophical imagination) is once more extended to comprehend not only its thorough-going epistemological anti-foundationalism, but also…

  1. Surveying the Vienna Meridian from Brno to Varaždin

    Directory of Open Access Journals (Sweden)

    Miljenko Solarić

    2016-12-01

    Full Text Available The introduction provides a brief overview of using trigonometric chains for determining meridian arc lengths in Europe, as well as their extension to trigonometric networks in order to produce contemporary accurate maps in France. After Ruđer Bošković had visited Croatian-Hungarian Queen and Roman-German Empress Maria Theresa, she ordered Jesuit Joseph Liesganig to survey the meridian from Brno (Soběšice, over Vienna and Graz to Varaždin by establishing and surveying a trigonometric chain. That distance amounts to 320 km, i.e. the difference between latitude of the starting and finishing points of the chain equaled 2° 56' 45.85''. Two baselines were measured directly between Wiener Neustadt and Neunkirchen of 6410.903 Vienna fathom (12 158.175 m and between Seyring and Glizendorf in the Moravian field (Moravské pole, Marchfeld of 6387.862 Vienna fathom (12 114.478 m. Liesganig published previous Vienna Meridian survey results in Philosophical Transactions in London in 1768 and the final results in Latin in Dimensio Graduum Meridiani Viennensis et Hungarici in 1770. His results were quickly criticized and subsequently subjected to validation. Trigonometric point Varaždin is the first and oldest trigonometric point in Croatia.

  2. Mineral Resources in Mobile Phones: A Case Study of Boston and Vienna Teachers and Students

    Science.gov (United States)

    Bookhagen, Britta; Koeberl, Christian; Juang, Linda; DeRosa, Donald A.

    2017-01-01

    As part of an outreach initiative by the Natural History Museum in Vienna, Austria, an interdisciplinary educational module was developed to teach students about sustainability through the lens of mineral resources used to produce mobile phones. The overall goal of the module is to provide teachers of different subjects with a multifaceted tool to…

  3. The Relationships between Paranormal Belief, Creationism, Intelligent Design and Evolution at Secondary Schools in Vienna (Austria)

    Science.gov (United States)

    Eder, Erich; Turic, Katharina; Milasowszky, Norbert; Van Adzin, Katherine; Hergovich, Andreas

    2011-01-01

    The present study is the first to investigate the relationships between a multiple set of paranormal beliefs and the acceptance of evolution, creationism, and intelligent design, respectively, in Europe. Using a questionnaire, 2,129 students at secondary schools in Vienna (Austria) answered the 26 statements of the Revised Paranormal Belief Scale…

  4. Single Particle Analysis by Combined Chemical Imaging to Study Episodic Air Pollution Events in Vienna

    Science.gov (United States)

    Ofner, Johannes; Eitenberger, Elisabeth; Friedbacher, Gernot; Brenner, Florian; Hutter, Herbert; Schauer, Gerhard; Kistler, Magdalena; Greilinger, Marion; Lohninger, Hans; Lendl, Bernhard; Kasper-Giebl, Anne

    2017-04-01

    The aerosol composition of a city like Vienna is characterized by a complex interaction of local emissions and atmospheric input on a regional and continental scale. The identification of major aerosol constituents for basic source appointment and air quality issues needs a high analytical effort. Exceptional episodic air pollution events strongly change the typical aerosol composition of a city like Vienna on a time-scale of few hours to several days. Analyzing the chemistry of particulate matter from these events is often hampered by the sampling time and related sample amount necessary to apply the full range of bulk analytical methods needed for chemical characterization. Additionally, morphological and single particle features are hardly accessible. Chemical Imaging evolved to a powerful tool for image-based chemical analysis of complex samples. As a complementary technique to bulk analytical methods, chemical imaging can address a new access to study air pollution events by obtaining major aerosol constituents with single particle features at high temporal resolutions and small sample volumes. The analysis of the chemical imaging datasets is assisted by multivariate statistics with the benefit of image-based chemical structure determination for direct aerosol source appointment. A novel approach in chemical imaging is combined chemical imaging or so-called multisensor hyperspectral imaging, involving elemental imaging (electron microscopy-based energy dispersive X-ray imaging), vibrational imaging (Raman micro-spectroscopy) and mass spectrometric imaging (Time-of-Flight Secondary Ion Mass Spectrometry) with subsequent combined multivariate analytics. Combined chemical imaging of precipitated aerosol particles will be demonstrated by the following examples of air pollution events in Vienna: Exceptional episodic events like the transformation of Saharan dust by the impact of the city of Vienna will be discussed and compared to samples obtained at a high alpine

  5. "Pee-in-a-Pot": acceptability and uptake of on-site chlamydia screening in a student population in the Republic of Ireland

    LENUS (Irish Health Repository)

    Vaughan, Deirdre

    2010-11-11

    Abstract Background The aim of the study was to explore the acceptability and uptake of on-campus screening using a youth friendly approach in two Third Level higher education institutions (HEIs). This study is part of wider research exploring the optimal setting for chlamydia screening in Ireland. Methods Male and female students were given the opportunity to take a free anonymous test for chlamydia during a one week programme of "pee-in-a-pot" days at two HEI campuses in the West of Ireland. The study was set up after extensive consultation with the two HEIs and advertised on the two campuses using a variety of media in the two weeks preceding the screening days. Screening involved the provision and distribution of testing packs at communal areas and in toilet facilities. In Ireland, chlamydia notifications are highest amongst 20-29 year olds and hence the screening criterion was aimed at 18-29 year olds. Urine samples were tested using a nucleic acid amplification test (NAAT). Following the screening days, qualitative in-depth interviews were conducted with participants about their experiences of the event. Results Out of 1,249 test kits distributed in two HEIs, 592 specimens were collected giving a return rate of 47.5%. Tests excluded (54) were due to labelling errors or ineligibility of participants\\' age. Two thirds of those tested were females and the mean age was 21 years. Overall,3.9% (21\\/538) of participants tested positive, 5% (17\\/336) among females and 2% (4\\/191) among males. Participant interviews identified factors which enhanced student participation such as anonymity, convenience, accessibility of testing, and the informal and non-medical approach to testing. Conclusions Screening for chlamydia using on-campus "pee-in-a-pot" days is an acceptable strategy in this population. This model can detect and treat asymptomatic cases of chlamydia and avoid many of the barriers associated with testing for sexually transmitted infections (STIs) in

  6. Exploring the possible relationship between ambient heat and sudden infant death with data from Vienna, Austria.

    Science.gov (United States)

    Waldhoer, Thomas; Heinzl, Harald

    2017-01-01

    A non-linear relationship between maximum ambient temperature and number of sudden infant death syndrome (SIDS) cases had been reported for Montreal, Canada, for the warm season. In particular, high maximum ambient temperatures were found to be extra-hazardous for infants. The study was replicated with data from Vienna, Austria, applying the same statistical approach. Vienna is roughly comparable to Montreal with regard to temperatures in the warm season, size of population, and number of SIDS cases. Although the Viennese study was powerful enough to detect even smaller effects, the Montrealean results could not be confirmed. The Viennese results do not support the hypothesis of a strong effect of maximum ambient temperature on the risk of SIDS during the warm season.

  7. Exploring the possible relationship between ambient heat and sudden infant death with data from Vienna, Austria.

    Directory of Open Access Journals (Sweden)

    Thomas Waldhoer

    Full Text Available A non-linear relationship between maximum ambient temperature and number of sudden infant death syndrome (SIDS cases had been reported for Montreal, Canada, for the warm season. In particular, high maximum ambient temperatures were found to be extra-hazardous for infants. The study was replicated with data from Vienna, Austria, applying the same statistical approach. Vienna is roughly comparable to Montreal with regard to temperatures in the warm season, size of population, and number of SIDS cases. Although the Viennese study was powerful enough to detect even smaller effects, the Montrealean results could not be confirmed. The Viennese results do not support the hypothesis of a strong effect of maximum ambient temperature on the risk of SIDS during the warm season.

  8. Florentine anatomical models and the challenge of medical authority in late-eighteenth-century Vienna.

    Science.gov (United States)

    Maerker, Anna

    2012-09-01

    This paper investigates the reception of a set of Florentine anatomical wax models on display at the medico-surgical academy Josephinum in late-eighteenth-century Vienna. Celebrated in Florence as tools of public enlightenment, in the Habsburg capital the models were criticised by physicians, who regarded the Josephinum and its surgeons as a threat to their medical authority. The controversy surrounding these models from the empire's periphery temporarily destabilised the relationship between surgeons and physicians in the Austrian capital. The debate on the utility of the Tuscan anatomical models in Vienna highlights the fact that the centre of the Habsburg empire was by no means medically homogeneous, and that the implementation of reforms could be as difficult to achieve in the capital as in the provinces. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. ViennaNGS: A toolbox for building efficient next- generation sequencing analysis pipelines.

    Science.gov (United States)

    Wolfinger, Michael T; Fallmann, Jörg; Eggenhofer, Florian; Amman, Fabian

    2015-01-01

    Recent achievements in next-generation sequencing (NGS) technologies lead to a high demand for reuseable software components to easily compile customized analysis workflows for big genomics data. We present ViennaNGS, an integrated collection of Perl modules focused on building efficient pipelines for NGS data processing. It comes with functionality for extracting and converting features from common NGS file formats, computation and evaluation of read mapping statistics, as well as normalization of RNA abundance. Moreover, ViennaNGS provides software components for identification and characterization of splice junctions from RNA-seq data, parsing and condensing sequence motif data, automated construction of Assembly and Track Hubs for the UCSC genome browser, as well as wrapper routines for a set of commonly used NGS command line tools.

  10. The Third Mission of Universities in the Development Strategy of Vienna City

    Directory of Open Access Journals (Sweden)

    Mihaela-Cornelia DAN

    2012-01-01

    Full Text Available Vienna City is one of the most attractive cities in Europe and according to different rankings [1], [2]it is placed on the top ten in the list of cities with best living conditions, excellent education, infrastructure and good urban planning. This is the result of a systematic approach of the local government, companies, universities and public in the development and modernization of the city. Since 2000 the city has known a growth in different areas (number of researchers, number of patents, joint programs for the popularization of science etc. and evolved into a network point not only for business but also for research and innovation. In this paper we investigate the strategy of Vienna City regarding research and development and the extensive and complex role of universities in the city.

  11. Isochron burial dating of the Haslau terrace of the Danube (Vienna Basin) and interlaboratory comparison of sample preparation in Vienna and Budapest

    Science.gov (United States)

    Ruszkiczay-Rüdiger, Zsófia; Neuhuber, Stephanie; Decker, Kurt; Braucher, Régis; Fiebig, Marcus; Braun, Mihály; Lachner, Johannes; Aster Team

    2017-04-01

    In the Vienna Basin, terraces to the South of the Danube form a staircase with altitudes ranging between 25 and 130 m above current water level. The terrace system has been strongly dissected by faults related to the sinistral movement of the Vienna Basin Transform Fault System [1, 2]. Although each fault block displays a slightly different succession of terraces, fault-related vertical displacements south of the Danube have not yet been quantified. To better understand the Quaternary terrace sequence and its displacement along a fault segment south of the Danube, the isochron burial dating method [3] based on the 26Al and 10Be cosmogenic nuclide pair has been used on a terrace at Haslau an der Donau (˜40 m above river level). This terrace is locally the lowest of a staircase of a total of 6 different levels. Based on geomorphological mapping, its age was considered to be Middle Pleistocene [4]. The sample set consisted of several quartzite cobbles taken from two sedimentary units (5.5 m and 11.8 m depth) separated by an erosional hiatus of unknown duration. Six cobbles were selected for inter-laboratory comparison and processed at both the Cosmogenic Nuclide Sample Preparation Laboratory at Vienna and at Budapest [5]. AMS measurements were performed at the French national facility ASTER (CEREGE, Aix-en-Provence) and at the Vienna Environmental Research Accelerator (VERA). Initially, the obtained results show that the 10Be and 26Al concentrations calculated from the subsamples processed independently using different extraction schemes at both laboratories overlap within error for all subsamples but one, whose 26Al concentrations were significantly different. The low 26Al concentration measured in one Budapest sample probably resulted from Al having been trapped within the insoluble residues observed after evaporation to dryness. A modification of the sample processing allows overcoming this difficulty while treating for the following sample set. The results

  12. Parascolymia (Scleractinia: Lobophylliidae) in the Central Paratethys Sea (Vienna Basin, Austria) and its possible biogeographic implications

    OpenAIRE

    Markus Reuter; Thomas Wiedl; Piller, Werner E.

    2015-01-01

    Palaeobiogeographical and palaeodiversity patterns of scleractinian reef corals are generally biased due to uncertain taxonomy and a loss of taxonomic characters through dissolution and recrystallization of the skeletal aragonite in shallow marine limestones. Herein, we describe a fossil lobophylliid coral in mouldic preservation from the early middle Miocene Leitha Limestone of the Central Paratethys Sea (Vienna Basin, Austria). By using grey-scale image inversion and silicone rubber casts f...

  13. Mosquitoes (Diptera: Culicidae) and their relevance as disease vectors in the city of Vienna, Austria.

    Science.gov (United States)

    Lebl, Karin; Zittra, Carina; Silbermayr, Katja; Obwaller, Adelheid; Berer, Dominik; Brugger, Katharina; Walter, Melanie; Pinior, Beate; Fuehrer, Hans-Peter; Rubel, Franz

    2015-02-01

    Mosquitoes (Diptera: Culicidae) are important vectors for a wide range of pathogenic organisms. As large parts of the human population in developed countries live in cities, the occurrence of vector-borne diseases in urban areas is of particular interest for epidemiologists and public health authorities. In this study, we investigated the mosquito occurrence in the city of Vienna, Austria, in order to estimate the risk of transmission of mosquito-borne diseases. Mosquitoes were captured using different sampling techniques at 17 sites in the city of Vienna. Species belonging to the Culex pipiens complex (78.8 %) were most abundant, followed by Coquillettidia richiardii (10.2 %), Anopheles plumbeus (5.4 %), Aedes vexans (3.8 %), and Ochlerotatus sticticus (0.7 %). Individuals of the Cx. pipiens complex were found at 80.2 % of the trap sites, while 58.8 % of the trap sites were positive for Cq. richiardii and Ae. vexans. Oc. sticticus was captured at 35.3 % of the sites, and An. plumbeus only at 23.5 % of the trap sites. Cx. pipiens complex is known to be a potent vector and pathogens like West Nile virus (WNV), Usutu virus (USUV), Tahyna virus (TAHV), Sindbis virus (SINV), Plasmodium sp., and Dirofilaria repens can be transmitted by this species. Cq. richiardii is a known vector species for Batai virus (BATV), SINV, TAHV, and WNV, while Ae. vexans can transmit TAHV, USUV, WNV, and Dirofilaria repens. An. plumbeus and Oc. sticticus seem to play only a minor role in the transmission of vector-borne diseases in Vienna. WNV, which is already wide-spread in Europe, is likely to be the highest threat in Vienna as it can be transmitted by several of the most common species, has already been shown to pose a higher risk in cities, and has the possibility to cause severe illness.

  14. [Autopsy records in Vienna since Lorenz Biermayer--a complete documentation of 195 years].

    Science.gov (United States)

    Winter, Eduard; Höflmayer, Doris; Patzak, Beatrix; Feigl, Walter

    2013-07-01

    Vienna has a long tradition of clinical autopsies. In the period from 1817 to 2012 there are over 300,000 autopsies documented in the Vienna General Hospital. From five other community hospitals with departments for pathology and some closed hospitals, autopsy reports exist since 1865. Until the nineteenth century the reports are written in Kurrent, then Latin script and since the 1920s they are stored as machine written copies. This incredible high number of preserved reports was only possible because of the tradition started by Rokitansky and the possibility of storing this large amount of records in the Pathologic anatomical collection in the Narrenturm, the Vienna Municipal Archives and various hospitals. The aim of this study was to create a documentary of the repositories of the autopsy records, to make the records available and easier accessible for different kinds of research. The autopsy records should be easier to find and access, be it for the use in statistics or other scientific projects.

  15. Modelling reduction of urban heat load in Vienna by modifying surface properties of roofs

    Science.gov (United States)

    Žuvela-Aloise, Maja; Andre, Konrad; Schwaiger, Hannes; Bird, David Neil; Gallaun, Heinz

    2017-01-01

    The study examines the potential of urban roofs to reduce the urban heat island (UHI) effect by changing their reflectivity and implementing vegetation (green roofs) using the example of the City of Vienna. The urban modelling simulations are performed based on high-resolution orography and land use data, climatological observations, surface albedo values from satellite imagery and registry of the green roof potential in Vienna. The modelling results show that a moderate increase in reflectivity of roofs (up to 0.45) reduces the mean summer temperatures in the densely built-up environment by approximately 0.25 °C. Applying high reflectivity materials (roof albedo up to 0.7) leads to average cooling in densely built-up area of approximately 0.5 °C. The green roofs yield a heat load reduction in similar order of magnitude as the high reflectivity materials. However, only 45 % of roof area in Vienna is suitable for greening and the green roof potential mostly applies to industrial areas in city outskirts and is therefore not sufficient for substantial reduction of the UHI effect, particularly in the city centre which has the highest heat load. The strongest cooling effect can be achieved by combining the green roofs with high reflectivity materials. In this case, using 50 or 100 % of the green roof potential and applying high reflectivity materials on the remaining surfaces have a similar cooling effect.

  16. Segway® related injuries in Vienna: report from the Lorenz Böhler Trauma Centre.

    Science.gov (United States)

    Roider, D; Busch, C; Spitaler, R; Hertz, H

    2016-04-01

    The Segway® vehicle facilitates a new way of eco-friendly mobility and is currently used all over the world. In the last years, the use of the Segway® transporters for sightseeing tours in Vienna has increased distinctly, resulting in a growing number of Segway® related injuries and subsequent admissions of these patients to the Lorenz Böhler Trauma Centre in Vienna, Austria. A retrospective analysis of clinical records in the electronic data system of the LBTC in Vienna, Austria, was performed to identify Segway® transporter related injuries between January 2010 and December 2012. Eighty-six patients represented the study cohort. The median age was 38 years (range 14-80 years) with a majority of male patients. Most common injuries were contusions (24, 6 %, n = 44) and fractures (23, 5 %, n = 42). The most frequent injury was a fracture of the radial head in 15, 1 % of all patients. 13 (15, 1 %) of 86 patients required admission and seven (8, 1 %) of these 13 patients had surgical treatment. This case series presents severe injuries related to the use of a Segway® transporter. As a consequence, it has to be ensured that public tour operators need to provide sufficient safety instructions and equipment for people who are unfamiliar with riding a Segway® .

  17. ScholarlyStats@MedUniVienna: Are usage statistics now a piece of cake? / ScholarlyStats@MedUniVienna: Nutzungsstatistik leicht gemacht?

    Directory of Open Access Journals (Sweden)

    Dollfuss, Helmut

    2008-06-01

    Full Text Available COUNTER (Counting Online Usage of Networked Electronic Resources standardized usage data from publishers of electronic library resources. Notwithstanding the collection of differently formated usage data from a variety of platforms to piece together an all-encompassing usage report is still cumbersome. MPS technologies is offering exactly this kind of service. The company collects usage data from publisher platforms on behalf of the library and pulls them together into uniform spreadsheet reports. Additionally several statisistical analysis are generated based on the consolidated reports. Since 2007 the university library at the Medical University Vienna holds a contract with MPS Technologies. The following report will give insight into service coverage, functionality results and experience with ScholarlyStats. Furthermore a few points are listed which have to be considered and discussed in the library before signing this contract.

  18. Weather as physiologically equivalent was not associated with ischemic stroke onsets in Vienna, 2004-2010.

    Science.gov (United States)

    Ferrari, Julia; Shiue, Ivy; Seyfang, Leonhard; Matzarakis, Andreas; Lang, Wilfried

    2015-06-01

    Stroke rates were found to have seasonal variations. However, previous studies using air temperature, humidity, or air pressure separately were not adequate, and the study catchment was not clearly drawn. Therefore, here we proposed to use a thermal index called physiologically equivalent temperature (PET) that incorporates air temperature, humidity, wind speed, cloud cover, air pressure and radiation flux from a biometeorological approach to estimate the effect of weather as physiologically equivalent on ischemic stroke onsets in an Austrian population. Eight thousand four hundred eleven stroke events in Vienna registered within the Austrian Stroke Unit Register from January 1, 2004 to December 31, 2010 were included and were correlated with the weather data, obtained from the Central Institute for Meteorology and Geodynamics in the same area and study time period and calculated as PET (°C). Statistical analysis involved Poisson regression modeling. The median age was 74 years, and men made up 49 % of the entire population. Eighty percent had hypertension while 25.4 % were current smokers. Of note, 26.5 % had diabetes mellitus, 28.9 % had pre-stroke, and 11.5 % had pre-myocardial infarction. We have observed that onsets were higher on the weekdays than on the weekend. However, we did not find any significant association between PETs and ischemic stroke onsets by subtypes in Vienna. We did not observe any significant associations between PETs and ischemic stroke onsets by subtypes in Vienna. Hospital admission peaks on the weekdays might be due to hospital administration reasons.

  19. Cryopreservation of Embryos of the Mediterranean Fruit Fly Ceratitis capitata Vienna 8 Genetic Sexing Strain.

    Directory of Open Access Journals (Sweden)

    Antonios A Augustinos

    Full Text Available The Mediterranean fruit fly, Ceratitis capitata, is one of the most serious pests of fruit crops world-wide. During the last decades, area-wide pest management (AW-IPM approaches with a sterile insect technique (SIT component have been used to control populations of this pest in an effective and environment-friendly manner. The development of genetic sexing strains (GSS, such as the Vienna 8 strain, has been played a major role in increasing the efficacy and reducing the cost of SIT programs. However, mass rearing, extensive inbreeding, possible bottleneck phenomena and hitch-hiking effects might pose major risks for deterioration and loss of important genetic characteristics of domesticated insect. In the present study, we present a modified procedure to cryopreserve the embryos of the medfly Vienna 8 GSS based on vitrification and used this strain as insect model to assess the impact of the cryopreservation process on the genetic structure of the cryopreserved insects. Forty-eight hours old embryos, incubated at 24°C, were found to be the most suitable developmental stage for cryopreservation treatment for high production of acceptable hatch rate (38%. Our data suggest the absence of any negative impact of the cryopreservation process on egg hatch rate, pupation rates, adult emergence rates and stability of the temperature sensitive lethal (tsl character on two established cryopreserved lines (flies emerged from cryopreserved embryos, named V8-118 and V8-228. Taken together, our study provides an optimized procedure to cryopreserve the medfly Vienna 8 GSS and documents the absence of any negative impact on the genetic structure and quality of the strain. Benefits and sceneries for utilization of this technology to support operational SIT projects are discussed in this paper.

  20. Medicines discarded in household garbage: analysis of a pharmaceutical waste sample in Vienna.

    Science.gov (United States)

    Vogler, Sabine; Leopold, Christine; Zuidberg, Christel; Habl, Claudia

    2014-01-01

    To analyze a sample of pharmaceutical waste drawn from household garbage in Vienna, with the aim to learn whether and which medicines end up unused in normal household waste. We obtained a pharmaceutical waste sample from the Vienna Municipal Waste Department. This was drawn by their staff in a representative search in October and November 2009. We did a manual investigation of the sample which contained packs and loose blisters, excluded medical devices and traced loose blisters back to medicines packs. We reported information on the prescription status, origin, therapeutic group, dose form, contents and expiry date. We performed descriptive statistics for the total data set and for sub-groups (e.g. items still containing some of original content). In total, 152 packs were identified, of which the majority was prescription-only medicines (74%). Cardiovascular medicines accounted for the highest share (24%). 87% of the packs were in oral form. 95% of the packs had not expired. 14.5% of the total data set contained contents but the range of content left in the packs varied. Results on the packs with contents differed from the total: the shares of Over-the Counter medicines (36%), of medicines of the respiratory system (18%) and of the musculo-skeletal system (18%), for dermal use (23%) and of expired medicines (19%) were higher compared to the full data set. The study showed that some medicines end up unused or partially used in normal household garbage in Vienna. Our results did not confirm speculations about a high percentage of unused medicines improperly discarded. There is room for improved patient information and counseling to enhance medication adherence and a proper discharge of medicines.

  1. Medicines discarded in household garbage: analysis of a pharmaceutical waste sample in Vienna

    Science.gov (United States)

    2014-01-01

    Objectives To analyze a sample of pharmaceutical waste drawn from household garbage in Vienna, with the aim to learn whether and which medicines end up unused in normal household waste. Methods We obtained a pharmaceutical waste sample from the Vienna Municipal Waste Department. This was drawn by their staff in a representative search in October and November 2009. We did a manual investigation of the sample which contained packs and loose blisters, excluded medical devices and traced loose blisters back to medicines packs. We reported information on the prescription status, origin, therapeutic group, dose form, contents and expiry date. We performed descriptive statistics for the total data set and for sub-groups (e.g. items still containing some of original content). Results In total, 152 packs were identified, of which the majority was prescription-only medicines (74%). Cardiovascular medicines accounted for the highest share (24%). 87% of the packs were in oral form. 95% of the packs had not expired. 14.5% of the total data set contained contents but the range of content left in the packs varied. Results on the packs with contents differed from the total: the shares of Over-the Counter medicines (36%), of medicines of the respiratory system (18%) and of the musculo-skeletal system (18%), for dermal use (23%) and of expired medicines (19%) were higher compared to the full data set. Conclusions The study showed that some medicines end up unused or partially used in normal household garbage in Vienna. Our results did not confirm speculations about a high percentage of unused medicines improperly discarded. There is room for improved patient information and counseling to enhance medication adherence and a proper discharge of medicines. PMID:25848546

  2. Julius von Schlosser, 'The Vienna school of the history of art (1934'

    Directory of Open Access Journals (Sweden)

    Karl Johns

    2009-12-01

    Full Text Available Julius v. Schlosser, The Vienna School of the History of Art - Review of a Century of Austrian Scholarship in German Including a list of members edited by Hans Hahnloser. Dedicated to the spirit of Theodor von Sickel and Franz Wickhoff on the 25th anniversary of their deaths and the occasion of the 80th anniversary of the Österreichisches Institut für Geschichtsforschung. A translation of ‘Die Wiener Schule der Kunstgeschichte‘, Mitteilungen des österreichischen Institut für Geschichtsforschung Ergänzungs-Band 13, Heft 2, Innsbruck: Wagner 1934.

  3. West Nile virus lineage 2 infection in a blood donor from Vienna, Austria, August 2014.

    Science.gov (United States)

    Jungbauer, C; Hourfar, M K; Stiasny, K; Aberle, S W; Cadar, D; Schmidt-Chanasit, J; Mayr, W R

    2015-03-01

    Eastern Austria is neighbouring regions with ongoing West Nile virus (WNV) transmissions. Three human WNV infections had been diagnosed during the past decade in Austria. The Austrian Red Cross Blood Service (ARC-BS) started a first voluntary screening for WNV in blood donors from Eastern Austria by Nucleic Acid Testing (NAT) in June 2014. This is also the most extensive WNV surveillance programme in humans in Austria so far. In August 2014, one autochthonous WNV infection was detected in a blood donor from Vienna. By now, one in 67,800 whole blood donations was found to be positive for WNV RNA. Copyright © 2015 Elsevier B.V. All rights reserved.

  4. [From Comte to Carnap. Marcel Boll and the introduction of the Vienna Circle in France].

    Science.gov (United States)

    Schöttler, Peter

    2015-01-01

    The issue of the introduction of viennese "scientific philosophy" in France appears to be resolved. However, the rediscovery of the positivist physicist Marcel Boll (1886-1971), who was the first-well before Louis Rougier-to draw the French public's attention to the works of Schlick, Frank, and Carnap, obliges us to rethink the passage from traditional positivism to neo-positivism during the 1920s and 1930s. The French reception of the Vienna circle can be dated earlier than accepted and is more profound than usualy assumed.

  5. Tracing stable isotopes (δ2H and δ1⁸O) from meteoric water to spring-groundwater in small catchments of the Vienna Woods, Vienna, Austria

    Science.gov (United States)

    Kralik, Martin; Wyhlidal, Stefan

    2017-04-01

    The isotopic ratios of oxygen and hydrogen in water (2H/1H and 18O/16O) are important tools to characterise waters and their cycles. To trace the recharge area of spring waters the mean annual δ 18O values in precipitation changes due temperature and fractionation factors with altitude and a representative fraction infiltrates in the ground without any changes. In this study, the characteristics of δ18O and δ2H in rain water and groundwater from two springs have been used to understand the transformation mechanism of rain water to groundwater. Two small recharge areas in the Vienna Woods (outskirts of Vienna) above Flysch sandstones and marls were studied. One spring drains a small catchment totally covered with an old beech-oak forest and the other one a catchment covered by lawns and partly by weekend cottages. The springs were sampled every month and the precipitation in monthly samples in a Palmex rain-collector close by over a period of three years (2013-2016). The altitude of the recharge areas is in the range of 310 - 464 m with a yearly precipitation sum of 593-754 mm. The mean temperature of this Pannonian climate range in this period from 2.2° C in January and 24.1° C in July. Precipitation, stream water and groundwater from each site plot approximately along the δ2H/δ18O slope (δ2H=7.9xδ18O+7.4) of local precipitation inputs. The spring water of the recharge area with mainly lawns and weekend cottages shows a clear seasonal variation between -11.84 ‰ in April and -9.99 ‰ in September. The recharge area with an old beech-oak forest shows a nearly constant δ18O-value of -11.0 ‰ in the spring water comparable to the mean of the winter half-year of the precipitation station. The isotope data and the considerable smaller discharge suggest that in the forested recharge area only precipitation water of the winter half year is added to the groundwater and rain water of the summer half-year is nearly totally transpired by the forest vegetation

  6. Differences and similarities in the regulation of medical practice between early modern Vienna and Osijek.

    Science.gov (United States)

    Atalic, Bruno

    2012-09-01

    This paper evaluates the regulation of medical practice from the sixteenth to the eighteenth centuries in two Habsburg cities, Vienna and Osijek, in the light of the spread of medical knowledge and practice from the centre to the periphery of the Habsburg Monarchy. Although both cities were part of the Habsburg Monarchy for much of the early modern period, there were more differences than similarities between them. This may be explained by appealing to a variety of factors, including geographical position, population structure, religion, government type, and professional organisations, all of which contributed to making medical practice very different in the two cities. The divergence occurred in spite of a central agenda for ensuring uniformity of medical practice throughout the Habsburg Monarchy. Although the legislation governing medical practice was the same in both cities, it was more strictly implemented in Vienna than in Osijek. In consequence, Osijek was the setting for some unique patterns of medical practice not to be found in the Habsburg capital. Copyright © 2012 Elsevier Ltd. All rights reserved.

  7. Lower Miocene plant assemblage with coastal-marsh herbaceous monocots from the Vienna Basin (Slovakia)

    Science.gov (United States)

    Kvaček, Zlatko; Teodoridis, Vasilis; Kováčová, Marianna; Schlögl, Ján; Sitár, Viliam

    2014-06-01

    A new plant assemblage of Cerová-Lieskové from Lower Miocene (Karpatian) deposits in the Vienna Basin (western Slovakia) is preserved in a relatively deep, upper-slope marine environment. Depositional conditions with high sedimentation rates allowed exceptional preservation of plant remains. The plant assemblage consists of (1) conifers represented by foliage of Pinus hepios and Tetraclinis salicornioides, a seed cone of Pinus cf. ornata, and by pollen of the Cupressaceae, Pinaceae, Pinus sp. and Cathaya sp., and (2) angiosperms represented by Cinnamomum polymorphum, Platanus neptuni, Potamogeton sp. and lauroid foliage, by pollen of Liquidambar sp., Engelhardia sp. and Craigia sp., and in particular by infructescences (so far interpreted as belonging to cereal ears). We validate genus and species assignments of the infructescences: they belong to Palaeotriticum Sitár, including P. mockii Sitár and P. carpaticum Sitár, and probably represent herbaceous monocots that inhabited coastal marshes, similar to the living grass Spartina. Similar infructescences occur in the Lower and Middle Miocene deposits of the Carpathian Foredeep (Slup in Moravia), Tunjice Hills (Žale in Slovenia), and probably also in the Swiss Molasse (Lausanne). This plant assemblage demonstrates that the paleovegetation was represented by evergreen woodland with pines and grasses in undergrowth, similar to vegetation inhabiting coastal brackish marshes today. It also indicates subtropical climatic conditions in the Vienna Basin (central Paratethys), similar to those implied by other coeval plant assemblages from Central Europe

  8. Lower Miocene plant assemblage with coastal-marsh herbaceous monocots from the Vienna Basin (Slovakia

    Directory of Open Access Journals (Sweden)

    Kvaček Zlatko

    2014-06-01

    Full Text Available A new plant assemblage of Cerová-Lieskové from Lower Miocene (Karpatian deposits in the Vienna Basin (western Slovakia is preserved in a relatively deep, upper-slope marine environment. Depositional conditions with high sedimentation rates allowed exceptional preservation of plant remains. The plant assemblage consists of (1 conifers represented by foliage of Pinus hepios and Tetraclinis salicornioides, a seed cone of Pinus cf. ornata, and by pollen of the Cupressaceae, Pinaceae, Pinus sp. and Cathaya sp., and (2 angiosperms represented by Cinnamomum polymorphum, Platanus neptuni, Potamogeton sp. and lauroid foliage, by pollen of Liquidambar sp., Engelhardia sp. and Craigia sp., and in particular by infructescences (so far interpreted as belonging to cereal ears. We validate genus and species assignments of the infructescences: they belong to Palaeotriticum Sitár, including P. mockii Sitár and P. carpaticum Sitár, and probably represent herbaceous monocots that inhabited coastal marshes, similar to the living grass Spartina. Similar infructescences occur in the Lower and Middle Miocene deposits of the Carpathian Foredeep (Slup in Moravia, Tunjice Hills (Žale in Slovenia, and probably also in the Swiss Molasse (Lausanne. This plant assemblage demonstrates that the paleovegetation was represented by evergreen woodland with pines and grasses in undergrowth, similar to vegetation inhabiting coastal brackish marshes today. It also indicates subtropical climatic conditions in the Vienna Basin (central Paratethys, similar to those implied by other coeval plant assemblages from Central Europe

  9. Enabling Energy-Awareness in the Semantic 3d City Model of Vienna

    Science.gov (United States)

    Agugiaro, G.

    2016-09-01

    This paper presents and discusses the first results regarding selection, analysis, preparation and eventual integration of a number of energy-related datasets, chosen in order to enrich a CityGML-based semantic 3D city model of Vienna. CityGML is an international standard conceived specifically as information and data model for semantic city models at urban and territorial scale. The still-in-development Energy Application Domain Extension (ADE) is a CityGML extension conceived to specifically model, manage and store energy-related features and attributes for buildings. The work presented in this paper is embedded within the European Marie-Curie ITN project "CINERGY, Smart cities with sustainable energy systems", which aims, among the rest, at developing urban decision making and operational optimisation software tools to minimise non-renewable energy use in cities. Given the scope and scale of the project, it is therefore vital to set up a common, unique and spatio-semantically coherent urban data model to be used as information hub for all applications being developed. This paper reports about the experiences done so far, it describes the test area in Vienna, Austria, and the available data sources, it shows and exemplifies the main data integration issues, the strategies developed to solve them in order to obtain the enriched 3D city model. The first results as well as some comments about their quality and limitations are presented, together with the discussion regarding the next steps and some planned improvements.

  10. Vienna-PTM web server: a toolkit for MD simulations of protein post-translational modifications.

    Science.gov (United States)

    Margreitter, Christian; Petrov, Drazen; Zagrovic, Bojan

    2013-07-01

    Post-translational modifications (PTMs) play a key role in numerous cellular processes by directly affecting structure, dynamics and interaction networks of target proteins. Despite their importance, our understanding of protein PTMs at the atomistic level is still largely incomplete. Molecular dynamics (MD) simulations, which provide high-resolution insight into biomolecular function and underlying mechanisms, are in principle ideally suited to tackle this problem. However, because of the challenges associated with the development of novel MD parameters and a general lack of suitable computational tools for incorporating PTMs in target protein structures, MD simulations of post-translationally modified proteins have historically lagged significantly behind the studies of unmodified proteins. Here, we present Vienna-PTM web server (http://vienna-ptm.univie.ac.at), a platform for automated introduction of PTMs of choice to protein 3D structures (PDB files) in a user-friendly visual environment. With 256 different enzymatic and non-enzymatic PTMs available, the server performs geometrically realistic introduction of modifications at sites of interests, as well as subsequent energy minimization. Finally, the server makes available force field parameters and input files needed to run MD simulations of modified proteins within the framework of the widely used GROMOS 54A7 and 45A3 force fields and GROMACS simulation package.

  11. Quality perception of organically grown tomatoes (Lycopersicon esculentum Mill. in Vienna, Austria

    Directory of Open Access Journals (Sweden)

    PK Ng’ang’a

    2015-12-01

    Full Text Available Austria is one of the major organic tomato producing countries for local and export marketing. These tomatoes are produced in parts of Austria especially around Vienna where their production system has to meet stringent organic quality standards in both local and international markets. These quality standards may put considerable strain on farmers and are normally formulated without famers’ participation so may not be wholly representative of the farmers’ quality interpretation. The aim of this paper is therefore to determine the Austrian organic tomatoes growers’ perception and practice of quality and challenges. Qualitative semi-structured interviews were carried out among 28 organic tomatoes farmers in Vienna, Austria. Findings suggest that quality of organic tomatoes is mainly perceived in terms of both informal values (big fruit size, long shelf life, food security and amount of income received from tomato sales as well as formal norms (non- application of chemicals, human health, damage free, sweet taste, red colour, and juiciness. There were no gendered differences in quality perception among the growers. High costs of production inputs were identified as the main challenge to attaining quality in organic tomatoes. Following these findings, there is need for effective participation of growers in formulation of standards as well as subsidizing of production inputs by the government. The Austrian tomato growers as well as local and international retailers should work closely to increase the price received by the Austrian organic tomato growers so that it more adequately covers their production costs.

  12. Exploring the physical layer frontiers of cellular uplink: The Vienna LTE-A Uplink Simulator.

    Science.gov (United States)

    Zöchmann, Erich; Schwarz, Stefan; Pratschner, Stefan; Nagel, Lukas; Lerch, Martin; Rupp, Markus

    Communication systems in practice are subject to many technical/technological constraints and restrictions. Multiple input, multiple output (MIMO) processing in current wireless communications, as an example, mostly employs codebook-based pre-coding to save computational complexity at the transmitters and receivers. In such cases, closed form expressions for capacity or bit-error probability are often unattainable; effects of realistic signal processing algorithms on the performance of practical communication systems rather have to be studied in simulation environments. The Vienna LTE-A Uplink Simulator is a 3GPP LTE-A standard compliant MATLAB-based link level simulator that is publicly available under an academic use license, facilitating reproducible evaluations of signal processing algorithms and transceiver designs in wireless communications. This paper reviews research results that have been obtained by means of the Vienna LTE-A Uplink Simulator, highlights the effects of single-carrier frequency-division multiplexing (as the distinguishing feature to LTE-A downlink), extends known link adaptation concepts to uplink transmission, shows the implications of the uplink pilot pattern for gathering channel state information at the receiver and completes with possible future research directions.

  13. Cultures of death and politics of corpse supply: anatomy in Vienna, 1848-1914.

    Science.gov (United States)

    Buklijas, Tatjana

    2008-01-01

    Nineteenth-century Vienna is well known to medical historians as a leading center of medical research and education, offering easy access to patients and corpses to students from all over the world. The author seeks to explain how this enviable supply of cadavers was achieved, why it provoked so little opposition at a time when Britain and the United States saw widespread protests against dissection, and how it was threatened from mid-century onward. To understand permissive Viennese attitudes, we need to place them in a longue durée history of death and dissection and to pay close attention to the city's political geography as it was transformed into a major imperial capital. The tolerant stance of the Roman Catholic Church, strong links to Southern Europe, and the weak position of individuals in the absolutist state all contributed to an idiosyncratic anatomical culture. But as the fame of the Vienna medical school peaked in the later 1800s, the increased demand created by rising numbers of students combined with intensified interdisciplinary competition to produce a shortfall that professors found increasingly difficult to meet. Around 1900, new religious groups and mass political parties challenged long-standing anatomical practice by refusing to supply cadavers and making dissection into an instrument of political struggle. This study of the material preconditions for anatomy at one of Europe's most influential medical schools provides a contrast to the dominant Anglo-American histories of death and dissection.

  14. Early East Asian art history in Vienna and its trajectories: Josef Strzygowski, Karl With, Alfred Salmony

    Directory of Open Access Journals (Sweden)

    Julia Orell

    2015-12-01

    Full Text Available In 1912 Josef Strzygowski founded the ‘Section for East Asian Art History’ at the University of Vienna, which attracted many students who would continue their careers in museums and at universities and thus established East Asian art history as an academic field. This paper examines these early art historical engagements with East Asian art: First, I discuss the role of East Asian art in Strzygowski’s agenda of broadening art history’s geographical scope beyond Europe and in his argument about the dominance of ‘Nordic’ artistic traditions in Europe and in Asia. Secondly, I introduce the work of two early students at the ‘Section for East Asian Art History’ in Vienna, Karl With and Alfred Salmony. Their respective approaches to East Asian art exemplify a range of methodological concerns of their time, from stylistic narratives, the concept of ars una, comparative frameworks, to ideas about cultural or national ‘purity’ in the arts, and an interest in cross-cultural adaption and transformation of motifs and symbolism.

  15. Vienna International Summer School on Experimental and Clinical Oncology for Medical Students : An Austrian Cancer Education Project

    NARCIS (Netherlands)

    Fromm-Haidenberger, Sabine; Pohl, Gudrun; Widder, Joachim; Kren, Gerhard; Fitzal, Florian; Bartsch, Rupert; de Vries, Jakob; Zielinski, Christoph; Poetter, Richard

    The "International Summer School on Experimental and Clinical Oncology for Medical Students" is organised at the Medical University of Vienna to teach a multidisciplinary approach to oncology to medical students in the final phase of their studies. The program includes biology, diagnosis, clinical

  16. Regional subsidence history and 3D visualization with MATLAB of the Vienna Basin, central Europe

    Science.gov (United States)

    Lee, E.; Novotny, J.; Wagreich, M.

    2013-12-01

    This study reconstructed the subsidence history by the backstripping and 3D visualization techniques, to understand tectonic evolution of the Neogene Vienna Basin. The backstripping removes the compaction effect of sediment loading and quantifies the tectonic subsidence. The amount of decompaction was calculated by porosity-depth relationships evaluated from seismic velocity data acquired from two boreholes. About 100 wells have been investigated to quantify the subsidence history of the Vienna Basin. The wells have been sorted into 10 groups; N1-4 in the northern part, C1-4 in the central part and L1-2 in the northernmost and easternmost parts, based on their position within the same block bordered by major faults. To visualize 3D subsidence maps, the wells were arranged to a set of 3D points based on their map location (x, y) and depths (z1, z2, z3 ...). The division of the stratigraphic column and age range was arranged based on the Central Paratethys regional Stages. In this study, MATLAB, a numerical computing environment, was used to calculate the TPS interpolation function. The Thin-Plate Spline (TPS) can be employed to reconstruct a smooth surface from a set of 3D points. The basic physical model of the TPS is based on the bending behavior of a thin metal sheet that is constrained only by a sparse set of fixed points. In the Lower Miocene, 3D subsidence maps show strong evidence that the pre-Neogene basement of the Vienna Basin was subsiding along borders of the Alpine-Carpathian nappes. This subsidence event is represented by a piggy-back basin developed on top of the NW-ward moving thrust sheets. In the late Lower Miocene, Group C and N display a typical subsidence pattern for the pull-apart basin with a very high subsidence event (0.2 - 1.0 km/Ma). After the event, Group N shows remarkably decreasing subsidence, following the thin-skinned extension which was regarded as the extension model of the Vienna Basin in the literature. But the subsidence in

  17. The Dual Listing of Austrian Companies in Vienna and Frankfurt: Dependence Analysis

    Directory of Open Access Journals (Sweden)

    Lukasz Gurgul

    2015-03-01

    Full Text Available International capital flows can be hampered by a variety of barriers such as transaction costs, information costs, and legal restrictions. The solution in this situation can be dual listing. The framework of the research presented here assumes that domestic securities are dually listed on a foreign capital market, while none of the foreign securities is dually listed on the domestic capital market. This paper is concerned with a dependence analysis of the log-levels and returns of Austrian stocks listed in Frankfurt and Vienna. The important issue is dynamic linear and non-linear causality between log-levels (returns of prices and the indices ATX and DAX. In this context the important directions of causality are found along with the level of relations of the selected types of causality.

  18. Nowcasting of Low-Visibility Procedure States with Ordered Logistic Regression at Vienna International Airport

    Science.gov (United States)

    Kneringer, Philipp; Dietz, Sebastian; Mayr, Georg J.; Zeileis, Achim

    2017-04-01

    Low-visibility conditions have a large impact on aviation safety and economic efficiency of airports and airlines. To support decision makers, we develop a statistical probabilistic nowcasting tool for the occurrence of capacity-reducing operations related to low visibility. The probabilities of four different low visibility classes are predicted with an ordered logistic regression model based on time series of meteorological point measurements. Potential predictor variables for the statistical models are visibility, humidity, temperature and wind measurements at several measurement sites. A stepwise variable selection method indicates that visibility and humidity measurements are the most important model inputs. The forecasts are tested with a 30 minute forecast interval up to two hours, which is a sufficient time span for tactical planning at Vienna Airport. The ordered logistic regression models outperform persistence and are competitive with human forecasters.

  19. Research Network Osteology Vienna: Hochauflösende und Mikro-Computertomographie in der Wiener Osteologie

    Directory of Open Access Journals (Sweden)

    Deutschmann J

    2010-01-01

    Full Text Available Das Spektrum bildgebender Verfahren zur Diagnostik osteologischer Fragestellungen wurde in den vergangenen Jahren vor allem durch verschiedene Techniken der hochauflösenden und der Mikro-Computertomographie (µCT erheblich erweitert. Das „Research Network Osteology“ (RNO Vienna hat es sich zum Ziel gesetzt, diese modernen bildgebenden Verfahren neben anderen osteologisch orientierten Forschungsrichtungen wie Molekularbiologie und Biomechanik interdisziplinär zu verbinden. Derzeit sind in das RNO 3 Mikro-CTGeräte unterschiedlicher Bauart, ein HR-pQCT-, ein 64-Zeilen-Multidetektor-CT- und ein Dual- Source-CT-Gerät, 2 Knochendichtemessgeräte (DXA unterschiedlicher Bauart, ein hochauflösender digitaler Röntgenaufnahmeplatz (in Mammographiequalität sowie 2 3-Tesla- und ein 7-Tesla- MR-Gerät integriert. Verbunden durch ein dediziertes wissenschaftliches Kommunikations- und Bildarchivierungssystem werden diese Systeme im Rahmen wissenschaftlicher Studien und neuerdings auch zur gezielten klinischen Anwendung eingesetzt.

  20. Unambiguous identification of hospital patients: case study at the university departments of the General Hospital, Vienna.

    Science.gov (United States)

    Sachs, P; Gall, W; Marksteiner, A; Dorda, W

    2000-07-01

    This article considers the problem of identifying patients in one or more heterogeneous personal databases. The unambiguous identification of patients is an essential prerequisite for an efficient patient care system. We discuss the problems involved in this task and suggest how they can be dealt with. The solution of automatic consolidation of patient records sequires programming, organisational and work psychology measures. Following a survey of conventional identification methods, the method developed at the Department of Medical Computer Sciences, which is based on the current clinical situation at the General Hospital in Vienna (AKH--Allgemeines KrankenHaus), is described in detail. The basic principle is to identify patients unambiguously by means of an ID (IZAHL) derived directly from the personal data. Thereby a deterministic technique without probability weighting is used-all compared information must correspond completely. The article closes with a critical survey of experience gathered to date.

  1. Maks Fabiani and urbanism in Vienna at the turn of the 19th century

    Directory of Open Access Journals (Sweden)

    Breda Mihelič

    2008-01-01

    Full Text Available This article deals with new concepts in urban planning at the turn of the 19th century. It represents three key persons, all architects and urban planners: Camillo Sitte, Otto Wagner and Maks Fabiani. All three left an indelible mark on urban planning in the Hapsburg Monarchy. In particular, it focuses on Maks Fabiani, whose work is closely related with the reconstruction of Ljubljana after the earthquake at the end of the 19th and the beginning of the 20th century. Even though Fabiani was one of the most distinguished and respected urban planners in Vienna, his contribution to the history and theory of urban planning was until now relatively overlooked and not stressed enough upon in the context of the urban history within the Austro-Hungarian Empire.

  2. Ambient noise techniques for better understanding of seismic hazard in the wider Vienna Basin region

    Science.gov (United States)

    Schippkus, Sven; Zigone, Dimitri; Bokelmann, Götz; AlpArray Working Group

    2017-04-01

    The Vienna Basin is one of the seismically most active regions in Austria. Because of population density and sensitive infrastructure, seismic hazard assessment in this area is of critical importance. Recently, it has become apparent that ambient noise techniques can be applied to provide additional information for seismic hazard studies. This contribution can be either a) indirect by providing detailed 3D tomographic images of the underground, which can be used in further studies, in areas with high seismological station density or b) more direct by predicting ground motions resulting from scenario earthquakes directly from ambient noise. While both techniques are based on the retrieval of the inter-station Green's function from ambient noise interferometry, they are utilizing different features of the Green's function. For calculating tomographic images of the underground, phase information is needed to extract surface wave dispersion curves. Ground motion prediction, however, relies heavily on the extracted amplitude information. Commonly applied ambient noise processing techniques, e.g. pre-whitening, alter amplitudes non-linearly in exchange for more stable phase measurements. Therefore, depending on the study goal, different processing strategies have to be applied. Here, we present a case study for each. To construct the tomographic image of the wider Vienna Basin region (a), we used continuous seismic records from 65 seismological stations in the region, evenly covering the region with an inter-station distance of 40 km. For this, we utilized Love and Rayleigh wave phase and group velocity dispersion curves extracted from ambient noise cross correlations. To demonstrate the applicability of ground motion prediction using ambient noise (b), we use 2 months of continuous data from a temporary station, installed near the site of the ML 4.2 Alland earthquake on April 25th 2016 to retroactively reproduce the long-period earthquake seismograms using ambient noise

  3. Impact of urban planning on household's residential decisions: An agent-based simulation model for Vienna.

    Science.gov (United States)

    Gaube, Veronika; Remesch, Alexander

    2013-07-01

    Interest in assessing the sustainability of socio-ecological systems of urban areas has increased notably, with additional attention generated due to the fact that half the world's population now lives in cities. Urban areas face both a changing urban population size and increasing sustainability issues in terms of providing good socioeconomic and environmental living conditions. Urban planning has to deal with both challenges. Households play a major role by being affected by urban planning decisions on the one hand and by being responsible - among many other factors - for the environmental performance of a city (e.g. energy use). We here present an agent-based decision model referring to the city of Vienna, the capital of Austria, with a population of about 1.7 million (2.3 million within the metropolitan area, the latter being more than 25% of Austria's total population). Since the early 1990s, after decades of negative population growth, Vienna has been experiencing a steady increase in population, mainly driven by immigration. The aim of the agent-based decision model is to simulate new residential patterns of different household types based on demographic development and migration scenarios. Model results were used to assess spatial patterns of energy use caused by different household types in the four scenarios (1) conventional urban planning, (2) sustainable urban planning, (3) expensive centre and (4) no green area preference. Outcomes show that changes in preferences of households relating to the presence of nearby green areas have the most important impact on the distribution of households across the small-scaled city area. Additionally, the results demonstrate the importance of the distribution of different household types regarding spatial patterns of energy use.

  4. 76 FR 54134 - Final Flood Elevation Determinations

    Science.gov (United States)

    2011-08-31

    ... standards of Executive Order 12988. List of Subjects in 44 CFR Part 67 Administrative practice and procedure....: FEMA-B-1144 Little Pee Dee River Just upstream of Drama +28 Unincorporated Areas of Court extended...

  5. 5th October 2011 - Vienna Science and Technology Fund Board of Directors ((WWTF) led by Its President, Lord Mayor and Governor of Vienna M. Häupl, signing the guest book with Head of International relations F. Pauss and Director for Administration and General Infrastructure S. Lettow.

    CERN Multimedia

    2011-01-01

    5th October 2011 - Vienna Science and Technology Fund Board of Directors ((WWTF) led by Its President, Lord Mayor and Governor of Vienna M. Häupl, signing the guest book with Head of International relations F. Pauss and Director for Administration and General Infrastructure S. Lettow.

  6. Eberhard Widmann (Stefan Meyer Institute, Vienna) and Silke Federmann (Ph.D. Student from Vienna in the CERN-Austrian Ph.D. program) together with a microwave cavity developed by Silke at CERN. The cavity will be used for the first time to look for spin-flip transitions of antihydrogen atoms later this year.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Eberhard Widmann (Stefan Meyer Institute, Vienna) and Silke Federmann (Ph.D. Student from Vienna in the CERN-Austrian Ph.D. program) together with a microwave cavity developed by Silke at CERN. The cavity will be used for the first time to look for spin-flip transitions of antihydrogen atoms later this year.

  7. A conceptual hydrotectonic model of water level fluctuation in a cave at the Vienna Basin (Austria)

    Science.gov (United States)

    Hardege, Jonas; Plan, Lukas; Winkler, Gerhard; Baron, Ivo; Grasemann, Bernhard

    2017-04-01

    Eisensteinhöhle is a hydrothermally overprinted cave at the south-western margin of the Miocene Vienna pull-apart Basin. The basin has been formed by a still active NE-SW trending sinistral strike slip fault associated with NNE-SSW striking normal faults. These faults create pathways for thermal water to rise from the central basin and emerge in several lukewarm thermal springs along the basin margin. The cave was opened during quarrying in 1855 and is developed in a Miocene marine carbonate breccia. It has a crevice-shape while the morphology in most parts is coined by hydrothermal karstification. It is about 2 km long and has a vertical extend of 87 m. At the deepest point, there is a small pond filled with 14.5 °C warm water. This is about 5 °C above the annual average and it shows that there is some connection to a nearby subthermal spring with similar temperature. The water level fluctuates within a range of 3 m and at a certain level the water drains through a hole into a nearby slightly deeper gallery. This pond has attracted considerable attention because sporadic records of water level and discharge measurements since 1992 did not show any correlation with regional precipitation. Within the framework of the SPELEOTECT project (Austrian Science Fund # P25884-N29), the current tectonic activity of two faults along the margin of the Vienna Basin as well as the fault controlling the orientation of the cave are monitored by means of high-resolution moiré extensometers. Since October 2015, data loggers measure water level and temperature in the pond as well as CO2 in the air. A pumping test during medium water level, where the whole pond was emptied showed a volume of only 2800 l and a discharge of 4.5 l/h. Water temperature and hydrochemistry hint towards a mix of old thermal components and young meteoric components. However, water level and temperature change abruptly with no obvious relation to precipitation. Within the first year of the continuous

  8. Clinical decision support systems at the Vienna General Hospital using Arden Syntax: Design, implementation, and integration.

    Science.gov (United States)

    Schuh, Christian; de Bruin, Jeroen S; Seeling, Walter

    2015-12-01

    The Allgemeines Krankenhaus Informations Management (AKIM) project was started at the Vienna General Hospital (VGH) several years ago. This led to the introduction of a new hospital information system (HIS), and the installation of the expert system platform (EXP) for the integration of Arden-Syntax-based clinical decision support systems (CDSSs). In this report we take a look at the milestones achieved and the challenges faced in the creation and modification of CDSSs, and their integration into the HIS over the last three years. We introduce a three-stage development method, which is followed in nearly all CDSS projects at the Medical University of Vienna and the VGH. Stage one comprises requirements engineering and system conception. Stage two focuses on the implementation and testing of the system. Finally, stage three describes the deployment and integration of the system in the VGH HIS. The HIS provides a clinical work environment for healthcare specialists using customizable graphical interfaces known as parametric medical documents. Multiple Arden Syntax servers are employed to host and execute the CDSS knowledge bases: two embedded in the EXP for production and development, and a further three in clinical routine for production, development, and quality assurance. Three systems are discussed; the systems serve different purposes in different clinical areas, but are all implemented with Arden Syntax. MONI-ICU is an automated surveillance system for monitoring healthcare-associated infections in the intensive care setting. TSM-CDS is a CDSS used for risk prediction in the formation of cutaneous melanoma metastases. Finally, TacroDS is a CDSS for the manipulation of dosages for tacrolimus, an immunosuppressive agent used after kidney transplantation. Problems in development and integration were related to data quality or availability, although organizational difficulties also caused delays in development and integration. Since the inception of the AKIM

  9. The Influence of Wittgenstein’s Philosophy of Language on the Textual Production of the Vienna Group

    Directory of Open Access Journals (Sweden)

    Luka Bešlagić

    2016-04-01

    Full Text Available The entirety of Wittgenstein’s problematization of language was of particular importance for numerous Austrian postwar artists and art movements, but was possibly most evident in the poetics and heterogeneous practices of the Vienna Group. Analysis of selected texts of the latter neo-avantgarde movement – namely, Konrad Bayer’s the philosopher’s stone1 (1963 and Oswald Wiener’s the improvement of central europe, novel (1969 – unveils the direct influence of both of the early and late Wittgenstein, paradigmatically represented by his two major books: Tractatus Logico-Philosophicus (1921 and Philosophical Investigations (1953. Texts of the Vienna Group to which this article refers to are not interpreted as literary works, but rather as diverse examples of textual production; instead of being analyzed as aesthetic objects, these texts are examined as platforms of potential inscription of Wittgensteinian critique of language.

  10. Notion and order of determining the losses under the Vienna convention of UNO 1980 (by the example of law of England

    Directory of Open Access Journals (Sweden)

    Aleksandr V. Padiryakov

    2015-12-01

    Full Text Available Objective to carry out a comprehensive analysis of the institution of losses under the Vienna Convention of 1980 and its implementation in comparison with the regulation of the institution of losses in the law of England. Methods universal dialectic method of cognition as well as general scientific and private research methods based on it. Results the article analyses legal regulation of the institution of losses under the Vienna Convention of 1980 and reviews the practice of its application by the courts of various states as well as presents a comparative legal analysis of the institution of losses under the Vienna Convention of 1980 and the law of England. Scientific novelty the article suggests practical recommendations on using the provisions of the Vienna Convention 1980 on losses and international practices in contracting. Practical significance the findings of this paper can be used in scientific legislative and law enforcement activities and in the educational process of higher education institutions. nbsp

  11. A garage-building programme for the city of Vienna and resulting air quality. Related health aspects

    Energy Technology Data Exchange (ETDEWEB)

    Tvrdy, C.; Walter, R. [Inst. of Environmental Medicine of the City Council of Vienna (Austria)

    1995-12-31

    Urban traffic influences air quality in cities considerably. This is particularly true for the medieval parts of the big European cities, which have not been designed for today s heavy traffic. A problem closely associated with city traffic, is the lack of parking lots, particularly for residents. In Vienna, the parking problem is tackled by the building of underground car parks. In the next years more than 50 large garages (>100 sites) are being planned. The main goal is the clearing of the beautiful old places and streets of Vienna from the bulk of parking vehicles and supplying the citizens with parking spaces in the neighbourhood. According to a recent decision of the City Council of Vienna the construction of `large garages` (>100 parking spaces) requires an official approval by various local authorities. Among them are those responsible for town design and architecture, for fire precaution and fire fighting, for city traffic, for planning and building and for environmental health. In this context the Institute of Environmental Medicine of the City Council of Vienna faced the task of establishing criteria for a health risk assessment linked with `large garages`. Health-risks may be caused by air pollution and noise. This presentation deals with the air pollution problem. Air pollution problems may occur due to traffic in and out of the garage, by insufficient ventilation systems and by construction failures. In the garage programme the health officers have to bring evidence that residents of the houses with underground car parks and residents in the close neighbourhood are not exposed to any health risk due to air pollution

  12. Additive homeopathy in cancer patients: Retrospective survival data from a homeopathic outpatient unit at the Medical University of Vienna.

    Science.gov (United States)

    Gaertner, Katharina; Müllner, Michael; Friehs, Helmut; Schuster, Ernst; Marosi, Christine; Muchitsch, Ilse; Frass, Michael; Kaye, Alan David

    2014-04-01

    Current literature suggests a positive influence of additive classical homeopathy on global health and well-being in cancer patients. Besides encouraging case reports, there is little if any research on long-term survival of patients who obtain homeopathic care during cancer treatment. Data from cancer patients who had undergone homeopathic treatment complementary to conventional anti-cancer treatment at the Outpatient Unit for Homeopathy in Malignant Diseases, Medical University Vienna, Department of Medicine I, Vienna, Austria, were collected, described and a retrospective subgroup-analysis with regard to survival time was performed. Patient inclusion criteria were at least three homeopathic consultations, fatal prognosis of disease, quantitative and qualitative description of patient characteristics, and survival time. In four years, a total of 538 patients were recorded to have visited the Outpatient Unit Homeopathy in Malignant Diseases, Medical University Vienna, Department of Medicine I, Vienna, Austria. 62.8% of them were women, and nearly 20% had breast cancer. From the 53.7% (n=287) who had undergone at least three homeopathic consultations within four years, 18.7% (n=54) fulfilled inclusion criteria for survival analysis. The surveyed neoplasms were glioblastoma, lung, cholangiocellular and pancreatic carcinomas, metastasized sarcoma, and renal cell carcinoma. Median overall survival was compared to expert expectations of survival outcomes by specific cancer type and was prolonged across observed cancer entities (pcancer patients with fatal prognosis but additive homeopathic treatment is interesting. However, findings are based on a small sample, and with only limited data available about patient and treatment characteristics. The relationship between homeopathic treatment and survival time requires prospective investigation in larger samples possibly using matched-pair control analysis or randomized trials. Copyright © 2014 Elsevier Ltd. All rights

  13. Deformation bands evolving from dilation to cementation bands in a hydrocarbon reservoir (Vienna Basin, Austria)

    Science.gov (United States)

    Exner, Ulrike; Kaiser, Jasmin; Gier, Susanne

    2013-01-01

    In this study we analyzed five core samples from a hydrocarbon reservoir, the Matzen Field in the Vienna Basin (Austria). Deformation bands occur as single bands or as strands of several bands. In contrast to most published examples of deformation bands in terrigeneous sandstones, the reduction of porosity is predominantly caused by the precipitation of Fe-rich dolomite cement within the bands, and only subordinately by cataclasis of detrital grains. The chemical composition of this dolomite cement (10–12 wt% FeO) differs from detrital dolomite grains in the host rock (<2 wt% FeO). This observation in combination with stable isotope data suggests that the cement is not derived from the detrital grains, but precipitated from a fluid from an external, non-meteoric source. After an initial increase of porosity by dilation, disaggregation and fragmentation of detrital grains, a Fe-rich carbonate fluid crystallized within the bands, thereby reducing the porosity relative to the host sediment. The retention of pyrite cement by these cementation bands as well as the different degree of oil staining on either side of the bands demonstrate that these cementation bands act as effective barriers to the migration of fluids and should be considered in reservoir models. PMID:26321782

  14. The DIY Careers of Techno and Drum ‘n’ Bass DJs in Vienna

    Directory of Open Access Journals (Sweden)

    Rosa Reitsamer

    2011-06-01

    Full Text Available My empirical research on electronic dance music scenes in Vienna, Austria, explores an area of cultural production that unites the ideology of creativity with the aspirations of social networks and individual entrepreneurship. The model for a DJ's career is a hybrid of inspired musician, compelling performer, marketing genius and business strategist. An economically successful career depends not only on performing in clubs; DJs are also involved in music production, making records, marketing themselves through the media, organizing club nights and running labels. Social and cultural capital is invested in creative freedom, a do-it-yourself ethos, and collective enjoyment, yet these DJs tend to promote the neoliberal economic ideal of the "autonomous cultural entrepreneur" combining self-organisation and self-marketing with unregulated labour and gendered constructions of artist identity. Taking Bourdieu's work on the field of cultural production as a theoretical framework, my analysis of the DJs' modes of self-(representation suggests that the opposition Bourdieu made between art and commerce tends to blur.

  15. Parascolymia (Scleractinia: Lobophylliidae) in the Central Paratethys Sea (Vienna Basin, Austria) and its possible biogeographic implications

    Science.gov (United States)

    Reuter, Markus; Wiedl, Thomas; Piller, Werner E.

    2015-01-01

    Palaeobiogeographical and palaeodiversity patterns of scleractinian reef corals are generally biased due to uncertain taxonomy and a loss of taxonomic characters through dissolution and recrystallization of the skeletal aragonite in shallow marine limestones. Herein, we describe a fossil lobophylliid coral in mouldic preservation from the early middle Miocene Leitha Limestone of the Central Paratethys Sea (Vienna Basin, Austria). By using grey-scale image inversion and silicone rubber casts for the visualization of the original skeletal anatomy and the detection of distinct micromorphological characters (i.e. shape of septal teeth, granulation of septocostae) Parascolymia bracherti has been identified as a new species in spite of the dissolved skeleton. In the recent era, Parascolymia like all Lobophylliidae is restricted to the Indo-Pacific region, where it is represented by a single species. The new species proves the genus also in the Miocene Mediterranean reef coral province. A review of the spatio-temporal relationships of fossil corals related to Parascolymia indicates that the genus was probably rooted in the Eastern Atlantic‒Western Tethys region during the Paleocene to Eocene and reached the Indo-Pacific region not before the Oligocene. The revealed palaeobiogeographical pattern shows an obvious congruence with that of Acropora and tridacnine bivalves reflecting a gradual equatorwards retreat of the marine biodiversity center parallel to the Cenozoic climate deterioration. PMID:26201071

  16. Vienna's biowaste compost--quality development and effects of input materials.

    Science.gov (United States)

    Plahl, F; Rogalski, W; Gilnreiner, G; Erhart, E

    2002-04-01

    Extensive chemical analyses were conducted during the last decade to assess the heavy metal content of the finished compost as well as of biowaste and other input materials. Twenty six percent of the compost lots were class I according to ONORM S2200, 70% class II and 4% did not reach class II. If the compost lots were classified according to the new Austrian compost ordinance, 22% would conform to class A+ and 78% to class A. These data are put into relation with heavy metal contents of soil, of yard wastes and of biowastes without contaminants. In the soil samples particularly nickel and lead exceeded the limits for class A+ (compost ordinance). In the yard wastes, more than 90% of the samples met the limits for all heavy metals. Biowaste without contaminants conformed to class A+ on average. In biowaste without contaminants no influence of the housing structure on the heavy metal content was observed. The compost produced only from biowaste from areas with high building density, after undergoing the normal process of metal removal, however, was significantly higher contaminated than that of compost of the whole city of Vienna. The impact of specific input materials, such as Christmas trees or wooden crates, was investigated by chemical analyses before and after controlled composting experiments with those materials. In both experiments the compost quality did not reach the limits for heavy metals of class I (ONORM S2200).

  17. Data reconciliation, structure analysis and simulation of waste flows: case study Vienna.

    Science.gov (United States)

    Matyus, Thomas; Gleiss, Andreas; Gruber, Karl; Bauer, Gerd

    2003-04-01

    The management of complex waste flow systems requires a systematic approach for the handling of data, for obtaining a consistent picture of the system under consideration, and for simulating various policy scenarios and evaluating material control strategies. In this paper the implementation of a useful methodology is presented, which has been developed in previous works and is further enhanced for modelling, identifying, analysing and simulating material flow systems for which at most one measurement per flow is available for a single balancing period. The methodology enables the analyst to cope with missing data and uncertainty in the measurements. A data reconciliation procedure is used to minimise the uncertainty concerning flows by exploiting the redundancies created by restricting the available data to fulfil the available structural information. Statistical tests are introduced to enable the user to check the compatibility of the data with the a priori information. The origins analysis and destination analysis tools allow for a deeper insight into the system structure. Policy scenarios can be treated using the simulation tools. The waste flow system of the city of Vienna has been chosen to demonstrate step-by-step the procedure for building a reliable model and the effective application of the above mentioned methods and tools. Current and future research focuses on models balancing different interrelated quantities simultaneously and on incorporating stock accumulation and depletion behaviour.

  18. Controlling and culturing diversity: experimental zoology before World War II and Vienna's Biologische Versuchsanstalt.

    Science.gov (United States)

    Logan, Cheryl A; Brauckmann, Sabine

    2015-04-01

    Founded in Vienna in 1903, the Institute for Experimental Biology pioneered the application of experimental methods to living organisms maintained for sustained periods in captivity. Its Director, the zoologist Hans Przibram, oversaw until 1938, the attempt to integrate ontogeny with studies of inheritance using precise and controlled measurements of the impact of environmental influences on the emergence of form and function. In the early years, these efforts paralleled and even fostered the emergence of experimental biology in America. But fate intervened. Though the Institute served an international community, most of its resident scientists and staff were of Jewish ancestry. Well before the Nazis entered Austria in 1938, these men and women were being fired and driven out; some, including Przibram, were eventually killed. We describe the unprecedented facilities built and the topics addressed by the several departments that made up this Institute, stressing those most relevant to the establishment and success of the Journal of Experimental Zoology, which was founded just a year later. The Institute's diaspora left an important legacy in North America, perhaps best embodied by the career of the developmental neuroscientist Paul Weiss. © 2015 Wiley Periodicals, Inc.

  19. The Vienna LTE-advanced simulators up and downlink, link and system level simulation

    CERN Document Server

    Rupp, Markus; Taranetz, Martin

    2016-01-01

    This book introduces the Vienna Simulator Suite for 3rd-Generation Partnership Project (3GPP)-compatible Long Term Evolution-Advanced (LTE-A) simulators and presents applications to demonstrate their uses for describing, designing, and optimizing wireless cellular LTE-A networks. Part One addresses LTE and LTE-A link level techniques. As there has been high demand for the downlink (DL) simulator, it constitutes the central focus of the majority of the chapters. This part of the book reports on relevant highlights, including single-user (SU), multi-user (MU) and single-input-single-output (SISO) as well as multiple-input-multiple-output (MIMO) transmissions. Furthermore, it summarizes the optimal pilot pattern for high-speed communications as well as different synchronization issues. One chapter is devoted to experiments that show how the link level simulator can provide input to a testbed. This section also uses measurements to present and validate fundamental results on orthogonal frequency division multiple...

  20. Network environ perspective for urban metabolism and carbon emissions: a case study of Vienna, Austria.

    Science.gov (United States)

    Chen, Shaoqing; Chen, Bin

    2012-04-17

    Cities are considered major contributors to global warming, where carbon emissions are highly embedded in the overall urban metabolism. To examine urban metabolic processes and emission trajectories we developed a carbon flux model based on Network Environ Analysis (NEA). The mutual interactions and control situation within the urban ecosystem of Vienna were examined, and the system-level properties of the city's carbon metabolism were assessed. Regulatory strategies to minimize carbon emissions were identified through the tracking of the possible pathways that affect these emission trajectories. Our findings suggest that indirect flows have a strong bearing on the mutual and control relationships between urban sectors. The metabolism of a city is considered self-mutualistic and sustainable only when the local and distal environments are embraced. Energy production and construction were found to be two factors with a major impact on carbon emissions, and whose regulation is only effective via ad-hoc pathways. In comparison with the original life-cycle tracking, the application of NEA was better at revealing details from a mechanistic aspect, which is crucial for informed sustainable urban management.

  1. Education, Enlightenment and Positivism: The Vienna Circle's Scientific World-Conception Revisited

    Science.gov (United States)

    Uebel, Thomase.

    The scientific world-conception is properly understood as an enlightenment philosophy only if the current reassessment of the historical Vienna Circle(as opposed to the caricature still prevalent in the popular philosophical imagination) is once more extended to comprehend not only its thorough-going epistemological anti-foundationalism, but also the voluntarist point of its ethical`non-cognitivism'. That is to say, the scientific world-conception is properly understood as the opposite of village positivism only if it is recognized that it has an `other' and that the scientific world-conception was meant by its proponents to perform its enlightenment work only in conjunction with that other of scientific reason - ethical will and willing. Scientific reason cannot determine all there is to determine, it cannot determine the will. In this sense, there was, pace village positivism, more than scientific reason dreamt of. Scientific reason was not made absolute: rather, its (self-) clarification was required if a satisfactory view of its place in `life' was to be attained.

  2. Parascolymia (Scleractinia: Lobophylliidae in the Central Paratethys Sea (Vienna Basin, Austria and its possible biogeographic implications.

    Directory of Open Access Journals (Sweden)

    Markus Reuter

    Full Text Available Palaeobiogeographical and palaeodiversity patterns of scleractinian reef corals are generally biased due to uncertain taxonomy and a loss of taxonomic characters through dissolution and recrystallization of the skeletal aragonite in shallow marine limestones. Herein, we describe a fossil lobophylliid coral in mouldic preservation from the early middle Miocene Leitha Limestone of the Central Paratethys Sea (Vienna Basin, Austria. By using grey-scale image inversion and silicone rubber casts for the visualization of the original skeletal anatomy and the detection of distinct micromorphological characters (i.e. shape of septal teeth, granulation of septocostae Parascolymia bracherti has been identified as a new species in spite of the dissolved skeleton. In the recent era, Parascolymia like all Lobophylliidae is restricted to the Indo-Pacific region, where it is represented by a single species. The new species proves the genus also in the Miocene Mediterranean reef coral province. A review of the spatio-temporal relationships of fossil corals related to Parascolymia indicates that the genus was probably rooted in the Eastern Atlantic‒Western Tethys region during the Paleocene to Eocene and reached the Indo-Pacific region not before the Oligocene. The revealed palaeobiogeographical pattern shows an obvious congruence with that of Acropora and tridacnine bivalves reflecting a gradual equatorwards retreat of the marine biodiversity center parallel to the Cenozoic climate deterioration.

  3. Dilatant shear band formation and diagenesis in calcareous, arkosic sandstones, Vienna Basin (Austria)

    Science.gov (United States)

    Lommatzsch, Marco; Exner, Ulrike; Gier, Susanne; Grasemann, Bernhard

    2015-01-01

    The present study examines deformation bands in calcareous arkosic sands. The investigated units can be considered as an equivalent to the Matzen field in the Vienna Basin (Austria), which is one of the most productive oil reservoirs in central Europe. The outcrop exposes carbonate-free and carbonatic sediments of Badenian age separated by a normal fault. Carbonatic sediments in the hanging wall of the normal fault develop dilation bands with minor shear displacements (< 2 mm), whereas carbonate-free sediments in the footwall develop cataclastic shear bands with up to 70 cm displacement. The cataclastic shear bands show a permeability reduction up to 3 orders of magnitude and strong baffling effects in the vadose zone. Carbonatic dilation bands show a permeability reduction of 1-2 orders of magnitude and no baffling structures. We distinguished two types of deformation bands in the carbonatic units, which differ in deformation mechanisms, distribution and composition. Full-cemented bands form as dilation bands with an intense syn-kinematic calcite cementation, whereas the younger loose-cemented bands are dilatant shear bands cemented by patchy calcite and clay minerals. All analyzed bands are characterized by a porosity and permeability reduction caused by grain fracturing and cementation. The changed petrophysical properties and especially the porosity evolution are closely related to diagenetic processes driven by varying pore fluids in different diagenetic environments. The deformation band evolution and sealing capacity is controlled by the initial host rock composition. PMID:26300577

  4. Microbacterium aerolatum sp. nov., isolated from the air in the 'Virgilkapelle' in Vienna.

    Science.gov (United States)

    Zlamala, Christian; Schumann, Peter; Kämpfer, Peter; Valens, Maria; Rosselló-Mora, Ramon; Lubitz, Werner; Busse, Hans-Jürgen

    2002-07-01

    Three rod-shaped, Gram-positive strains were isolated from the air of the chapel 'Virgilkapelle' in Vienna. A representative of these three strains, strain V-73T, shared the highest 16S rDNA sequence similarities with members of the genus Microbacterium, in particular Microbacterium foliorum, Microbacterium testaceum, Microbacterium esteraromaticum, Microbacterium keratanolyticum and Microbacterium arabinogalactanolyticum. The strains displayed almost identical biochemical and physiological characteristics and showed no differences in their protein patterns obtained after SDS-PAGE. On the basis of Fourier-transform infra-red (FT-IR) spectra and genomic fingerprints, the three strains were grouped together and separated from the other relevant members of the genus Microbacterium. The chemotaxonomic characteristics analysed, including polar lipids, quinone systems, cell wall composition and fatty acid profiles, were in good agreement with the characteristics described for the genus Microbacterium. The G+C content of the DNAs was determined to be in the narrow range 69.3-69.7 mol %. The results of DNA-DNA hybridization, biochemical/physiological characterization, ERIC-PCR-generated genomic fingerprints and FT-IR spectra demonstrated that the three isolates represent a novel species of the genus Microbacterium. The name Microbacterium aerolatum sp. nov. is proposed for the novel species, of which strain V-73T (= DSM 14217T = CCM 4955T) is the type strain.

  5. Suburban Processes of Islandisation in Austria: The Cases of Vienna and Tyrol

    Directory of Open Access Journals (Sweden)

    Wolfgang Andexlinger

    2015-12-01

    Full Text Available Suburban areas are often described as monotonous and generic. In Europe, however, suburban areas show distinct morphological and functional configurations in different regions due to cultural, spatial, economic, and institutional conditions. This paper compares recent suburban developments in Austria in the region south of Vienna and in the region of Tyrol, highlighting significant developments after 1985 in the fields of housing, shopping, leisure, and commercial sites. Using quantitative (aerial images, statistical data, plans and qualitative (case studies methods, the paper analyses the distinct morphological similarities of selected case studies and tries to answer two questions. First, how can these developments be assessed from the viewpoint of urban and spatial planning? Second, what spatial strategies could be useful for further interventions? It is concluded that these developments can be understood as island-like developments. This means that hybrid suburban structures have appeared where sharp-edged boundaries separate single elements from adjacent ones. These island-like developments have increased dramatically over the past decades and are today to a large extent characteristic of Austrian suburbs. Capitalism, market liberalisation, and prevailing planning regulations and culture are driving these processes of islandisation. The paper furthermore shows that new spatial strategies are required for creating more coherent spaces. Interstitial landscape as a planning tool seems to be one option for creating more livable and sustainable suburban areas in the future.

  6. Food and feed supply and waste disposal in the industrialising city of Vienna (1830-1913): a special focus on urban nitrogen flows.

    Science.gov (United States)

    Gierlinger, Sylvia

    Taking an urban metabolism perspective, this article investigates food and feed consumption as well as flows of nitrogen in the city of Vienna during the industrial transformation. It addresses the question of the amount of agricultural products consumed in the city and their nitrogen content, their origin and their fate after consumption. Changes in dietary nitrogen flows in nineteenth century Vienna are embedded in the context of a socio-ecological transition from an agrarian to an industrial socio-metabolic regime. Similarities and differences in the size and dynamics of urban nitrogen flows in Vienna and Paris are discussed. Critical reading of historical sources and historical material flow accounting are the methodological backbone of this study. Between 1830 and 1913, inflows of dietary nitrogen into the city increased fivefold. Throughout the time period under observation, the urban waterscape was the most important sink for human and animal excreta. The amount of nitrogen disposed of in the urban waterscape via urban excreta increased sevenfold. The average daily consumption of nitrogen per capita was very similar to that in Paris, but the composition of foodstuff differed. In Vienna, the share of meat in food consumption was considerably higher. Both cities had to face the challenge of increasing output flows. However, urban authorities in Vienna and Paris came to different solutions of how to deal with this challenge. Besides institutional settings, the specific geomorphology of the cities as well as biogeographic factors such as the absorption capacity of the Danube in Vienna and the Seine in Paris mattered.

  7. Digitalization of the exceptional building and decorative stones collection of the Natural History Museum Vienna

    Science.gov (United States)

    Ferrière, Ludovic; Steinwender, Christian

    2014-05-01

    The Natural History Museum Vienna (NHMV) owns one of the largest building, decorative, and ornamental stones collections in Europe. This important collection dates back to the 19th century and was initiated by curator Felix Karrer after a donation of the "Union-Baugesellschaft" (Karrer, 1892). It contains rock samples used for the construction of most of the famous buildings and monuments in Vienna and in the entire Austria and surrounding countries, as well as from other famous constructions and antique (Egyptian, Greek, Roman, etc.) monuments in the world. Decorative stones that were used for the inside parts of buildings as well as artificial materials, such as stucco, tiles, and building-materials like gravel, are also part of this collection. Unfortunately, most specimens of this collection cannot be displayed at the NHMV (i.e., only 500 specimens are visible in the display Hall I) and are therefore preserved in storage rooms, and not accessible to the public. The main objective of our project of digitalization is to share our rock collection and all treasures it contains with the large majority of interested persons, and especially to provide knowledge on these rocks for people who need this information, such as people who work in cultural, architectural, scientific, and commercial fields. So far 4,500 samples from our collection have been processed with the support of the Open Up! project (Opening up the Natural History Heritage for Europeana). Our database contains all information available on these samples (including e.g., the name of the rock, locality, historic use, heritage utilization, etc.), high-quality digital photographs (with both top and bottom sides of the samples), and scanned labels (both "old" NHMV labels and other (original) labels attached to the samples). We plan to achieve the full digitalization of our unique collection within the next two years and to develop a website to provide access to the content of our database (if adequate

  8. Factors associated with academic success at Vienna Medical School: prospective survey.

    Science.gov (United States)

    Frischenschlager, Oskar; Haidinger, Gerald; Mitterauer, Lukas

    2005-02-01

    To identify factors relating to students' success in the study of medicine at the Medical University of Vienna. In view of Austria's tradition of open access to higher education, which results large number of students, high dropout rate, long duration of studies, factors predicting success could be helpful for student counseling. In a prospective study, 674 freshmen (50.8% of students enrolled that year) responded to a questionnaire on their sociodemographic data, family background, performance in school, economic situation, living conditions, social integration and health, learning capacity, motivations related to studies and future profession, attitudes, and the ability to cope with stress. We used the results of the compulsory test of knowledge after the first year as an outcome measure of their success. By comparing two extremes of academic success, very successful students and students who twice failed the challenging first-year exam, we were able to identify three factors relevant in predicting academic success: male sex, German as mother tongue, and good performance in secondary school. Moreover, there is evidence that maturity and intrinsic motivational structure are linked to superior academic performance. The results of this study differ from or even contradict the findings of previous retrospective studies in Austria. We suggest that a more thorough examination of the effect of gender should be undertaken in future studies. We also hope that our work will lead to the improvement in the efficiency of the German courses for foreign students. Our findings confirm the importance of success in secondary school, but also clearly indicate that it should not be the only criterion for university admission.

  9. Liability for nuclear damage: an international perspective. Reflections on the revision of the Vienna Convention

    Energy Technology Data Exchange (ETDEWEB)

    Lopuski, J.

    1993-12-31

    This book deals with deals of the complex issues of liability and compensation for nuclear damage which have been considered in the course of the work of the IAEA concerning the revision of the Vienna Convention on nuclear liability. It presents, in an orderly way, personal reflections of its author based on his experience gathered in years 1989-1992 when participating in this work. Necessarily it contains in some of its parts references to documents of the IAEA Standing Committee on Nuclear Liability; these documents because of their length could not be reproduced. Consequently these parts may not be fully intelligible for those who have not participated in or closely followed the Committee`s work. The IAEA work on liability for nuclear damage was initiated in the wake of the impact made on the world`s public opinion by the Chernobyl incident and its transboundary effects; issues of international state liability and full compensation have been raised. But humanitarian ideas have quickly been confronted with cold calculations of the cost of financial protection for victims and an open unwillingness of some nuclear states has been manifested. After three years of discussions no wide consensus could be reached on some basic issues, such as: relationship between international state and civil liability regimes, structure of international legislation, concept of nuclear damage, limits of compensation, role of public funds or jurisdiction. The author presents his approach to these controversial issue, trying to provide at the same time a theoretical outline for the future international legislation on nuclear liability. (author).

  10. Promoting interdisciplinary education - the Vienna Doctoral Programme on Water Resource Systems

    Science.gov (United States)

    Blöschl, G.; Carr, G.; Bucher, C.; Farnleitner, A. H.; Rechberger, H.; Wagner, W.; Zessner, M.

    2012-02-01

    The Vienna Doctoral Programme on Water Resource Systems (DK-WRS) is a programme that aims to educate students in interdisciplinary water science through cutting edge research at an international level. It is funded by the Austrian Science Fund and designed to run over a period of 12 yr during which 80 doctoral students are anticipated to graduate. This paper reports on our experiences of setting up and implementing the Programme. We identify three challenges: integrating the disciplines, maintaining depth in an interdisciplinary programme, and teaching subjects remote to each student's core expertise. To address these challenges we adopt a number of approaches. We use three levels of instruments to foster integration across the disciplines: joint groups (e.g. a joint study programme), joint science questions (e.g. developed in annual symposia), and joint study sites. To maintain depth we apply a system of quality control including regular feedback sessions, theses by journal publications and international study exchange. For simultaneously teaching students from civil and environmental engineering, biology, geology, chemistry, mathematics we use visually explicit teaching, learning by doing, extra mentoring and by cross relating associated subjects. Our initial assessment of the Programme shows some very positive outcomes. Joint science questions formed between students from various disciplines indicate integration is being achieved. The number of successful publications in top journals suggests that depth is maintained. Positive feedback from the students on the variety and clarity of the courses indicates the teaching strategy is working well. Our experiences have shown that implementing and running an interdisciplinary doctoral programme has its challenges and is demanding in terms of time and human resources but seeing interactions progress and watching people grow and develop their way of thinking in an interdisciplinary environment is a valuable reward.

  11. Promoting interdisciplinary education − the Vienna Doctoral Programme on Water Resource Systems

    Directory of Open Access Journals (Sweden)

    W. Wagner

    2012-02-01

    Full Text Available The Vienna Doctoral Programme on Water Resource Systems (DK-WRS is a programme that aims to educate students in interdisciplinary water science through cutting edge research at an international level. It is funded by the Austrian Science Fund and designed to run over a period of 12 yr during which 80 doctoral students are anticipated to graduate. This paper reports on our experiences of setting up and implementing the Programme. We identify three challenges: integrating the disciplines, maintaining depth in an interdisciplinary programme, and teaching subjects remote to each student's core expertise. To address these challenges we adopt a number of approaches. We use three levels of instruments to foster integration across the disciplines: joint groups (e.g. a joint study programme, joint science questions (e.g. developed in annual symposia, and joint study sites. To maintain depth we apply a system of quality control including regular feedback sessions, theses by journal publications and international study exchange. For simultaneously teaching students from civil and environmental engineering, biology, geology, chemistry, mathematics we use visually explicit teaching, learning by doing, extra mentoring and by cross relating associated subjects. Our initial assessment of the Programme shows some very positive outcomes. Joint science questions formed between students from various disciplines indicate integration is being achieved. The number of successful publications in top journals suggests that depth is maintained. Positive feedback from the students on the variety and clarity of the courses indicates the teaching strategy is working well. Our experiences have shown that implementing and running an interdisciplinary doctoral programme has its challenges and is demanding in terms of time and human resources but seeing interactions progress and watching people grow and develop their way of thinking in an interdisciplinary environment is a

  12. Aerial Photography and Imagery, Ortho-Corrected, True Color Orthophotography for Cambridge, Hurlock, Secretary, and Vienna - 4" pixles, 2006., Published in 2006, 1:600 (1in=50ft) scale, Eastern Shore Regional GIS Cooperative.

    Data.gov (United States)

    NSGIC Regional | GIS Inventory — Aerial Photography and Imagery, Ortho-Corrected dataset current as of 2006. True Color Orthophotography for Cambridge, Hurlock, Secretary, and Vienna - 4" pixles,...

  13. Stereotactic photon beam irradiation of uveal melanoma: indications and experience at the University of Vienna since 1997

    Energy Technology Data Exchange (ETDEWEB)

    Dieckmann, K.; Georg, D.; Rottenfusser, A.; Poetter, R. [Dept. of Radiotherapy, Univ. of Vienna (Austria); Zehetmayer, M. [Dept. of Ophthalmology, Univ. of Vienna (Austria)

    2007-12-15

    Most uveal melanomas are currently treated by eye-preserving radiotherapy. No advantage of enucleation of posterior uveal melanoma (< 12 mm) could be demonstrated in multiple studies (e.g.). Besides brachytherapy and highly conformal proton therapy advanced photon beam therapy techniques have been introduced during the last years. Since 1997, at the Medical University of Vienna, patients with uveal melanoma have been treated with 3D stereotactic photon beam radiotherapy. Special fixation- and eye-monitoring systems have been developed to perform a local treatment which provides high local tumor control with acceptable long term side effects. (orig.)

  14. Air for learning. School of healthcare and nursing of Vienna; Luft zum Lernen. Gesundheits- und Krankenpflegeschule der Stadt Wien

    Energy Technology Data Exchange (ETDEWEB)

    Lichtblau, Andreas; Wagner, Susanna [lichtblauwagner architekten, Vienna (Austria)

    2012-07-01

    Due to the generously and light volume of space, the self-regulating shading system as well as the energy efficient ventilation, the energy optimized school of healthcare and nursing of the Kaiser-Franz-Josef-Hospital (Vienna, Austria) provides significant innovative steps in school buildings. The heterogeneous space on offer as well as the four-story, open hall with a maximum natural lighting and acoustics, which is attuned to the classrooms, enable a learning and working in a friendly atmosphere. With the open space structure and the row of trees as a technical shading system the building upgrades the traffic-exposed environment.

  15. Neutron flux measurements at the TRIGA reactor in Vienna for the prediction of the activation of the biological shield.

    Science.gov (United States)

    Merz, Stefan; Djuricic, Mile; Villa, Mario; Böck, Helmuth; Steinhauser, Georg

    2011-11-01

    The activation of the biological shield is an important process for waste management considerations of nuclear facilities. The final activity can be estimated by modeling using the neutron flux density rather than the radiometric approach of activity measurements. Measurement series at the TRIGA reactor Vienna reveal that the flux density next to the biological shield is in the order of 10(9)cm(-2)s(-1) at maximum power; but it is strongly influenced by reactor installations. The data allow the estimation of the final waste categorization of the concrete according to the Austrian legislation. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Effects of rupatadine vs placebo on allergen-induced symptoms in patients exposed to aeroallergens in the Vienna Challenge Chamber.

    Science.gov (United States)

    Stuebner, Petra; Horak, Friedrich; Zieglmayer, René; Arnáiz, Eva; Leuratti, Chiara; Pérez, Iñaki; Izquierdo, Iñaki

    2006-01-01

    Rupatadine is a novel compound with potent dual antihistamine and platelet-activating factor antagonist activities and no sedative effects. To evaluate the efficacy of rupatadine, 10 mg once daily, and placebo on allergen-induced symptoms (including nasal congestion), nasal airflow, nasal secretion, and subjective tolerability in response to grass pollen in a controlled allergen-exposure chamber. In a randomized, double-blind, placebo-controlled, crossover trial, 45 patients with a history of seasonal allergic rhinitis received rupatadine or placebo every morning for 8 days in 2 different periods separated by a 14-day washout interval. On day 8 of each crossover period, patients underwent a 6-hour allergen exposure in the Vienna Challenge Chamber, where a constant and homogeneous concentration of aeroallergens was maintained. Subjective and objective assessments were performed online during the exposure. Subjective single and composite nasal and nonnasal symptoms were consistently less severe with rupatadine use than with placebo use starting from the first evaluation at 15 minutes to the end of the 6-hour Vienna Challenge Chamber challenge, with the most significant effects seen for nasal rhinorrhea, nasal itching, sneezing attacks, and total nasal symptoms (P rupatadine therapy than with placebo use (P rupatadine treatment was well tolerated. Rupatadine treatment is effective and well tolerated in patients with allergen-induced symptoms exposed to aeroallergens in a controlled exposure chamber.

  17. Tourist Intensity in Capital Cities in Central Europe: Comparative Analysis of Tourism in Prague, Vienna and Budapest

    Directory of Open Access Journals (Sweden)

    Dumbrovská Veronika

    2014-12-01

    Full Text Available Urban tourism has become a significant phenomenon of tourism over the last decade. the importance of urban tourism has grown mainly due to the development of transport and information technologies. rapid advancement of low cost airlines and reduction of administrative barriers owing to the expansion of the schengen area caused not only the development of a number of urban destinations, including Prague, but also the growth of new source markets. this paper compares the development of urban tourism in Prague with the situation in Vienna and Budapest in the last decade. the aim of the paper is to describe the main trends of tourism development and the geographic distribution of tourism in Prague in comparison with culturally and historically similar cities - Vienna and Budapest. the analysis shows high load of tourism in Prague and its strong concentration in the old city. this causes congestion in the city centre and an extrusion of residential functions by the functions of tourism. As a result, a tourism ghetto has been formed in the centre of Prague and the urban society has been increasingly dualized.

  18. Geochemistry of hydrothermal fluids from the PACMANUS, Northeast Pual and Vienna Woods hydrothermal fields, Manus Basin, Papua New Guinea

    Science.gov (United States)

    Reeves, Eoghan P.; Seewald, Jeffrey S.; Saccocia, Peter; Bach, Wolfgang; Craddock, Paul R.; Shanks, Wayne C.; Sylva, Sean P.; Walsh, Emily; Pichler, Thomas; Rosner, Martin

    2011-01-01

    Processes controlling the composition of seafloor hydrothermal fluids in silicic back-arc or near-arc crustal settings remain poorly constrained despite growing evidence for extensive magmatic-hydrothermal activity in such environments. We conducted a survey of vent fluid compositions from two contrasting sites in the Manus back-arc basin, Papua New Guinea, to examine the influence of variations in host rock composition and magmatic inputs (both a function of arc proximity) on hydrothermal fluid chemistry. Fluid samples were collected from felsic-hosted hydrothermal vent fields located on Pual Ridge (PACMANUS and Northeast (NE) Pual) near the active New Britain Arc and a basalt-hosted vent field (Vienna Woods) located farther from the arc on the Manus Spreading Center. Vienna Woods fluids were characterized by relatively uniform endmember temperatures (273-285 degrees C) and major element compositions, low dissolved CO2 concentrations (4.4 mmol/kg) and high measured pH (4.2-4.9 at 25 degrees C). Temperatures and compositions were highly variable at PACMANUS/NE Pual and a large, newly discovered vent area (Fenway) was observed to be vigorously venting boiling (358 degrees C) fluid. All PACMANUS fluids are characterized by negative delta DH2O values, in contrast to positive values at Vienna Woods, suggesting substantial magmatic water input to circulating fluids at Pual Ridge. Low measured pH (25 degrees C) values (~2.6-2.7), high endmember CO2 (up to 274 mmol/kg) and negative delta 34SH2S values (down to -2.7 permille) in some vent fluids are also consistent with degassing of acid-volatile species from evolved magma. Dissolved CO2 at PACMANUS is more enriched in 13C (-4.1 permille to -2.3 permille) than Vienna Woods (-5.2 permille to -5.7 permille), suggesting a contribution of slab-derived carbon. The mobile elements (e.g. Li, K, Rb, Cs and B) are also greatly enriched in PACMANUS fluids reflecting increased abundances in the crust there relative to the Manus

  19. Vienna University Observatory and Bruno Thüring (German Title: Die Wiener Universitätssternwarte und Bruno Thüring )

    Science.gov (United States)

    Kerschbaum, Franz; Posch, Thomas; Lackner, Karin

    We investigate Bruno Thüring's political attitude during the time of National Socialism, based on material from the Vienna Observatory archive, and on statements by his contemporaries. The contribution focuses on the filling of astronomy positions in Vienna, and also on the expulsion of Kasimir Graff. A central role is played by Wilhelm Führer, Obersturmführer der Waffen-SS (Senior Storm Leader of the Armed Protection Squad) and chief civil servant in the Reich science ministry. The transcription of an original letter of 1939 by Führer, addressed to Thüring, is given.

  20. Economic models of compensation for damages caused by nuclear accidents: some lessons for the revision of the Paris and Vienna Conventions

    Energy Technology Data Exchange (ETDEWEB)

    Faure, Michael G. [Limburg Univ., Maastricht (Netherlands). Faculty of Law

    1995-12-31

    Alternative systems of compensation for damages caused by nuclear accidents have been proposed. In respect, the question merits attention to whether these alternative models of compensation discussed in the economic literature could be implemented when discussing the revision of the Paris and Vienna Conventions. 55 refs., 1 tab.

  1. Clinical trials update from the European Society of Cardiology Congress in Vienna, 2007 : PROSPECT, EVEREST, ARISE, ALOFT, FINESSE, Prague-8, CARESS in MI and ACUITY

    NARCIS (Netherlands)

    Recio-Mayoral, A.; Kaski, J. -C.; McMurray, J. J. V.; Horowitz, J.; van Veldhuisen, D. J.; Remme, W. J.

    2007-01-01

    The Clinical Trials described in this article were presented at the Hotline and Clinical Trial Update Sessions of the European Society of Cardiology Congress held in September 2007 in Vienna, Austria. The sessions chosen for this article represent the scope of interest of Cardiovascular Drugs and

  2. [Migration in Austria: 1850-1900. Migration flows within the monarchy and the structure of migration to Vienna].

    Science.gov (United States)

    Fassmann, H

    1986-01-01

    The author surveys migration within the Austrian part of the Austro-Hungarian Empire from 1850 to 1900 using census data. "As a result of the increase in regional mobility during the nineteenth century, clearly defined patterns of migration developed involving movement from the peripheral areas to the center.... In the process of this development, various sub-systems of migration appeared. Of these, migration from one region to another was more important than that within the same region...and Vienna, the Imperial capital, became the center of migration." Migrants are studied by place of origin and distance traveled and by social class and demographic characteristics. Employment, segregation, and the integration of urban migrants are also considered. (SUMMARY IN ENG) excerpt

  3. The Beginnings and Development of the Collection of Historic Musical Instruments of the Kunsthistorisches Museum in Vienna

    Directory of Open Access Journals (Sweden)

    Beatrix Darmstaedter

    2016-12-01

    Full Text Available The Collection of Historic Musical Instruments of the Kunsthistorisches Museum in Vienna (KHM was founded during the First World War when the inventories of the collections owned by Archduke Franz Ferdinand of Austria-Este (1863-1914 went to the Imperial museum in Vienna after his assassination. From 1916/17 on, the renowned art historian Julius von Schlosser (1866-1938 and his successor, Hermann Julius Hermann (1869-1953, organized one of the most important collections and exhibitions exclusively dedicated to musical instruments. They assembled valuable items from the 16th century that had belonged to Archduke Ferdinand II’s (1529-1595 Cabinet of Curiosities, objects collected by members of the Obizzi dynasty in the castle of Catajo, and recently acquired historical instruments connected with the Viennese tradition of instrument making. In 1920, Schlosser wrote his fundamental catalogue on the newly established collection that  is considered to be the fi rst systematical and scientifi c publication on historic musical instruments in Austria. During the following years, he strove towards amplifying the inventory and expanding the exhibition. He transferred precious items originally belonging to the movables depot of the erstwhile court (Hofmobiliendepot and instruments left in former imperial residences, such as the castle of Laxenburg. The contribution reviews previously unpublished archived sources documenting the early history of the collection and broaches the issue of the extended exhibition in the 1920s, discusses the thematic orientations of the collection and the principles in museum didactic that consequently arose. Moreover, the position of the collection and its policy in the context of other museums with similar emphases at that time will be analyzed. La collezione di strumenti musicali antichi del Kunsthistorisches Museum a Vienna (KHM é stata fondata durante la prima guerra mondiale quando l’inventario delle collezioni dell

  4. Between Vienna and Moscow: the Protopope and the General Vicar Nicolae Pop Balomiri(c. 1700 to c. 1764

    Directory of Open Access Journals (Sweden)

    Cristian Ioan Popa

    2016-12-01

    Full Text Available This article explores the life of Nicolae Pop Balomiri, a Greek-Catholic Protopope and Orthodox Archimandrite. Appointed General Vicar by the exiled Bishop Inochentie Micu-Klein in 1747, Balomiri fled Transylvania shortly afterwards when the Court in Vienna refused to acknowledge his appointment, instead supporting his predecessor, Petru Pavel Aaron. Early on in his exile, Balomiri converted to Orthodoxy, and was later made Archimandrite of the Monastery of Curtea de Argeş. From exile in Wallachia, he continued to campaign for the rights of Romanian Orthodox Christians in Transylvania, lobbying Russian Empress Elisabeta Petrovna to intervene with the Viennese to request a non-United bishop for Transylvania. Many historians have glossed over Balomiri’s importance, possibly because of his controversial role as an apostate priest.

  5. ["The aim is familiarity with the infant". Work and research in the Jackson Nursery (Vienna 1937/38)].

    Science.gov (United States)

    Krivanek, Roman

    2014-01-01

    The "Jackson Nursery", existing from February 1937 until March 1938, was directed by Anna Freud and financed by Edith Jackson and Dorothy Burlingham. It took care of infants from the poorest strata of Vienna and also gave material support to their families. On the other hand, it was a training institution for psychoanalysts, offering the opportunity of observing children during their first two years, e. g. their feeding habits and social sense. In addition, the Jackson Nursery was a place for research where psychoanalytic theories of infantile development were checked against the findings of direct observation. The work started here was then continued by A. Freud and D. Burlingham on a larger scale in their War Nurseries.--This paper examines the many-sided activities in the nursery mainly on the basis of unpu blished archival documents.

  6. Validation of the Austrian forecast model for solar, biologically effective UV radiation-UV index for Vienna

    Science.gov (United States)

    Schmalwieser, Alois W.; Schauberger, Günther

    2000-11-01

    Since October 1995, a daily forecast of the UV index, as the irradiance of the biologically effective ultraviolet radiation, for the next day is published for Austria, Europe, and world wide. The Austrian forecast model as well as the input parameters are described. By connecting the UV index with the sensitivity of the photobiological skin types, a recommendation is given to select an appropriate sun protection factor of a sunscreen to avoid overexposure of the skin. The validation of the Austrian forecast model is done by measurements of the biologically effective ultraviolet radiation collected between July 1996 and July 1998 at Vienna (48°N, 16°E), Austria. The forecast quality is evaluated by comparing the Austrian model with two statistical models used in Canada and the Netherlands. By using the underestimation of the UV index as criteria in the sense of radiation protection, the Austrian model shows a 12% underestimation over the whole year.

  7. PREFACE: EUCAS '05: The 7th European Conference on Applied Superconductivity (Vienna University of Technology, Austria, 11 15 September 2005)

    Science.gov (United States)

    Donaldson, Gordon; Weber, Harald W.; Sauerzopf, Franz M.

    2006-03-01

    This issue of Superconductor Science and Technology contains the plenary and invited papers presented at the 7th European Conference on Applied Superconductivity (EUCAS '05) that was held at the Vienna University of Technology from 11-15 September 2005. All those contributed papers that were submitted to the Conference Proceedings will be published in the Journal of Physics: Conference Series. The scientific aims of EUCAS '05 followed the tradition established at the preceding conferences in Göttingen, Edinburgh, Eindhoven, Sitges (Barcelona), Lyngby (Copenhagen) and finally Sorrento (Napoli). The focus was placed on the interplay between the most recent developments in superconductor research and the positioning of applications of superconductivity in the marketplace. Although initially founded as an exchange forum mainly for European scientists, it has gradually developed into a truly international meeting with significant attendance from the Far East and the United States. The Vienna conference attracted 813 participants in the scientific programme and 90 accompanying persons. 59% of all participants came from Europe, 31% from the Far East, 6% from the United States and Canada as well as 4% from other nations worldwide. 27 companies presented their latest developments in the field. 32 plenary and invited lectures highlighted the state-of-the-art in the areas of materials, large-scale as well as small-scale applications; 625 contributed papers (among them 556 posters) demonstrated the broad range of exciting activities in all research areas of our field. EUCAS '05 spread a lot of optimism and enthusiasm for this fascinating field of research and for its well established technological potential, especially among the numerous young researchers attending this conference. We are grateful to all those who participated in the meeting and contributed to its success.

  8. Sterile medfly males of the tsl Vienna 8 genetic sexing strain display improved mating performance with ginger root oil

    Energy Technology Data Exchange (ETDEWEB)

    Paranhos, Beatriz Jordao; Alves, Renata Morelli, E-mail: bjordao@cpatsa.embrapa.b [EMBRAPA Semi-Arido, Petrolina, PE (Brazil); McInnis, Donald [U.S. Department of Agriculture (USDA/ARS/PBARC), Honolulu, HI (United States). Agricultural Research Service. Pacific Basin Agricultural Research Center; Uramoto, Keiko [Universidade de Sao Paulo (USP), SP (Brazil); Damasceno, Itala; Malavasi, Aldo [Biofabrica Moscamed Brasil, Juazeiro, BA (Brazil); Goncalves, Nilmara [Valexport, Petrolina, PE (Brazil); Costa, Maria de Lourdes; Walder, Julio [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil); Nascimento, Antonio [EMBRAPA Mandioca e Fruticultura, Cruz das Almas, BA (Brazil)

    2006-07-01

    A key point of the sterile insect technique applied to the medfly, Ceratitis capitata, is that the sterile males produced in the laboratory should have at least a minimal sexual compatibility with wild females. Among several genetic sexing tsl (Temperature Sensitive Lethal) strains of C. capitata mass-reared around the world, the Biofabrica Moscamed Brasil has chosen the most recent mass produced tsl strain, Vienna 8 (V8), which has been evaluated in the San Francisco River Valley, Brazil, since April, 2005. The tests were accomplished in field cages, with different treatments for V8 males, sterile or fertile, exposed to the aroma of ginger root oil (GRO) or not, versus wild males and females. Males of one strain (V8 or wild) were painted white on the thorax the day before the mating tests. All the insects were virgin, and early in the morning (7-8 A.M.) males were released inside the field cages, 10 min. before females. Mating pairs were collected in glass vials, until early afternoon. From this raw data, both the type of male mating and the time in copula were recorded for each pair. Then, the total percentage of mated females, the RSI (Relative Sterility Index), and Fried's competitiveness values (C), were calculated for each field cage. The percentage of females mated was statistically higher to sterile males exposed to GRO than to non exposed to GRO. Time in copula was significantly higher for wild flies than for laboratory flies, except for the case of fertile V8 males exposed to GRO x wild females. The RSI and C values were significantly higher for V8 males (irradiated and fertile) treated with GRO than for V8 males not treated with GRO. The results indicate that there is adequate sexual compatibility between sterile males of the tsl Vienna 8 strain and wild C. capitata females from the San Francisco River Valley, Brazil. Also, the radiation dose of 95 Gy, used to sterilize the males, did not affect their sexual activity. Ginger root oil acted as a

  9. Towards improving sterile insect technique: Exposure to orange oil compounds increases sexual signalling and longevity in Ceratitis capitata males of the Vienna 8 GSS

    Science.gov (United States)

    Gerofotis, Christos D.; Ioannou, Charalampos S.; Iliadis, Ioannis V.; Papadopoulos, Nikos T.; Koveos, Dimitris S.

    2017-01-01

    The Mediterranean fruit fly (medfly), Ceratitis capitata, is a notorious insect pest causing huge economic losses worldwide. The sterile insect technique (SIT) is widely used for its control. Using sexually mature sterilized males of the Vienna 8 (tsl) strain in the laboratory, we explored whether exposure of males to citrus compounds (separately or in a mixture) affects their sexual behaviour and if nutritional conditions and age modulate those effects. Exposed males exhibited increased sexual signalling compared to unexposed ones, particularly when fed a rich adult diet. Interestingly, and for the first time reported in medfly, exposure of Vienna 8 males to a mixture of citrus compounds increases longevity under poor adult diet conditions. We discuss the possible associated mechanisms and provide some practical implications of our results towards improving the effectiveness of SIT. PMID:29190755

  10. Towards improving sterile insect technique: Exposure to orange oil compounds increases sexual signalling and longevity in Ceratitis capitata males of the Vienna 8 GSS.

    Directory of Open Access Journals (Sweden)

    Nikos A Kouloussis

    Full Text Available The Mediterranean fruit fly (medfly, Ceratitis capitata, is a notorious insect pest causing huge economic losses worldwide. The sterile insect technique (SIT is widely used for its control. Using sexually mature sterilized males of the Vienna 8 (tsl strain in the laboratory, we explored whether exposure of males to citrus compounds (separately or in a mixture affects their sexual behaviour and if nutritional conditions and age modulate those effects. Exposed males exhibited increased sexual signalling compared to unexposed ones, particularly when fed a rich adult diet. Interestingly, and for the first time reported in medfly, exposure of Vienna 8 males to a mixture of citrus compounds increases longevity under poor adult diet conditions. We discuss the possible associated mechanisms and provide some practical implications of our results towards improving the effectiveness of SIT.

  11. The pre-Anschluss Vienna School of Medicine - the physicians: Sigmund Freud (1856-1939), Julius Wagner-Jauregg (1857-1940) and Karel Wenckebach (1864-1940).

    Science.gov (United States)

    Shaw, Lily Bzl; Shaw, Robert A

    2016-05-01

    Three physicians are discussed. Sigmund Freud, probably the best-known member of the Vienna School of Medicine, was the path-breaking pioneer in psychoanalysis and psychotherapy. Julius Wagner-Jauregg was a psychiatrist who discovered the link between iodine deficiency and goitre and also developed malaria therapy to treat progressive paralysis caused by syphilis for which he was awarded the Nobel Prize. Karel Wenckebach, the pioneering Dutch cardiologist, is best known for the Wenckebach block. After the Anschluss, fate dealt very different hands to these three physicians. Freud fled to London where he soon died. Wagner-Jauregg, who had some pan-Germanic sympathies as well as views on eugenics, left a controversial legacy. The Dutch cardiologist Wenckebach died in Vienna shortly after his homeland had been invaded in 1940 by that of his hosts. © IMechE 2014.

  12. Opfer des NS-Bücherraubes – 10 Fälle aus medizinischen Bibliotheken in Wien: Provenienzforschungsprojekt an der Universitätsbibliothek der Medizinischen Universität Wien / Victims of book expropriation during nazi regime – 10 examples from medical libraries in Vienna: provenance research project at the university library at the Medical University Vienna

    Directory of Open Access Journals (Sweden)

    Bauer, Bruno

    2008-01-01

    Full Text Available Since 2007 the university library at the Medical University Vienna runs a provenance research project. Books, stolen between 1938 and 1945, were acquired by at that time discrete libraries at institutions and clinics of the former medical faculty at Vienna University. A systematic survey of the now centralised book collection should bring to light these misgotten book acquisitions. Aim of the project is to document such cases and to restitute books to their lawful owners or their legal successors. Until Novemver 2008 about 80,000 volumes were scrutinised directly at the shelves by so-called autopsy. So far about 200 definitely stolen books and approximately 1800 suspicious books were dedected. This paper describes the initial position, method and hitherto existing results of the provenance research project. Ten cases of such book theft, recorded in the now centralised collection of the university library of the Medical University Vienna (former medical faculty, should depict victims of book expropiation during nazi regime. These cases include second-hand bookshops (Alois Fantl, Hans Peter Kraus, an university professor from the former medical faculty at Vienna University (Markus Hajek, general practitioners not associated with the former medical faculty (Adolf Kronfeld, Richard Löwi, private persons (Lily Fuchs, Raoul Fernand Jellinek-Mercedes and books from public and private libraries (Akademischer Verein jüdischer Mediziner, Bibliothek Sassenbach, Ortskrankenkasse Dresden.

  13. HOW TO PINPOINT ENERGY-INEFFICIENT BUILDINGS? AN APPROACH BASED ON THE 3D CITY MODEL OF VIENNA

    Directory of Open Access Journals (Sweden)

    B. Skarbal

    2017-09-01

    Full Text Available This paper describes a methodology to assess the energy performance of residential buildings starting from the semantic 3D city model of Vienna. Space heating, domestic hot water and electricity demand are taken into account. The paper deals with aspects related to urban data modelling, with particular attention to the energy-related topics, and with issues related to interactive data exploration/visualisation and management from a plugin-free web-browser, e.g. based on Cesium, a WebGL virtual globe and map engine. While providing references to existing previous works, only some general and introductory information is given about the data collection, harmonisation and integration process necessary to create the CityGML-based 3D city model, which serves as the central information hub for the different applications developed and described more in detail in this paper. The work aims, among the rest, at developing urban decision making and operational optimisation software tools to minimise non-renewable energy use in cities. The results obtained so far, as well as some comments about their quality and limitations, are presented, together with the discussion regarding the next steps and some planned improvements.

  14. How to Pinpoint Energy-Inefficient Buildings? AN Approach Based on the 3d City Model of Vienna

    Science.gov (United States)

    Skarbal, B.; Peters-Anders, J.; Faizan Malik, A.; Agugiaro, G.

    2017-09-01

    This paper describes a methodology to assess the energy performance of residential buildings starting from the semantic 3D city model of Vienna. Space heating, domestic hot water and electricity demand are taken into account. The paper deals with aspects related to urban data modelling, with particular attention to the energy-related topics, and with issues related to interactive data exploration/visualisation and management from a plugin-free web-browser, e.g. based on Cesium, a WebGL virtual globe and map engine. While providing references to existing previous works, only some general and introductory information is given about the data collection, harmonisation and integration process necessary to create the CityGML-based 3D city model, which serves as the central information hub for the different applications developed and described more in detail in this paper. The work aims, among the rest, at developing urban decision making and operational optimisation software tools to minimise non-renewable energy use in cities. The results obtained so far, as well as some comments about their quality and limitations, are presented, together with the discussion regarding the next steps and some planned improvements.

  15. Basic design and construction of the Vienna FES implants: existing solutions and prospects for new generations of implants.

    Science.gov (United States)

    Mayr, W; Bijak, M; Rafolt, D; Sauermann, S; Unger, E; Lanmüller, H

    2001-01-01

    We can distinguish 3 generations of FES implants for activation of neural structures: 1. RF-powered implants with antenna displacement dependent stimulation amplitude; 2. RF-powered implants with stabilised stimulation amplitude; and 3. battery powered implants. In Vienna an 8-channel version of the second generation type has been applied clinically to mobilisation of paraplegics and phrenic pacing. A 20-channel implant of the second generation type for mobilisation of paraplegics and an 8-channel implant of the third generation type for cardiac assist have been tested in animal studies. A device of completely new design for direct stimulation of denervated muscles is being tested in animal studies. There is a limited choice of technologically suitable biocompatible and bioresistant materials for implants. The physical design has to be anatomically shaped without corners or edges. Electrical conductors carrying direct current (D.C.) have to be placed inside a hermetic metal case. The established sealing materials, silicone rubber and epoxy resin, do not provide hermeticity and should only embed DC-free components. For electrical connections outside the hermetic metal case welding is preferable to soldering; conductive adhesives should be avoided. It is advisable to use a hydrophobic oxide ceramic core for telemetry antenna coils embedded in sealing polymer. Cleaning of all components before sealing in resin is of the utmost importance as well as avoidance of rapid temperature changes during the curing process.

  16. Prediction of survival after out-of-hospital cardiac arrest: results of a community-based study in Vienna.

    Science.gov (United States)

    Gaul, G B; Gruska, M; Titscher, G; Blazek, G; Havelec, L; Marktl, W; Muellner, W; Kaff, A

    1996-10-01

    The objective of this study was the assessment of out-of-hospital cardiac arrest and the definition of possible predictive factors for final hospital discharge. Out of a database of 89,557 consecutive missions of the Vienna emergency medical system (EMS) during 1990, there were 623 missions due to a collapse of non-traumatic origin: in 374 cases (60.0%) the patients were declared dead without further attempts at resuscitation. The remaining 249 patients were analysed for predictive factors at site. Survival to hospital admission: 109 patients survived to hospital admission (43.7%); bystander support had a small impact (P < 0.05) on survival to hospital arrival whereas age and gender had no predictive power. Most patients with ventricular tachycardia/fibrillation (VT/VF) survived primarily (69 of 117, i.e. 59.0%). Survival to hospital discharge: 27 patients were discharged from hospital care (10.8%). ECG findings on arrival of the EMS physician at the site proved to be the only powerful predictor for survival: 24 of 117 patients with VT/VF survived compared with only one of 81 with primary asystole, two of 39 with severe bradycardia, and no patient with electromechanical dissociation.

  17. Speech perception with the Vienna extra-cochlear single-channel implant: a comparison of two approaches to speech coding.

    Science.gov (United States)

    Rosen, S; Ball, V

    1986-02-01

    Although it is generally accepted that single-channel electrical stimulation can significantly improve a deafened patient's speech perceptual ability, there is still much controversy surrounding the choice of speech processing schemes. We have compared, in the same patients, two different approaches: (1) The speech pattern extraction technique of the EPI group, London (Fourcin et al., British Journal of Audiology, 1979,13,85-107) in which voice fundamental frequency is extracted and presented in an appropriate way, and (2) The analogue 'whole speech' approach of Hochmair and Hochmair-Desoyer (Annals of the New York Academy of Sciences, 1983, 405, 268-279) of Vienna, in which the microphone-sensed acoustic signal is frequency-equalized and amplitude-compressed before being presented to the electrode. With the 'whole-speech' coding scheme (which they used daily), all three patients showed an improvement in lipreading when they used the device. No patient was able to understand speech without lipreading. Reasonable ability to distinguish voicing contrasts and voice pitch contours was displayed. One patient was able to detect and make appropriate use of the presence of voiceless frication in certain situations. Little sensitivity to spectral features in natural speech was noted, although two patients could detect changes in the frequency of the first formant of synthesised vowels. Presentation of the fundamental frequency only generally led to improved perception of features associated with it (voicing and intonation). Only one patient consistently showed any advantage (and that not in all tests) of coding more than the fundamental alone.

  18. Urban climate model MUKLIMO_3 in prediction mode - evaluation of model performance based on the case study of Vienna

    Science.gov (United States)

    Hollosi, Brigitta; Zuvela-Aloise, Maja

    2017-04-01

    To reduce negative health impacts of extreme heat load in urban areas is the application of early warning systems that use weather forecast models to predict forthcoming heat events of utmost importance. In the state-of-the-art operational heat warning systems the meteorological information relies on the weather forecast from the regional numerical models and monitoring stations that do not include details of urban structure. In this study, the dynamical urban climate model MUKLIMO3 (horizontal resolution of 100 - 200 m) is initialized with the vertical profiles from the archived daily forecast data of the ZAMG from the hydrostatic ALARO numerical weather prediction model run at 0600 UTC to simulate the development of the urban heat island in Vienna on a daily basis. The aim is to evaluate the performance of the urban climate model, so far applied only for climatological studies, in a weather prediction mode using the summer period 2011-2015 as a test period. The focus of the investigation is on assessment of the urban heat load during the day-time. The model output has been evaluated against the monitoring data at the weather stations in the area of the city. The model results for daily maximum temperature show good agreement with the observations, especially at the urban and suburban stations where the mean bias is low. The results are highly dependent on the input data from the meso-scale model that leads to larger deviation from observations if the prediction is not representative for the given day. This study can be used to support urban planning strategies and to improve existing practices to alert decision-makers and the public to impending dangers of excessive heat.

  19. Open Space between Residential Buildings as a Factor of Sustainable Development – Case Studies in Brno (Czech Republic) and Vienna (Austria)

    Science.gov (United States)

    Kilnarová, Pavla; Wittmann, Maxmilian

    2017-12-01

    The characteristics of open spaces between residential buildings have, as authors suppose, an impact on the sustainable development of urban areas. Spatial arrangement and accessibility of these spaces, the type and height of surrounding buildings, the quantity and character of greenery, and many more characteristics influence the quality of environment, and the quality of life of local residents. These and further characteristics of the open spaces between residential buildings influence the ecological stability of the area, its hygienic qualities, the intensity and way of using by various social groups, and also the prices of real estates. These qualities indicate the environmental, social and economic sustainability of the urban area. The proposed research methodology assessed specific indicators of sustainability within a range from 0 to 10 points. 5 points correspond to the general standard in the area, 0 points indicate degradation, and 10 points indicate the highest contribution to sustainable development. Observation methods, questionnaire survey, statistical analyses, and methods of measurement were used to determine the values of the given indicators. The paper analyses the impact of the open spaces between residential buildings on sustainability via the case studies performed in the Central European cities of Brno, Czech Republic and Vienna, Austria. Two forms of residential urban structures in the City of Brno in the Czech Republic were selected for the analysis: the closed courtyards in the urban block from the 19th century and the open spaces in the housing estates constructed under socialism in the 20th century. The question is, if the different forms of spaces between residential buildings influence the sustainability of urban area and satisfaction of inhabitants in different ways. A complementary case study in Vienna indicates that inhabitants of a housing estate in Vienna, as well as inhabitants of housing estates in Brno, highly appreciate the

  20. Shaped by the environment--adaptation in plants: meeting report based on the presentations at the FEBS Workshop 'Adaptation Potential in Plants' 2009 (Vienna, Austria).

    Science.gov (United States)

    Siomos, Maria F

    2009-09-01

    As sessile organisms that are unable to escape from inhospitable environments, plants are at the mercy of the elements. Nonetheless, plants have managed to adapt, evolve and survive in some of the harshest conditions on earth. The FEBS Workshop 'Adaptation Potential in Plants', held at the Gregor Mendel Institute of Molecular Plant Biology, Vienna, Austria from 19 to 21 March 2009, provided a forum (including 18 invited talks, 8 selected short talks and 69 posters) for about 100 plant biologists from 32 countries, working in the diverse fields of genetics, epigenetics, stress signalling, and growth and development, to come together and discuss adaptation potential in plants at all its levels.

  1. INTERNATIONAL V. UNITED STATES COURTS: IN SEARCH OF A RIGHT AND A REMEDY IN ARTICLE 36 OF THE VIENNA CONVENTION ON CONSULAR RELATIONS

    OpenAIRE

    Rincón Eizaga, Lorena; Ministerio de Ciencia y tecnología de Venezuela

    2006-01-01

    This paper seeks to analyze whether Article 36 (1) (b) of the Vienna Convention on Consular Relations (1963) confers an individual right to consular notification upon detained foreign nationals under international and U.S. courts decisions, and if such right is to be considered a human right in the current state of international law. This paper will further analyze whether  characterizing consular notification as a fundamental human right would make a difference regarding the remedies that sh...

  2. Survey on the Listeria contamination of ready-to-eat food products and household environments in Vienna, Austria.

    Science.gov (United States)

    Wagner, M; Auer, B; Trittremmel, C; Hein, I; Schoder, D

    2007-01-01

    Qualitative and quantitative contamination of ready-to-eat food-stuffs with the pathogen Listeria monocytogenes was studied in 1586 samples collected from 103 supermarkets (n = 946) and 61 households (n = 640) in Vienna, Austria. Seventeen groups of ready-to-eat foods were classified into three risk categories for contamination (CP1-CP3). Three to four samples were randomly collected at the retail level from each CP. Regarding the households, the sampling procedure was started with food items of CP1, and if not available, was continued with sampling of food items of CP2 and finally of CP3. Additionally, 184 environmental samples (swabs from the kitchen area, dust samples from the vacuum cleaner) and faecal samples (household members and pet animals) were included. One-hundred and twenty-four (13.1%) and 45 (4.8%) samples out of 946 food samples collected from food retailers tested positive for Listeria spp. and L. monocytogenes, respectively, with five smoked fish samples exceeding the tolerated limit of 100 CFU/g food. Food-stuffs associated with the highest risk of contamination were twice as frequently contaminated with L. monocytogenes as food-stuffs associated with a medium risk of contamination. Products showing the highest contamination rate were fish and seafood (19.4%), followed by raw meat sausages (6.3%), soft cheese (5.5%) and cooked meat products/patés (4.5%). The overall contamination rate of foods collected at the household level was more than two times lower. Only 5.6% and 1.7% of 640 food-stuffs analysed tested positive for Listeria spp. and L. monocytogenes, respectively. However, CP1 foods were rarely collected. Pulsed-field gel electrophoresis (PFGE) typing of the collected L. monocytogenes isolates revealed a high degree of diversity between the isolates, with some exceptions. PFGE typing of isolates harvested from green-veined cheese revealed a match among strains, although the manufacturer seemed to be distinguishable. Typing of household

  3. The astronomer Friedrich Viktor Schembor and the Vienna Urania Observatory (The history of the Vienna Urania Observatory from its foundation to its re-opening (1897-1957) / Friedrich Viktor Schembor - a life for astronomy). (German Title: Der Astronom Friedrich Viktor Schembor und die Wiener Urania-Sternwarte (Die Geschichte der Wiener Urania-Sternwarte von ihrer Gründung bis zu ihrer Wiedereröffnung (1897-1957) / Friedrich Viktor Schembor - ein Leben für die Astronomie))

    Science.gov (United States)

    Schembor, Friedrich Wilhelm

    The Urania Observatory in Vienna and the life and workings of the Viennese astronomer Friedrich Viktor Schembor are the topics of this volume. The first part deals with the history of the Urania Observatory and its significance as the oldest popular observatory in Vienna for the education of adults. After a short digression on the development of popular educational activities in the 19th century, the efforts are traced that led to the establishment of the Urania Observatory. The second part deals with the biography of the astronomer Friedrich Viktor Schembor (1898-1942). Already at an early age he committed himself as a volunteer for popular education in astronomy. In his time as director of the Urania Observatory, he was able to guide the “Astronomische Gemeinde” (Astronomical Congregation) to scientifically useful results. Because of a vicious disease, he was given only a short time of scientific work at the Vienna University Observatory.

  4. To Pee, or Not to Pee: A Review on Envenomation and Treatment in European Jellyfish Species

    Directory of Open Access Journals (Sweden)

    Louise Montgomery

    2016-07-01

    Full Text Available There is a growing cause for concern on envenoming European species because of jellyfish blooms, climate change and globalization displacing species. Treatment of envenomation involves the prevention of further nematocyst release and relieving local and systemic symptoms. Many anecdotal treatments are available but species-specific first aid response is essential for effective treatment. However, species identification is difficult in most cases. There is evidence that oral analgesics, seawater, baking soda slurry and 42–45 °C hot water are effective against nematocyst inhibition and giving pain relief. The application of topical vinegar for 30 s is effective on stings of specific species. Treatments, which produce osmotic or pressure changes can exacerbate the initial sting and aggravate symptoms, common among many anecdotal treatments. Most available therapies are based on weak evidence and thus it is strongly recommended that randomized clinical trials are undertaken. We recommend a vital increase in directed research on the effect of environmental factors on envenoming mechanisms and to establish a species-specific treatment. Adequate signage on jellyfish stings and standardized first aid protocols with emphasis on protective equipment and avoidance of jellyfish to minimize cases should be implemented in areas at risk.

  5. The Restroom and Locker Room Wars: Where to Pee or Not to Pee

    Science.gov (United States)

    Eckes, Suzanne E.

    2017-01-01

    As society's views of sexual orientation and gender identity have significantly evolved in recent years, school districts across the country are addressing how to create policies that align with the law in this area. One recent issue involves laws and policies focused on transgender students and their right to access restrooms that align with…

  6. To Pee, or Not to Pee: A Review on Envenomation and Treatment in European Jellyfish Species.

    Science.gov (United States)

    Montgomery, Louise; Seys, Jan; Mees, Jan

    2016-07-08

    There is a growing cause for concern on envenoming European species because of jellyfish blooms, climate change and globalization displacing species. Treatment of envenomation involves the prevention of further nematocyst release and relieving local and systemic symptoms. Many anecdotal treatments are available but species-specific first aid response is essential for effective treatment. However, species identification is difficult in most cases. There is evidence that oral analgesics, seawater, baking soda slurry and 42-45 °C hot water are effective against nematocyst inhibition and giving pain relief. The application of topical vinegar for 30 s is effective on stings of specific species. Treatments, which produce osmotic or pressure changes can exacerbate the initial sting and aggravate symptoms, common among many anecdotal treatments. Most available therapies are based on weak evidence and thus it is strongly recommended that randomized clinical trials are undertaken. We recommend a vital increase in directed research on the effect of environmental factors on envenoming mechanisms and to establish a species-specific treatment. Adequate signage on jellyfish stings and standardized first aid protocols with emphasis on protective equipment and avoidance of jellyfish to minimize cases should be implemented in areas at risk.

  7. To Pee, or Not to Pee: A Review on Envenomation and Treatment in European Jellyfish Species

    OpenAIRE

    Montgomery, Louise; Seys, Jan; Mees, Jan

    2016-01-01

    There is a growing cause for concern on envenoming European species because of jellyfish blooms, climate change and globalization displacing species. Treatment of envenomation involves the prevention of further nematocyst release and relieving local and systemic symptoms. Many anecdotal treatments are available but species-specific first aid response is essential for effective treatment. However, species identification is difficult in most cases. There is evidence that oral analgesics, seawat...

  8. Nitrogen-isotopes and multi-parameter sewage water test for identification of nitrate sources: Groundwater body Marchfeld East of Vienna

    Science.gov (United States)

    Kralik, Martin

    2017-04-01

    The application of nitrogen and oxygen isotopes in nitrate allows, under favourable circumstances, to identify potential sources such as precipitation, chemical fertilisers and manure or sewage water. Without any additional tracer, the source distinction of nitrate from manure or sewage water is still difficult. Even the application of boron isotopes can in some cases not avoid ambiguous interpretation. Therefore, the Environment Agency Austria developed a new multi parametrical indicator test to allow the identification and quantification of pollution by domestic sewage water. The test analyses 8 substances well known to occur in sewage water: Acesulfame and sucralose (two artificial, calorie-free sweeteners), benzotriazole and tolyltriazole (two industrial chemicals/corrosion inhibitors), metoprolol, sotalol, carbamazepine and the metabolite 10,11-Dihydro-10,11-dihydroxycarbamazepine (pharmaceuticals) [1]. These substances are polar and degradation in the aquatic system by microbiological processes is not documented. These 8 Substances do not occur naturally which make them ideal tracers. The test can detect wastewater in the analysed water sample down to 0.1 %. This ideal coupling of these analytic tests helps to identify the nitrogen sources in the groundwater body Marchfeld East of Vienna to a high confidence level. In addition, the results allow a reasonable quantification of nitrogen sources from different types of fertilizers as well as sewage water contributions close to villages and in wells recharged by bank filtration. Recent investigations of groundwater in selected wells in Marchfeld [2] indicated a clear nitrogen contribution by wastewater leakages (sewers or septic tanks) to the total nitrogen budget. However, this contribution is shrinking and the main source comes still from agricultural activities. [1] Humer, F.; Weiss, S.; Reinnicke, S.; Clara, M.; Grath, J.; Windhofer, G. (2013): Multi parametrical indicator test for urban wastewater influence

  9. Search efforts for ivory-billed woodpecker in South Carolina

    Science.gov (United States)

    Matthew Moskwik; Theresa Thom; Laurel M. Barnhill; Craig Watson; Jennifer Koches; John Kilgo; Bill Hulslander; Colette Degarady; Gary. Peters

    2013-01-01

    Following the reported rediscovery of Campephilus principalis (Ivory-billed Woodpecker) in Arkansas, we initiated searches in South Carolina in February 2006, with additional searches in the winter and spring of 2006–2007 and 2007–2008, concentrating in the Congaree, Santee, and Pee Dee river basins. We accrued a cumulative total of 8893 survey hours...

  10. The effects of bilastine compared with cetirizine, fexofenadine, and placebo on allergen-induced nasal and ocular symptoms in patients exposed to aeroallergen in the Vienna Challenge Chamber.

    Science.gov (United States)

    Horak, Friedrich; Zieglmayer, Petra; Zieglmayer, René; Lemell, Patrick

    2010-05-01

    This double-blind cross-over study compared the potential of bilastine, cetirizine, and fexofenadine to relieve the symptoms of allergic rhinitis. Seventy-five allergic volunteers were challenged with grass pollen in the Vienna Challenge Chamber (VCC) on two consecutive days of allergen provocation; 6 h on day 1 and 4 h day 2. Bilastine 20 mg, cetirizine 10 mg, fexofenadine 120 mg, or placebo were taken orally 2 h after the start of provocation on day 1 only. Total nasal symptom scores, the global symptom scores, nasal secretions, and eye symptoms were assessed on both day 1 and day 2. Bilastine had a rapid onset of action, within 1 h, and a long duration of action, greater than 26 h. Cetirizine was similar. Fexofenadine was similar on day 1 but less effective on day 2, indicating a shorter duration of action. Bilastine, like cetirizine and fexofenadine, was safe and well tolerated in this study.

  11. [Examinandi, doctors and medical councils. Reform proposals concerning surgico-medical education and examinations at the University of Vienna around 1800].

    Science.gov (United States)

    Oppenauer, Markus

    2013-01-01

    This essay examines the workings of the so called Court Committee for the Revision of University Studies. The main duty of this institution was to evaluate the structure of the whole educational system of the Habsburg Empire. These records have not received much notice hitherto from historians of medicine. Nevertheless, they deserve attention, as they are quite full of information regarding the "how" of medical education and health care management around 1800. Johann Peter Frank, at that time professor at the Medical Faculty of Vienna was responsible for reform proposals. His deliberations shed fresh light not only on the structures of Viennese Medical Faculty itself but also on different educational policies in the medical sciences in Central Europe around 1800.

  12. The function of thermal treatment of waste in the Vienna waste management concept; Die Funktion der thermischen Abfallbehandlung im Abfallwirtschaftskonzept von Wien

    Energy Technology Data Exchange (ETDEWEB)

    Loeschau, M. [Technische Univ. Berlin (Germany). Fachgebiet Abfallwirtschaft

    2004-07-01

    Thermal waste treatment has a key role in the waste management system of Vienna. As landfills will be prohibited and waste volumes will increase, further capacities will have to be provided. Another incinerator will be constructed in order to reduce the waste volume, to relieve landfills, to reduce the cost of land regeneration after pollution, and to provide additional energy for district heating. (orig.) [German] Die thermischen Abfallbehandlungsanlagen nehmen im Wiener Abfallwirtschaftssystem eine Schluesselrolle ein. Sie sind nach derzeitigem Stand der Technik das nachhaltigste Entsorgungsverfahren fuer nicht schadlos verwertbare Abfaelle. Aufgrund des Deponierungsverbots der Deponieverordnung fuer unzureichend behandelte Abfaelle sowie der prognostizierten Zunahme von Restmuellaufkommens muessen in Wien kuenftig weitere Behandlungskapazitaeten geschaffen werden. Mit dem Bau einer weiteren Muellverbrennungsanlage werden die abzulagernden Abfallmengen und die entstehenden Umweltbelastungen durch ihre Deponierung reduziert, Altlastenbeitraege gespart sowie zusaetzliche Energie fuer die Fernwaermeversorgung bereitgestellt. (orig.)

  13. [The day-to-day routine in hospitals--standards and conflicts, based on the example of the Rothschild spital in Vienna around the year 1900].

    Science.gov (United States)

    Malleier, Elisabeth

    2014-01-01

    The juxtaposition of official regulations and letters of complaint from Vienna's Rothschild Hospital shows, beyond the rhetoric and euphemisms of hospital reports, how lively and diverse day-to-day life was in a Jewish hospital around the year 1900. The letters of complaint query the official hospital rules and show that ideal and reality did not always coincide. Often, religious questions were at the root of the critique--such as doubts as to whether kosher dietary laws were adhered to--or conflicts between the agents involved, be they individuals or groups, patients, nurses, physicians or administrative staff. As part of this process, power structures, social hierarchies, patient rights and gender issues were called into question and renegotiated.

  14. “Learning from Vienna Means Learning to Win”: the Cracovian Christian Socials and the ‘Antisemitic Turn’ of 1896

    Directory of Open Access Journals (Sweden)

    Tim Buchen

    2012-07-01

    Full Text Available This article describes how it came to pass that the clerical milieu in Cracow deployed the concepts “antisemitism” and “Aryan people”, why Karl Lueger, accused of German nationalism, served as a bearer of hope, and how all of this came to a head in the call for an antisemitic movement in 1897. The reference to Vienna was not a mere copy of Viennese antisemitic ideas. Rather it made up one element in a larger strategy of the Cracovian Clericals to gain votes in the ballot box. Analyzing these strategies and rhetorics allows a better understanding of antisemitism in the Catholic milieu in particular and in antisemitic agitation in Galicia in general.

  15. Home-based Functional Electrical Stimulation for long-term denervated human muscle: History, basics, results and perspectives of the Vienna Rehabilitation Strategy

    Directory of Open Access Journals (Sweden)

    Helmut Kern

    2014-03-01

    Full Text Available We will here discuss the following points related to Home-based Functional Electrical Stimulation (h-b FES as treatment for patients with permanently denervated muscles in their legs: 1. Upper (UMN and lower motor neuron (LMN damage to the lower spinal cord; 2. Muscle atrophy/hypertrophy versus processes of degeneration, regeneration, and recovery; 3. Recovery of twitch- and tetanic-contractility by h-b FES; 4. Clinical effects of h-b FES using the protocol of the “Vienna School”; 5. Limitations and perspectives. Arguments in favor of using the Vienna protocol include: 1. Increased muscle size in both legs; 2. Improved tetanic force production after 3-5 months of percutaneous stimulation using long stimulus pulses (> 100 msec of high amplitude (> 80 mAmp, tolerated only in patients with no pain sensibility; 3. Histological and electron microscopic evidence that two years of h-b FES return muscle fibers to a state typical of two weeks denervated muscles with respect to atrophy, disrupted myofibrillar structure, and disorganized Excitation-Contraction Coupling (E-CC structures; 4. The excitability never recovers to that typical of normal or reinnervated muscles where pulses less than 1 msec in duration and 25 mAmp in intensity excite axons and thereby muscle fibres. It is important to motivate these patients for chronic stimulation throughout life, preferably standing up against the load of the body weight rather than sitting. Only younger and low weight patients can expect to be able to stand-up and do some steps more or less independently. Some patients like to maintain the h-b FES training for decades. Limitations of the procedure are obvious, in part related to the use of multiple, large surface electrodes and the amount of time patients are willing to use for such muscle training.

  16. A multi-proxy record from the Quaternary Vienna Basin: Chronology, climate and environmental change at the Alpine-Carpathian transition during the last 250,000 years

    Science.gov (United States)

    Salcher, Bernhard; Lomax, Johanna; Frank, Christa; Preusser, Frank; Scholger, Robert; Ottner, Franz; Wagreich, Michael

    2016-04-01

    Dated multi-proxy records of terrestrial sequences in the Quaternary of the circum-Alpine realm are sparse. This is especially true for those exceeding the time span of the last glacial maximum as extensive glaciers eroded substantial parts of potential records. Outside formerly glaciated regions, preservation space is low in the absence of tectonic subsidence. Foreland terraces forming as a consequence of mountain range uplift may partly account for this gap but are typically dominated by coarse-grained fluvial sediments commonly reflecting only short pulses during cold stage periods. Here we analyze a terrestrial record in the Vienna Basin in order to derive regional climatic and environmental changes of the last c. 250 ka. The Vienna Basin forms as a classical pull-apart feature showing a length of almost 200 km and a width of c. 55 km. Quaternary subsidence is focused along the active Vienna Basin Transfer Fault leading to the formation of a series of narrow strike-slip (sub-) basins and grabens with the Mitterndorf sub-basin being the largest (c. 270 km²) and deepest (c.175 m). The southern part of the basin is confined by the alpine mountain front and fed by two alluvial fans highlighting up to several tens of meters thick coarse grained, massive sediments intercalated by up to few meters thick fine clastic sediments. We investigated the fan's sequence development through core and outcrop sampling applying luminescence dating, magnetostratigraphy, soil and lithofacies classification as well as malacological analysis. The latter comprise the determination and distribution of species and individuals as well as coenological analysis. Data suggest a distinct sequence development with coarse-grained massive sediments abundantly deposited during cold periods (MIS 2 and 6) and fine, overbank sediments and soils, dominantly forming during warmer, Interstadial or Interglacial periods (MIS 5 and 7). Overbanks and soils are generally rich in terrestrial mollusk

  17. First characterization and comparison of TEB model simulations with in situ measurements regarding radiation balance in a single urban canyon at the BOKU site (Vienna)

    Science.gov (United States)

    Oswald, Sandro; Trimmel, Heidelinde; Revesz, Michael; Nadeem, Imran; Masson, Valéry; Weihs, Philipp

    2017-04-01

    According to the World Health Organization more than half of the world population lives in a city since 2010. Predictions foresee that by 2030 six out of ten people will live in an urban area. As a result, many cities are expanding in size. Almost 10% of all urban dwellers live in megacities (defined according to UN HABITAT as a city with a population of more than 10 million). There are several effects in cities which strongly influence human health. Visible influences like the severe emissions of air pollutants by industry and traffic (e.g. Mayer H., 1999, Grimmond et al., 2010) are obvious to people but thermal stress in urban areas is only recently recognized for its strong devastating effect on human health. As a consequence, the urban environment virtually influences all weather parameters that have an impact on human comfort and thermal stress. Within this study, we investigate effects of city growth and the development of outlying districts on the local climate of Vienna. We focus particularly on the influence of urban heat island and consequent the risk for heat related illnesses or thermal stress for people. To quantify radiation balance and other important meteorological factors, we performed an extensive field campaign with three types of net radiometer in three different heights at BOKU site in August 2016. The first results indicated a strong correlation (ρ=0.96) between the Town Energy Balance (TEB) model and the measurements of the top net radiometer regarding radiation balance at roof level, meanwhile the TEB results are slightly underestimated. Further check if the measurements are reasonable, a comparison of the input values (global and direct solar radiation) for the TEB simulation with Secondary Standard measurements of ARAD site Wien Hohe Warte shows a deviation under 2% concerning interquartile range on clear sky days. The next steps will enclose TEB simulations, coupled with the mesoscale Weather Research and Forecasting (WRF) model, for

  18. Analysing the importance of older people's resources for the use of home care in a cash-for-care scheme: evidence from Vienna.

    Science.gov (United States)

    Schmidt, Andrea E

    2017-03-01

    Older people of lower socioeconomic status (SES) are disproportionately affected by chronic conditions, yet less able to compensate health limitations through use of formal long-term care (LTC) at home, a preferred type of care for most. Some, like older women and single people, are particularly vulnerable. Under the Austrian public cash-for-care scheme, which aims to incentivise care at home and empowerment of LTC users, this study analyses: (i) interdependencies between SES, gender and 'informal' or family care, and (ii) how these factors associate with the use of old age formal home care in Vienna. An adaptation of Arber and Ginn's theory is used to identify material resources (income), health resources (care needs) and informal caring resources (co-residence and/or availability of family care). Gender aspects are also considered as a persistent source of inequalities. Administrative and survey data, collected by public authorities between 2010 and 2012 in Vienna, serve to compare home care use in old age (60+) to other support forms (residential and informal care) using logistic regression analysis. Results show a pro-rich bias in home care use among single-living people, with high-income single people being less likely to move to a care home, while there are no significant income differences present for non-singles. Second, traditional gender roles are salient: female care recipients co-residing with a partner are more likely to use formal care than men, reflecting that men's traditional gender roles involve less unpaid care work than women's. In conclusion, in an urban setting, the Austrian cash-for-care scheme is likely to reinforce stratifications along gender and class, thus implementing the general policy objective of care at home, but more likely for those with higher income. A support mechanism promoting empowerment among all older people might contribute to unequal degrees of choice, especially for those with fewer resources to manage their way through

  19. ‘Countering memory loss through misrepresentation: what does she think feminist art history is?’, Julie M. Johnson, The Memory Factory: The Forgotten Women Artists of Vienna 1900

    OpenAIRE

    Griselda Pollock

    2013-01-01

    Johnson offers a detailed study of women in the Viennese avant-garde art movements between 1880 and 1940, detailing both the careers and the critical/public reception of their contributions to various Vienna art groups. Johnson aims to counter the myth that women were confined to the private sphere, suffered institiutional discrimination and were hence unrecognized by their contemporaries, arguments Johnson attributes misleadingly to ‘feminist’ art history. Her book sets itself up in refutat...

  20. ‘We have to compliment the Aristocracy on the exhibition of their morals': the Ellenborough divorce case (1830) and the politics of scandal in pre-reform London and Vormärz Vienna

    OpenAIRE

    De Bock, Greet

    2016-01-01

    Using the 1830 divorce of Lord and Lady Ellenborough as a case study, this article sheds more light on the mechanisms of sexual scandal in early nineteenth-century Europe. It contrasts the publicity and political meaning given to the adultery of Lady Ellenborough and the Austrian envoy Felix zu Schwarzenberg in London and Vienna. Whereas radical and moderate reformers exploited the divorce to contest aristocratic leadership and to propagate a contrasting model of domesticity in the British pr...

  1. Brain Tumor Epidemiology - A Hub within Multidisciplinary Neuro-oncology. Report on the 15th Brain Tumor Epidemiology Consortium (BTEC) Annual Meeting, Vienna, 2014.

    Science.gov (United States)

    Woehrer, Adelheid; Lau, Ching C; Prayer, Daniela; Bauchet, Luc; Rosenfeld, Myrna; Capper, David; Fisher, Paul G; Kool, Marcel; Müller, Martin; Kros, Johan M; Kruchko, Carol; Wiemels, Joseph; Wrensch, Margaret; Danysh, Heather E; Zouaoui, Sonia; Heck, Julia E; Johnson, Kimberly J; Qi, Xiaoyang; O'Neill, Brian P; Afzal, Samina; Scheurer, Michael E; Bainbridge, Matthew N; Nousome, Darryl; Bahassi, El Mustapha; Hainfellner, Johannes A; Barnholtz-Sloan, Jill S

    2015-01-01

    The Brain Tumor Epidemiology Consortium (BTEC) is an open scientific forum, which fosters the development of multi-center, international and inter-disciplinary collaborations. BTEC aims to develop a better understanding of the etiology, outcomes, and prevention of brain tumors (http://epi.grants.cancer.gov/btec/). The 15th annual Brain Tumor Epidemiology Consortium Meeting, hosted by the Austrian Societies of Neuropathology and Neuro-oncology, was held on September 9 - 11, 2014 in Vienna, Austria. The meeting focused on the central role of brain tumor epidemiology within multidisciplinary neuro-oncology. Knowledge of disease incidence, outcomes, as well as risk factors is fundamental to all fields involved in research and treatment of patients with brain tumors; thus, epidemiology constitutes an important link between disciplines, indeed the very hub. This was reflected by the scientific program, which included various sessions linking brain tumor epidemiology with clinical neuro-oncology, tissue-based research, and cancer registration. Renowned experts from Europe and the United States contributed their personal perspectives stimulating further group discussions. Several concrete action plans evolved for the group to move forward until next year's meeting, which will be held at the Mayo Clinic at Rochester, MN, USA.

  2. Data preparation for digital modelling of the coal seams in the South Moravian Lignite Coalfield (Czech part of the Vienna Basin

    Directory of Open Access Journals (Sweden)

    Josef Honěk

    2008-12-01

    Full Text Available In the contribution data preparation for digital modelling and assessing the Kyjov Seam (Pannonian, zone B of the Vienna Basinstratigraphy and the Dubňany Seam (Pannonian, zone F is presented. The seams occur partly as unit seam and partly as seam splitin up to four benches. Almost 3000 holes were drilled in the area in the last 50 years. Data about lithological logs, laboratory resultsand other measurements were gathered, uniformed, and stored in digital database. Input data for modelling, which were the thicknessand average values of analytical parameters in set thickness in each data point (drill hole, were derived from the primary data storedin database by designed software. The thickness was defined in five ways in each drill hole. Firstly as the geological thickness to modelnatural geometry of the seam and secondly as deposit thickness to model only part of the seam with required quality. Deposit thicknesswas defined in four variants according to limit parameter of maximal average ash content value of 50, 40, 35, and 30 % in the seamin borehole.

  3. Strong ties inside and outside the neighbourhood. An exploratory analysis of the spatial dimension of ego/alter relations in three urban settings in Vienna

    Directory of Open Access Journals (Sweden)

    Josef Kohlbacher

    2013-12-01

    Full Text Available Regarding the spatial dimension of ego/alter relations, the fact whether egos and alters live within the same neighbourhood and the consequences thereof are heavily debated. Some authors argue that a network consisting mostly of people who live in the same urban area may result in lower socio-economic opportunities. Another strand of research emphasizes the importance of strong ties on the local level for neighbourhood embeddedness and social cohesion. In this article the role of the neighbourhood (a in the formation of strong ties, (b as the place where strong ties currently live and (c as a meeting place for people sharing strong ties is investigated for three neighbourhoods in Vienna. In line with previous research results, it turns out that in the socially marginalized remote setting, strong ties are more often neighbourhood-based and less often interethnic. In the more affluent neighbourhood, strong ties are not so strongly bound to the neighbourhood, but are more spatially dispersed.

  4. Perspectives on gender-specific medicine, course and learning style preferences in medical education: a study among students at the Medical University of Vienna.

    Science.gov (United States)

    Harreiter, Jürgen; Wiener, Hubert; Plass, Herbert; Kautzky-Willer, Alexandra

    2011-03-01

    In the study for the thesis Web Based Training with Moodle: Gender-differences in Action of Drugs, a survey among students of the Medical University of Vienna (MUV) concerning the implementation of gender-specific medicine in the curriculum and students' learning styles was performed. Data analysis (given as mean±sem) showed that students (n = 642) rated (Likert scale, 1-6) the importance of gender-specific medicine fairly high (4.02±0.06), and rated the importance of knowing about gender-specific medicine as a medical doctor even higher (4.49±0.05). Further implementation of gender-relevant topics into the curriculum appeared less important (3.64±0.06). Students rated their own knowledge on gender-specific medicine neutrally (3.40±0.05). For some items significant differences between males and females as well as the old and new curriculum were found. Students considered gender-specific medicine as important but sufficiently covered in their medical education at the MUV.

  5. OpenCL-library-based implementation of SCLSU algorithm for remotely sensed hyperspectral data exploitation: clMAGMA versus viennaCL

    Science.gov (United States)

    Bernabé, Sergio; Botella, Guillermo; Orueta, Carlos; Navarro, José M. R.; Prieto-Matías, Manuel; Plaza, Antonio

    2016-10-01

    In the last decade, hyperspectral spectral unmixing (HSU) analysis have been applied in many remote sensing applications. For this process, the linear mixture model (LMM) has been the most popular tool used to find pure spectral constituents or endmembers and their fractional abundance in each pixel of the data set. The unmixing process consists of three stages: (i) estimation of the number of pure spectral signatures or endmembers, (ii) automatic identification of the estimated endmembers, and (iii) estimation of the fractional abundance of each endmember in each pixel of the scene. However, unmixing algorithms can be very expensive computationally, a fact that compromises their use in applications under real-time constraints. This is, mainly, due to the last two stages in the unmixing process, which are the most consuming ones. In this work, we propose parallel opencl-library- based implementations of the sum-to-one constrained least squares unmixing (P-SCLSU) algorithm to estimate the per-pixel fractional abundances by using mathematical libraries such as clMAGMA or ViennaCL. To the best of our knowledge, this kind of analysis using OpenCL libraries have not been previously conducted in the hyperspectral imaging processing literature, and in our opinion it is very important in order to achieve efficient implementations using parallel routines. The efficacy of our proposed implementations is demonstrated through Monte Carlo simulations for real data experiments and using high performance computing (HPC) platforms such as commodity graphics processing units (GPUs).

  6. Middle to Late Pleistocene multi-proxy record of environmental response to climate change from the Vienna Basin, Central Europe (Austria)

    Science.gov (United States)

    Salcher, Bernhard C.; Frank-Fellner, Christa; Lomax, Johanna; Preusser, Frank; Ottner, Franz; Scholger, Robert; Wagreich, Michael

    2017-10-01

    Tectonic basins can represent valuable archives of the environmental history. Presented here are the stratigraphy and multi-proxy analyses of two adjacent alluvial fans in the Quaternary active parts of the Vienna Basin, situated at the interface of the Atlantic, European continental and Mediterranean climate. Deposits comprise a sequence of coarse-grained fluvial deposits intercalated by laterally extensive horizons of pedogenically altered fine sediments. To establish palaeoenvironmental reconstructions, fine-grained sequences from a drill core and outcrop data were analysed according to its malacofauna, palaeopedology, susceptibility and sedimentology. The chronological framework is provided by 38 luminescence ages and supported by geomagnetic polarity investigations. Distinct warm periods each associated with a geomagnetic excursion, are recorded in three pedocomplexes formed during the Last Interglacial and two earlier interglacial periods, indicted to correlate with Marine Isotope Stage (MIS) 9 and MIS 11, respectively. Environmental conditions during the early last glacial period (MIS 5, c. 100-70 ka) are reconstructed from mollusc-shell rich overbank fines deposited along a former channel belt, covered by massive sheetflood deposits during MIS 2. Analysed warm phases suggest strong variations in humidity, ranging from steppe to forest dominated environments. The study presents one of the few numerically dated Middle Pleistocene multi-proxy records and one of the most comprehensive malacological datasets covering the early phases of last glacial period of continental Europe.

  7. A report from the European Association for the Study of the Liver's 50th International Liver Congress (April 22-26 - Vienna, Austria).

    Science.gov (United States)

    Rabasseda, X

    2015-04-01

    While Vienna's Prater park offers a varied selection of options, from theme parks to lush gardens and prairies to enjoy the sun, the nearby Messe Wien convention center was the focus of attention in April 2015 for all the scientists, researchers and clinicians interested in viral hepatitis, nonalcoholic steatohepatitis, hepatocellular carcinoma and a variety of other liver diseases. Treatments and potential new therapeutic strategies for these hepatopathies were discussed during the 50th International Liver Congress organized by the European Association for the Study of the Liver. Echoing epidemiological facts and a high social interest for hepatitis C virus infection, new findings with investigational and potential new therapies for the disease centered much of the attention at the conference. Nevertheless, new research was also reported related to potential improvements in how other liver diseases, particularly hepatitis B virus infection, hepatocellular carcinoma and a range of inflammatory and immune-mediated liver diseases, including rare hereditary diseases that should never be forgotten. Copyright 2015 Prous Science, S.A.U. or its licensors. All rights reserved.

  8. Implications of the Vienna Integrated Model of Art Perception for art-based interventions in clinical populations: Comment on "Move me, astonish me... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Taruffi, Liila; Koelsch, Stefan

    2017-07-01

    Pelowski et al. present a holistic framework within which the multiple processes underlying art viewing can be systematically organized [1]. The proposed model integrates a broad range of dynamic mechanisms, which can effectively account for empirical as well as humanistic perspectives on art perception. Particularly challenging is the final section of the article, where the authors draw a correspondence between behavioral and cognitive components and brain structures (as well as networks). Here, we comment on the implications of the Vienna Integrated Model of Art Perception for art therapy in clinical populations, particularly focusing on (1) expanding Pelowski et al.'s considerations of the Default Mode Network (DMN) into discussion of its relevance to mental diseases, and (2) elaborating on empathic resonance in aesthetic contexts and the capacity of art to build up empathic skills.

  9. Il mito di Elisabetta d'Austria (Sissi come fenomeno cine-turistico e fonte di itinerari culturali nella città di Vienna / The myth of Elisabeth of Austria (Sissi as a cine-touristic phenomenon and asset for cultural itineraries in Vienna

    Directory of Open Access Journals (Sweden)

    Alessandro Vitale

    2016-05-01

    Full Text Available Lo scopo di questo studio è quello di mettere in luce il potenziale del cinema quale strumento di sviluppo e di orientamento del turismo in un periodo altamente concorrenziale. Il caso-studio dell’utilizzo dilla figura mitica e cine-costruita e della relativa narrativa di Elisabetta d’Austria (1837-1898 divenuta “Sissi” dopo la Trilogia di Ernst Marischka, girata fra il 1955-1958, molto lontana dalla realtà storica, è significativo e rappresentativo. Il successo dei film dedicati a Sissi, seguiti da numerose altre opere teatrali, da musical, operette, cartoni animati, ha segnato l’ingresso della figura di Elisabetta nella cultura popolare che ha reso la figura storica ancor più leggendaria. Il ruolo dei film nell’attrarre visitatori a Vienna (la città è servita come set principale di questi è evidente. La popolarità dei film è stata usata per anni dagli operatori turistici e dal tourism board di Vienna per stimolare l’interesse dei turisti per la visita dei luoghi legati alla storia e alla cultura della capitale austriaca. Ma questo non ha impedito al tempo stesso di offrire la possibilità di offrire strumenti per comprendere la figura storica di Sisi. In ogni caso, l’evidenza supporta l’importanza del turismo indotto dal cinema. Partendo da una rivisitazione della letteratura focalizzata sul tema l’articolo, rivelando le strategie e i ruoli giocati dai manager del turismo indotto dal cinema, fornisce qualche utile intuizione per le organizzazioni interessate nello sviluppo turistico. The purpose of this study is to highlight the potential of movies as a tool for development and orientation of tourism in highly competitive years. The case-study of the use of the cinema’s constructed mythical figure and narrative of  Elisabeth von Wittelsbach, Empress of Austria (1837-1898, nicknamed “Sissi” after the Trilogy of Ernst Marischka of 1955-1958, very far from the historical reality, is quite significant and

  10. Declining atmospheric deposition of heavy metals over the last three decades is reflected in soil and foliage of 97 beech (Fagus sylvatica) stands in the Vienna Woods.

    Science.gov (United States)

    Türtscher, Selina; Berger, Pétra; Lindebner, Leopold; Berger, Torsten W

    2017-11-01

    Rigorous studies on long-term changes of heavy metal distribution in forest soils since the implementation of emission controls are rare. Hence, we resampled 97 old-growth beech stands in the Vienna Woods. This study exploits an extensive data set of soil (infiltration zone of stemflow and between trees area) and foliar chemistry from three decades ago. It was hypothesized that declining deposition of heavy metals is reflected in soil and foliar total contents of Pb, Cu, Zn, Ni, Mn and Fe. Mean soil contents of Pb in the stemflow area declined at the highest rate from 223 to 50 mg kg-1 within the last three decades. Soil contents of Pb and Ni decreased significantly both in the stemflow area and the between trees area down to 80-90 cm soil depth from 1984 to 2012. Top soil (0-5 cm) accumulation and simultaneous loss in the lower soil over time for the plant micro nutrients Cu and Zn are suggested to be caused by plant uptake from deep horizons. Reduced soil leaching, due to a mean soil pH (H2O) increase from 4.3 to 4.9, and increased plant cycling are put forward to explain the significant increase of total Mn contents in the infiltration zone of beech stemflow. Top soil Pb contents in the stemflow area presently exceed the critical value at which toxicity symptoms may occur at numerous sites. Mean foliar contents of all six studied heavy metals decreased within the last three decades, but plant supply with the micro nutrients Cu, Zn, Mn and Fe is still in the optimum range for beech trees. It is concluded that heavy metal pollution is not critical for the studied beech stands any longer. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  11. Use of gamma radiation to sterilize Ceratitis capitata (Wied., 1824), tsl VIENNA 8 strain, for application of sterile insect technique in Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Mastrangelo, Thiago de A.; Costa, Maria de L.Z.; Paesman, Leandro; Walder, Julio M.M. [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)]. E-mails: piaui@cena.usp.br; jmwalder@cena.usp.br; Mascarin, Gabriel M. [Universidade de Sao Paulo (USP), Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz (ESALQ)]. E-mail: gmmascar@esalq.usp.br

    2007-07-01

    The Sterile insect technique is a method of pest control allowed in integrated pest management programs in fruit growing, where sterile insects released compete in mate process against fertile wild ones, generating a gradual population reduction. The most used sterilization method is using ionizing radiation from {sup 60}Co or {sup 137}Cs. For efficient application of SIT, an important item is the sterilizing dose. This must be as lower as possible in order to preserve insect behavior. In this work, it was studied the reproductive potential of fruit fly Ceratitis capitata, tsl VIENNA 8 strain, irradiated with different doses of gamma radiation. This strain shall be used in population suppression programs at fruit-growing areas from Northeast of Brazil, through a partnership between CENA and Biofactory MOSCAMED Brazil, intending only sterile male releases. Radiation source used was a {sup 60}Co irradiator, with 17.2 .1012 Bq. Individualized couples were distributed in a randomized delineament with 10 replicates for each treatment and eggs were collected for fifteen days. With 9 and 10 days old, pupae were irradiated with doses ranging from 30 to 120 Gy. All means of emerged adult's percentages were higher than 90%. In regards to fecundity, different doses didn't affect the number of eggs laid, being the overall mean around 30 eggs/couple/day. Fertility data showed that as radiation dose increases, sterility increases. It was concluded that the dose of 90 Gy could be used in Brazil, since to SIT programs a dose is chosen witch prevents an egg hatch higher than 1%. (author)

  12. Land use and urban morphology parameters for Vienna required for initialisation of the urban canopy model TEB derived via the concept of "local climate zones"

    Science.gov (United States)

    Trimmel, Heidelinde; Weihs, Philipp; Oswald, Sandro M.; Masson, Valéry; Schoetter, Robert

    2017-04-01

    Urban settlements are generally known for their high fractions of impermeable surfaces, large heat capacity and low humidity compared to rural areas which results in the well known phenomena of urban heat islands. The urbanized areas are growing which can amplify the intensity and frequency of situations with heat stress. The distribution of the urban heat island is not uniform though, because the urban environment is highly diverse regarding its morphology as building heights, building contiguity and configuration of open spaces and trees vary, which cause changes in the aerodynamic resistance for heat transfers and drag coefficients for momentum. Furthermore cities are characterized by highly variable physical surface properties as albedo, emissivity, heat capacity and thermal conductivity. The distribution of the urban heat island is influenced by these morphological and physical parameters as well as the distribution of unsealed soil and vegetation. These aspects influence the urban climate on micro- and mesoscale. For larger Vienna high resolution vector and raster geodatasets were processed to derive land use surface fractions and building morphology parameters on block scale following the methodology of Cordeau (2016). A dataset of building age and typology was cross checked and extended using satellite visual and thermal bands and linked to a database joining building age and typology with typical physical building parameters obtained from different studies (Berger et al. 2012 and Amtmann M and Altmann-Mavaddat N (2014)) and the OIB (Österreichisches Institut für Bautechnik). Using dominant parameters obtained using this high resolution mainly ground based data sets (building height, built area fraction, unsealed fraction, sky view factor) a local climate zone classification was produced using an algorithm. The threshold values were chosen according to Stewart and Oke (2012). This approach is compared to results obtained with the methodology of Bechtel et

  13. Determination of the dose of gamma radiation sterilization for assessment of biological parameters of male Ceratitis capitada (Diptera: Tephritidae), tsl - Vienna 8 strain; Determinacao da dose de radiacao gama esterilizante pela avaliacao dos parametros biologicos de machos de Ceratitis capitata (Diptera: Tephritidae), linhagem tsl - Vienna 8

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Aline Cristina Pereira da

    2011-07-01

    The Vienna-8, tsl (temperature sensitive lethal) strain of Ceratitis capitata, by presenting mutations that facilitate the mass rearing and release only of sterile males in the field, has been used in (Sterile Insect Technique) programmes. The objective of this study was to determine the radiation dose that provides the highest level of sterility for Vienna-8, tsl males assessing their biological parameters that indicate the quality of sterile males to be released. Brown pupae (males) of the tsl strain were obtained from the mass rearing of the Food Irradiation and Radio entomology laboratory of CENA/USP, and they were irradiated (with gamma radiation - {sup 60}Co) 24 hours before the emergence at rates of 0, 30, 60, 90 and 120 Gy. The determination of the sterilizing dose was based on fertility of sexually mature females of the bisexual strain and not irradiated, mated with males of different treatments. Eggs were collected daily during 6 days, were counted and it was possible to estimate fecundity, and assess the hatching rate. The emergence and flight ability were determined by following the protocol of quality control manual for FAO/IAEA/USDA (2003). To assess the longevity under nutritional stress, the insects were kept a period of 48 h after emergence in the absence of water and food, and after this period, mortality was recorded. The size of the testes (left and right) was obtained by dissecting irradiated and non-irradiated males at the eighth day of life, and measure the testes in an ocular micrometer, considering the maximum length and width of each sample. To determine the sperm number was necessary to dissect the males and break their testicles. No difference was observed in emergence rate, flight ability and longevity of irradiated and non-irradiated males, nor in the fecundity of females mated with males of different treatments. The sterilizing dose that resulted in lower fertility of females was 120 Gy, with 1.5% hatching. Considering the parameters

  14. Josephinische Bibliothek und medizinhistorische Bestände der Universitätsbibliothek der Medizinischen Universität Wien [The Josephinian Library and the medical-historic stock of the University Library of the Medical University of Vienna

    Directory of Open Access Journals (Sweden)

    Albrecht, Harald

    2012-09-01

    Full Text Available [english] The University Library of the Medical University of Vienna, founded in 2004, is the most extensive medical library in Austria. It possesses an outstanding medical-historic stock which is basically stored in its Branch Library of Medical History. This unique stock also is a historical source itself because it represents the development of the supply of the Medical Faculty of Vienna, Viennese hospitals and medical societies with scientific literature and information during the last centuries. The brunch library contains several remarkable special-collections such as the Josephinian Library, the Library of Neurology (Obersteiner-Library, the Library of the Society of Physicians in Vienna or the Library of the Austrian Association of Oral and Maxillofacial Surgery.In order to deal with its own history the University Library runs a provenance-research project to identify expropriated goods transferred to its stock during the Nazi-regime and restores them to their rightful owners. It also runs a weblog-series “Displaced 1938”, which is about displaced members of the Medical Faculty of Vienna during World . Currently it establishes a bio-bibliographical online-portal about exponents of the so called “Vienna Medical School(s” between 1750 and 1950 as well as an online bookplate database.To improve the access to large parts of the stock the ancient card indexes got digitalized (including OCR-reading and have been online since 2010. Supplementary the University Library of the Medical University of Vienna engages in the European cooperation on E-books on Demand (EOD.[german] Die Universitätsbibliothek der 2004 errichteten Medizinischen Universität Wien ist die größte medizinische Fachbibliothek in Österreich. Sie verfügt auch über bedeutende medizinhistorische Bestände, die überwiegend in der Zweigbibliothek für Geschichte der Medizin untergebracht sind und auch eine Quelle für die Entwicklung der Literatur- und

  15. Urban prevalence of Listeria spp. and Listeria monocytogenes in public lavatories and on shoe soles of facility patrons in the European capital city Vienna.

    Science.gov (United States)

    Schoder, D; Schmalwieser, A; Szakmary-Brändle, K; Stessl, B; Wagner, M

    2015-05-01

    The aim of this study was to determine the prevalence of Listeria spp. and Listeria monocytogenes (L. monocytogenes) in urban public lavatories and on shoe soles of facility patrons in a European capital city. More than 91% of all municipal public lavatories in Vienna close to public hubs were included in this study. Overall, 373 swab samples of public lavatories and shoes of facility patrons were enriched, according to ISO 11290-1. Listeria monocytogenes isolates were subtyped using pulsed-field gel electrophoresis. A total of 24 samples were positive for Listeria spp., yielding an overall prevalence of 6.4% (24/373). Listeria monocytogenes was found in 2.1% (8/373) of all samples. Swabs from lavatories in parks, container lavatories and lavatories at markets had the highest prevalences of 20.7% (6/29), 20% (2/10) and 12.5% (1/8) Listeria spp., respectively. These detection rates were statistically significantly higher than those associated with lavatories in shopping centres (P = 0.003, P = 0.002, P = 0.02) and at public transport locations (P = 0.0004, P = 0.005, P = 0.02). Shoes sampled at Christmas markets showed the highest Listeria spp. and L. monocytogenes prevalences of 80% (4/5) and 40% (2/5), respectively. With regard to shoe type, Listeria spp. detection rates were 14.3% (3/21; winter boots), 13.3% (2/15; hiking boots), sport shoes (5.9%; 2/34) and brogues (5.1%; 4/79). No Listeria spp. were found on shoe soles that had smooth treads (0/76), while Listeria spp. were detected on 19.5% (8/41) of medium depth tread shoe types and on 9.4% (3/32) of deep tread shoes. These data suggest that soil environment is still one of the most important reservoirs for the foodborne pathogen L. monocytogenes. © 2014 Blackwell Verlag GmbH.

  16. Stream Bed Structure as a Determinat for Nutrient Dynamics: Evidence of recent Resoration Efforts in the urban Stream Wienfluss, Vienna (Austria)

    Science.gov (United States)

    Battin, T.; Glaser, S.; Görnet, B.; Hager, U.; Hein, T.; Weigelhofer, G.

    2003-04-01

    A large scale restoration program is being conducted at the urban stream Wienfluss (WF) in order to reconnect the main channel with the wetlands of the flood control reservoir (FCR) at the city limits of Vienna. The aim is to increase the WF´s ecological integrity and to establish an urban seminatural fluvial landscape element. The restoration measures at reach scale are expected to enhance transformation and degradation of material and energy within the stream ecosystem and to increase the ecosystem functionality by natural self purification processes. The phosphate retention capacity of the FCR is 3,90 ± 1,58 g m-2, approximately 13 % of the riverine input, as was shown by nutrient mass balance calculations. 75 % of of the WF phosphate pool are adsorbed to the sediment, primarily organic bound. An experimental approach using in vitro flow bioreactors demonstrated that the potential ammonia retention of the microbial community is 25 ± 6,5 (g N L-1 (90 ± 3,5%). Stream bed structure within the ecosystem ranges from high habitat heterogeneity in the FCR to monotonous habitat conditions at the concealed reach of the main channel. The degree of habitat heterogeneity is defined through sinuosity length and sediment composition governing vertical and lateral hydrological connectivity. We assume that at base flow stream bed structure acts as the controlling factor for nutrient retention and organic matter dynamics. Thus nutrient uptake length should increase with decreasing habitat heterogeneity. In the present experimental nutrient addition study we compare the nutrient retention efficiency of three reaches with different stream bed structures. Sediments range from natural sand to cobble in the FCR, over rip-rap to fine sediment aggregations at the seminatural restructurated section of the main channel, to the concealed reach of the WF. Ammonia and phosphate are added via constant and slug nutrient additions. Basic uptake parameters as uptake rate, uptake rate

  17. Tablet PCs in Elementary Education A Pilot Project at the Practice Primary School of the KPH at Campus Vienna/Krems

    Directory of Open Access Journals (Sweden)

    Anton Reiter

    2015-09-01

    Full Text Available Am Beginn des Schuljahrs 2011/2012 wurde eine Volksschulklasse der im 21. Wiener Gemeindebezirk gelegenen Praxisschule der katholischen Pädagogischen Hochschule Wien/Krems mit Tablet-PCs ausgestattet. Die Geräte wurden von der Institution und den Eltern finanziert und allen SchülerInnen einer dritten Klasse zur Verfügung gestellt. Evaluation und Dokumentation des Projekts wurde vom österreichische Ministerium für Unterricht und Frauen finanziert. Wie aktuelle internationale Studien zeigen, gewöhnen sich neunjährige SchülerInnen schnell an solche Geräte. Das war auch in der hier vorgelegten Studie zu beobachten. Die SchülerInnen waren sehr motiviert und haben verschiedene Anwendungen erprobt. Die Tablets wurden auch außerhalb des Klassenraums verwendet, was als wesentlicher Vorteil mobiler Computer gesehen werden kann. Tablet-PCs ermöglichen individuelles Lernen und können für kooperative, soziale und interaktive Lernformen während des Unterrichts und in der Freizeit verwendet werden. Als persönliche mobile Geräte katalysieren die Tablet-PCs selbstgesteuertes “just-in-time” Lernen. Alle SchülerInnen sollten daher im 21. Jahrhundert solche Geräte zur Verfügung haben. One class of the practice primary school at the church-affilated former pedagogical college (KPH at Campus Vienna/Krems located in the 21st district of the capital of Austria was equipped with Tablet PCs at the beginning of the school year 2011/2012. These devices for all students of a third class were financed by the institution and partly the parents. The Austrian Federal Ministry of Education and Women's Affairs funded the evaluation and documentation of this two-year project. As recent international studies on the use of tablets (mostly iPads in primary and secondary education confirm, also these nine years old kids quickly got familiar with the used Pearl Touchlet tablets. The pupils were highly motivated and tried out different applications. The tablets

  18. KERINDUAN PADA YANG REAL DALAM NOVEL AKAR KARYA DEE

    Directory of Open Access Journals (Sweden)

    Fina Hiasa

    2016-12-01

    Full Text Available This research was aimed to describe how the author’s desire manifested through Akar’s novel. There was a relationship between the story of Akar’s novel, which has a Buddhism background, with Dee’s interest as the author’s toward buddha’s teachings that became an indication about the relation between author’s desire and Akar’s novel. To answer this indication, the writer used Lacan’s Psychoanalysis method through the mechanism of metaphor and metonymy by analyzing a series of signifiers on Akar’s novel, so it will discover what exactly the desire of “being” and “having” of the author.

  19. ‘Countering memory loss through misrepresentation: what does she think feminist art history is?’, Julie M. Johnson, The Memory Factory: The Forgotten Women Artists of Vienna 1900

    Directory of Open Access Journals (Sweden)

    Griselda Pollock

    2013-06-01

    Full Text Available Johnson offers a detailed study of women in the Viennese avant-garde art movements between 1880 and 1940, detailing both the careers and the critical/public reception of their contributions to various Vienna art groups. Johnson aims to counter the myth that women were confined to the private sphere, suffered institiutional discrimination and were hence unrecognized by their contemporaries, arguments Johnson attributes misleadingly to ‘feminist’ art history. Her book sets itself up in refutation to feminist straw women, thereby distorting feminist analysis of women and modernist art movements. The effect of this false battle with straw feminists is to miss out on the analysis of the specific significance of the politics of memory in the twentieth century’s selective representation of the artworlds of Vienna that serve precisely to confirm feminist analysis of the modernist phenomenon of new gender politics being erased by the distinctly unmodernist forms of androcentric art historical and museal representations of modernist art movements and their significantly egalitarian art worlds.

  20. Prostitution, pee-Ing, percussion, and possibilities: Contemporary women documentary film-makers and the city in South Asia

    OpenAIRE

    Sen, Atreyee; Thakker, Neha Raheja

    2011-01-01

    This co-authored article offers an analytical overview of contemporary women documentary film-makers and the latter's engagement with 'the urban' in South Asia. It shows how a proliferating range of women directors represent the city through their political positions and dialogic sensibilities; often using the lens of feminism, sexuality, power relationships, and diasporic experiences to reflect the vibrancy and vitality (alongside the despair and destitution) embedded in urban existence in S...

  1. Expelled subsalt fluids form a pockmark field in the eastern Red Sea

    Science.gov (United States)

    Feldens, P.; Schmidt, M.; Mücke, I.; Augustin, N.; Al-Farawati, R.; Orif, M.; Faber, E.

    2016-10-01

    This study aimed to constrain the source area of fluids responsible for the formation of a pockmark field in the eastern Red Sea. The newly discovered field extends over an area of at least 1,000 km2 at a water depth of ~400 m. The pockmarks have modal diameters of 140-150 m and are either randomly distributed on the seafloor or aligned within valleys approximately 25 m deep and several kilometres in length. Seismic data show that chimneys and/or regions of acoustic turbidity prevail beneath the pockmark field down to the top of Miocene evaporites, which are widespread in the Red Sea. Four gravity cores were taken from the pockmark field. For most of the cores, geochemical analyses show that porewater has a higher Cl concentration than the local seawater and increased Cl/Br ratios, which indicate an origin from evaporites. The adsorbed hydrocarbons are of thermal origin, with C1/(C2+C3) ratios between 4 and 23 and stable carbon isotope data for methane varying from δ13C of -34 to -36.4‰ with respect to Vienna Pee Dee Belemnite. On the basis of the calculated maturity of the source rock of 1.2-1.4 Ro, local thermal gradients and sedimentation rates, its deeper depth boundary is approximated at 2,000 to 2,200 m. The results indicate that the adsorbed hydrocarbons sampled at the seafloor had to pass through an evaporite sequence of potentially several hundred metres to a few km in thickness. The most likely explanation for the increased permeability of the evaporite sequence is brittle deformation triggered by extensive local tectonic movements and supported by high fluid overpressure within the evaporite sequence.

  2. System for δ13C-CO2 and xCO2 analysis of discrete gas samples by cavity ring-down spectroscopy

    Science.gov (United States)

    Dickinson, Dane; Bodé, Samuel; Boeckx, Pascal

    2017-11-01

    A method was devised for analysing small discrete gas samples (50 mL syringe) by cavity ring-down spectroscopy (CRDS). Measurements were accomplished by inletting 50 mL syringed samples into an isotopic-CO2 CRDS analyser (Picarro G2131-i) between baseline readings of a reference air standard, which produced sharp peaks in the CRDS data feed. A custom software script was developed to manage the measurement process and aggregate sample data in real time. The method was successfully tested with CO2 mole fractions (xCO2) ranging from 20 000 ppm and δ13C-CO2 values from -100 up to +30 000 ‰ in comparison to VPDB (Vienna Pee Dee Belemnite). Throughput was typically 10 samples h-1, with 13 h-1 possible under ideal conditions. The measurement failure rate in routine use was ca. 1 %. Calibration to correct for memory effects was performed with gravimetric gas standards ranging from 0.05 to 2109 ppm xCO2 and δ13C-CO2 levels varying from -27.3 to +21 740 ‰. Repeatability tests demonstrated that method precision for 50 mL samples was ca. 0.05 % in xCO2 and 0.15 ‰ in δ13C-CO2 for CO2 compositions from 300 to 2000 ppm with natural abundance 13C. Long-term method consistency was tested over a 9-month period, with results showing no systematic measurement drift over time. Standardised analysis of discrete gas samples expands the scope of application for isotopic-CO2 CRDS and enhances its potential for replacing conventional isotope ratio measurement techniques. Our method involves minimal set-up costs and can be readily implemented in Picarro G2131-i and G2201-i analysers or tailored for use with other CRDS instruments and trace gases.

  3. Modelling riverine habitat for robust redhorse: assessment for reintroduction of an imperilled species

    Science.gov (United States)

    Fisk, J. M.; Kwak, Thomas J.; Heise, R. J.

    2014-01-01

    A critical component of a species reintroduction is assessment of contemporary habitat suitability. The robust redhorse, Moxostoma robustum (Cope), is an imperilled catostomid that occupies a restricted range in the south-eastern USA. A remnant population persists downstream of Blewett Falls Dam, the terminal dam in the Pee Dee River, North Carolina. Reintroduction upstream of Blewett Falls Dam may promote long-term survival of this population. Tillery Dam is the next hydroelectric facility upstream, which includes a 30 rkm lotic reach. Habitat suitability indices developed in the Pee Dee River were applied to model suitable habitat for proposed minimum flows downstream of Tillery Dam. Modelling results indicate that the Tillery reach provides suitable robust redhorse habitat, with spawning habitat more abundant than non-spawning habitat. Sensitivity analyses suggested that suitable water depth and substrate were limiting physical habitat variables. These results can inform decisions on flow regulation and guide planning for reintroduction of the robust redhorse and other species.

  4. Prevalence of Atrial Fibrillation and Antithrombotic Therapy in Hemodialysis Patients: Cross-Sectional Results of the Vienna InVestigation of AtriaL Fibrillation and Thromboembolism in Patients on HemoDIalysis (VIVALDI).

    Science.gov (United States)

    Königsbrügge, Oliver; Posch, Florian; Antlanger, Marlies; Kovarik, Josef; Klauser-Braun, Renate; Kletzmayr, Josef; Schmaldienst, Sabine; Auinger, Martin; Zuntner, Günther; Lorenz, Matthias; Grilz, Ella; Stampfel, Gerald; Steiner, Stefan; Pabinger, Ingrid; Säemann, Marcus; Ay, Cihan

    2017-01-01

    Atrial fibrillation (AF) adds significant risk of stroke and thromboembolism in patients on hemodialysis (HD). The aim of this study was to investigate the prevalence of AF in a population-based cohort of HD patients and practice patterns of antithrombotic therapy for stroke prevention in AF. The Vienna InVestigation of AtriaL fibrillation and thromboembolism in patients on hemodialysis (VIVALDI), an ongoing prospective observational cohort study, investigates the prevalence of AF and the risk of thromboembolic events in HD patients in Vienna, Austria. We analyzed cross-sectional data of 626 patients (63.4% men, median age 66 years, approx. 73% of HD patients in Vienna), who provided informed consent. A structured interview with each patient was performed, recent and archived ECGs were viewed and medical histories were verified with electronic records. The overall prevalence of AF was 26.5% (166 patients, 71.1% men, median age 72 years) of which 57.8% had paroxysmal AF, 3.0% persistent AF, 32.5% permanent AF, and 6.6% of patients had newly diagnosed AF. The median CHA2DS2-VASc Score was 4 [25th-75th percentile 3-5]. In multivariable analysis, AF was independently associated with age (odds ratio: 1.05 per year increase, 95% confidence interval: 1.03-1.07), male sex (1.7, 1.1-2.6), history of venous thromboembolism (2.0, 1.1-3.6), congestive heart failure (1.7, 1.1-2.5), history of or active cancer (1.5, 1.0-2.4) and time on HD (1.08 per year on HD, 1.03-1.13). Antithrombotic treatment was applied in 84.4% of AF patients (anticoagulant agents in 29.5%, antiplatelet agents in 33.7%, and both in 21.1%). In AF patients, vitamin-K-antagonists were used more often than low-molecular-weight heparins (30.1% and 19.9%). The prevalence of AF is high amongst HD patients and is associated with age, sex, and distinct comorbidities. Practice patterns of antithrombotic treatment indicate a lack of consensus for stroke prevention in HD patients with AF.

  5. Transmission and Survival of Ralstoniasolanacearum on Tobacco Machinery

    OpenAIRE

    Fortnum BA; Gooden D

    2014-01-01

    Bacterial wilt (Ralstoniasolanacearum) is an extremely damaging disease of flue-cured tobacco in the southeastern USA. It is generally believed that R. solanacearum infects field-grown tobacco through the roots. Epidemics of bacterial wilt are so common within South Carolina that the organism must be spread in a more rapid and efficient manner than the movement of soil on equipment. Field trials conducted at the Pee Dee Research and Education Center measured the spread of R. solancearum down ...

  6. A slight recovery of soils from Acid Rain over the last three decades is not reflected in the macro nutrition of beech (Fagus sylvatica) at 97 forest stands of the Vienna Woods.

    Science.gov (United States)

    Berger, Torsten W; Türtscher, Selina; Berger, Pétra; Lindebner, Leopold

    2016-09-01

    Rigorous studies of recovery from soil acidification are rare. Hence, we resampled 97 old-growth beech stands in the Vienna Woods. This study exploits an extensive data set of soil (infiltration zone of stemflow and between trees area at different soil depths) and foliar chemistry from three decades ago. It was hypothesized that declining acidic deposition is reflected in soil and foliar chemistry. Top soil pH within the stemflow area increased significantly by 0.6 units in both H2O and KCl extracts from 1984 to 2012. Exchangeable Ca and Mg increased markedly in the stemflow area and to a lower extent in the top soil of the between trees area. Trends of declining base cations in the lower top soil were probably caused by mobilization of organic S and associated leaching with high amounts of sulfate. Contents of C, N and S decreased markedly in the stemflow area from 1984 to 2012, suggesting that mineralization rates of organic matter increased due to more favorable soil conditions. It is concluded that the top soil will continue to recover from acidic deposition. However, in the between trees areas and especially in deeper soil horizons recovery may be highly delayed. The beech trees of the Vienna Woods showed no sign of recovery from acidification although S deposition levels decreased. Release of historic S even increased foliar S contents. Base cation levels in the foliage declined but are still adequate for beech trees. Increasing N/nutrient ratios over time were considered not the result of marginally higher N foliar contents in 2012 but of diminishing nutrient uptake due to the decrease in ion concentration in soil solution. The mean foliar N/P ratio already increased to the alarming value of 31. Further nutritional imbalances will predispose trees to vitality loss. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Disentangling dissolved oxygen sources in shallow riparian groundwater by stable isotope analysis

    Science.gov (United States)

    Mader, Michael; Porst, David; Schmidt, Christian; van Geldern, Robert; Barth, Johannes

    2017-04-01

    Dissolved oxygen (DO) is one of the strongest oxidation agents in aquatic environments. Besides gas-water-exchange, mixing and mineral oxidation, it is a key player in fundamental biogeochemical processes such as respiration and photosynthesis. These processes also systematically influence stable isotope ratios of DO and of dissolved inorganic carbon (DIC). Simultaneous measurements of DO and DIC concentrations in conjunction with their stable isotope ratios (δ18ODO and δ13CDIC) can thus provide useful tools to quantify oxygen and carbon sources and sinks in natural waters. This study focused on the Selke River in the Harz Mountains (Germany) with steep DO gradients between the stream water and the shallow, adjacent groundwater and associated stable isotope shifts. δ13CDIC values decreased from -13 ‰ to -18 ‰ versus the Vienna Pee Dee Belemnite standard (VPDB) from May to November 2016 and indicated the dominant influence of microbial respiration on the observed DO gradients. With such respiration dominance, we have expected a simultaneous enrichment of δ18ODOto values higher than the one of atmospheric O2 (+23.9 ‰ versus Vienna Standard Mean Ocean Water standard - VSMOW). However, our measurements revealed anomalously low δ18ODO values between +22 ‰ and +18 ‰ versus VSMOW for the same time period. These δ18ODO values were lower than those found in the river. Latter were close to equilibrium with the atmosphere (24.9 ‰ versus VSMOW). The observed δ18ODO ratios in the shallow groundwater can be explained with DO from the river that is subject to fractionation by microbial respiration with a typical fractionation factor (αr) of 0.995. In addition, mass balances revealed that this oxygen pool receives contributions of up to 25 % by diffused oxygen from the vadose zone. Consequently, isotope shifts by respiration and admixture with surface water are masked by diffusion effects that result in a decoupling of carbon and oxygen isotope systematics in

  8. From paramilitary action to defeat : the 1934 socialist insurrections in Vienna and Madrid | De la paramilitarización al fracaso : las insurrecciones sociales de 1934 en Viena y Madrid

    Directory of Open Access Journals (Sweden)

    Sandra Souto Kustrín

    2003-12-01

    Full Text Available The aim of this article is to compare the insurrections that took place in Vienna in February 1934 and in Madrid in October of the same year. They were both led by socialist parties ?the only two instances in European history in which socialist parties took this kind of action?, both were based on the experience of communist insurrections, involving the action of a paramilitary organization together with a general strike. This article analyses and compares the paramilitary organizations, the plans and the insurrections themselves in both cities. | El objetivo de este artículo es comparar los procesos insurreccionales producidos en Viena en febrero de 1934 y en Madrid en octubre del mismo año. Ambos fueron protagonizados por partidos socialistas ?las dos únicas ocasiones en la historia europea que partidos socialistas realizaron este tipo de acciones?, se basaron en la experiencia insurreccional comunista, y partieron de la acción de una organización paramilitar acompañada de una huelga general. Se analizan y comparan las organizaciones paramilitares, los proyectos y la insurrección misma en ambas ciudades.

  9. International Atomic Energy Agency's advisory group meeting on safeguards related to the final disposal of waste and spent fuel, Vienna, Austria, September 12-16, 1988: Foreign trip report

    Energy Technology Data Exchange (ETDEWEB)

    Moran, B.W.

    1988-10-01

    B.W. Moran traveled to Vienna, Austria, during the period of September 12--16, 1988, to serve as the technical advisor to the US Department of Energy's (DOE's) Office of Civilian Radioactive Waste Management (OCRWM) representatives to the International Atomic Energy Agency's Advisory Group Meeting on ''Safeguards Related to the Final Disposal of Nuclear Material in Waste and Spent Fuel.'' The goal of the US representatives to this meeting was to ensure that the advisory group's recommendations established (1) an effective IAEA safeguards approach for all radioactive waste and spent fuel management facilities and (2) a safeguards approach that is appropriate for the US Federal Waste Management System. The principal concerns of the United States on entering the advisory group meeting were: criteria for the termination of safeguards on waste should not be established, but should be referred for further study, safeguards on spent fuel should not be terminated, and safeguards studies are required before IAEA safeguards approaches for spent fuel are established. The US representatives generally recommended that consultant meetings be convened to address the technical issues after the requisite safeguards related research and development tasks have been performed. These objectives of the US representatives were achieved, and the recommendations of the advisory group generally coincided with and extended the recommendations presented in the US position paper.

  10. Move me, astonish me… delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates.

    Science.gov (United States)

    Pelowski, Matthew; Markey, Patrick S; Forster, Michael; Gerger, Gernot; Leder, Helmut

    2017-07-01

    This paper has a rather audacious purpose: to present a comprehensive theory explaining, and further providing hypotheses for the empirical study of, the multiple ways by which people respond to art. Despite common agreement that interaction with art can be based on a compelling, and occasionally profound, psychological experience, the nature of these interactions is still under debate. We propose a model, The Vienna Integrated Model of Art Perception (VIMAP), with the goal of resolving the multifarious processes that can occur when we perceive and interact with visual art. Specifically, we focus on the need to integrate bottom-up, artwork-derived processes, which have formed the bulk of previous theoretical and empirical assessments, with top-down mechanisms which can describe how individuals adapt or change within their processing experience, and thus how individuals may come to particularly moving, disturbing, transformative, as well as mundane, results. This is achieved by combining several recent lines of theoretical research into a new integrated approach built around three processing checks, which we argue can be used to systematically delineate the possible outcomes in art experience. We also connect our model's processing stages to specific hypotheses for emotional, evaluative, and physiological factors, and address main topics in psychological aesthetics including provocative reactions-chills, awe, thrills, sublime-and difference between "aesthetic" and "everyday" emotional response. Finally, we take the needed step of connecting stages to functional regions in the brain, as well as broader core networks that may coincide with the proposed cognitive checks, and which taken together can serve as a basis for future empirical and theoretical art research. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. The European Society for Medical Oncology 'Magnitude of Clinical Benefit Scale' field-tested in infrequent tumour entities: an extended analysis of its feasibility at the Medical University of Vienna.

    Science.gov (United States)

    Kiesewetter, Barbara; Raderer, Markus; Prager, Gerald W; Fuereder, Thorsten; Marosi, Christine; Preusser, Matthias; Krainer, Michael; Locker, Gottfried J; Brodowicz, Thomas; Zielinski, Christoph C

    2017-01-01

    The European Society for Medical Oncology Magnitude of Clinical Benefit Scale (ESMO-MCBS) is a new tool to quantify the clinical benefit that may be anticipated from a novel anticancer treatment. We present here an analysis on the feasibility of the ESMO-MCBS in less frequent tumour entities. This study evaluates the practicability of the ESMO-MCBS for metastatic neuroendocrine tumours (NETs), soft tissue sarcomas, glioblastoma, thyroid cancer, pancreatic cancer, head/neck cancer, urothelial cancer and ovarian cancer at the Medical University Vienna. A three-step approach including data acquisition, assessment of ESMO-MCBS scores and evaluation of results with a focus on clinical feasibility was applied. In NET and thyroid cancer, all analysed trials were very comparable in design and efficacy, and the ESMO-MCBS scores appeared to be consistent with the clinical benefit seen in practice. For pancreatic cancer, it was more difficult to compare first-line trials due to diverging populations included in the respective studies. Concerning soft tissue sarcomas, the ESMO-MCBS was applicable for gastrointestinal stromal tumours(GIST) and 'non-GIST' soft tissue sarcoma with respect to data deriving from randomised studies. However, due to the heterogeneity of the disease itself and a limited number of controlled trials, limitations are noted. In ovarian cancer, the ESMO-MCBS supported the use of bevacizumab in high-risk patients. To date, there are only limited data for glioblastoma, head/neck cancer and urothelial cancer but whenever randomised trials were available, the ESMO-MCBS rating supported clinical decisions. Interestingly, nivolumab for salvage treatment of head/neck cancer rated extremely high. The ESMO-MCBS scores supported our common treatment strategies and highlight the potential of new immunomodulatory drugs. Our results encourage further development of the ESMO-MCBS.

  12. Effects of elastic band resistance training and nutritional supplementation on muscle quality and circulating muscle growth and degradation factors of institutionalized elderly women: the Vienna Active Ageing Study (VAAS).

    Science.gov (United States)

    Hofmann, Marlene; Schober-Halper, Barbara; Oesen, Stefan; Franzke, Bernhard; Tschan, Harald; Bachl, Norbert; Strasser, Eva-Maria; Quittan, Michael; Wagner, Karl-Heinz; Wessner, Barbara

    2016-05-01

    Regular resistance exercise training and a balanced diet may counteract the age-related muscular decline on a molecular level. The aim of this study was to investigate the influence of elastic band resistance training and nutritional supplementation on circulating muscle growth and degradation factors, physical performance and muscle quality (MQ) of institutionalized elderly. Within the Vienna Active Ageing Study, 91 women aged 83.6 (65.0-92.2) years were randomly assigned to one of the three intervention groups (RT, resistance training; RTS, resistance training plus nutritional supplementation; CT, cognitive training). Circulating levels of myostatin, activin A, follistatin, IGF-1 and GDF-15, as well as MQ and functional parameters were tested at baseline as well as after 3 and 6 months of intervention. MQ of lower extremities significantly increased in the RT group (+14 %) and RTS group (+12 %) after 6 months. Performance improved in the RT and RTS groups for chair stand test (RT: +18 %; RTS: +15 %). Follistatin increased only in the RT group (+18 %) in the latter phase of the intervention, accompanied by a decrease in the activin A-to-follistatin ratio (-7 %). IGF-1, myostatin and GDF-15 levels were not affected by the intervention. Our data confirm that strength training improves physical performance and MQ even in very old institutionalized women. This amelioration appears to be mediated by blocking muscle degradation pathways via follistatin rather than inducing muscle growth through the IGF-1 pathway. As plasma levels of biomarkers reflect an overall status of various organ systems, future studies of tissue levels are suggested.

  13. Move me, astonish me… delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates

    Science.gov (United States)

    Pelowski, Matthew; Markey, Patrick S.; Forster, Michael; Gerger, Gernot; Leder, Helmut

    2017-07-01

    This paper has a rather audacious purpose: to present a comprehensive theory explaining, and further providing hypotheses for the empirical study of, the multiple ways by which people respond to art. Despite common agreement that interaction with art can be based on a compelling, and occasionally profound, psychological experience, the nature of these interactions is still under debate. We propose a model, The Vienna Integrated Model of Art Perception (VIMAP), with the goal of resolving the multifarious processes that can occur when we perceive and interact with visual art. Specifically, we focus on the need to integrate bottom-up, artwork-derived processes, which have formed the bulk of previous theoretical and empirical assessments, with top-down mechanisms which can describe how individuals adapt or change within their processing experience, and thus how individuals may come to particularly moving, disturbing, transformative, as well as mundane, results. This is achieved by combining several recent lines of theoretical research into a new integrated approach built around three processing checks, which we argue can be used to systematically delineate the possible outcomes in art experience. We also connect our model's processing stages to specific hypotheses for emotional, evaluative, and physiological factors, and address main topics in psychological aesthetics including provocative reactions-chills, awe, thrills, sublime-and difference between ;aesthetic; and ;everyday; emotional response. Finally, we take the needed step of connecting stages to functional regions in the brain, as well as broader core networks that may coincide with the proposed cognitive checks, and which taken together can serve as a basis for future empirical and theoretical art research.

  14. Universitätsbibliothek der Medizinischen Universität Wien – größte Medizinbibliothek Österreichs: Hybridbibliothek als Zukunftskonzept / University Library of the Medical University Vienna – largest Medical Library of Austria: Hybrid Library as a concept for the future

    Directory of Open Access Journals (Sweden)

    Hartl, Margrit

    2009-12-01

    Full Text Available The today’s Medical University Library was established as Faculty Library of the Vienna University Library in 1986 and serves till now as the largest Medical Library in Austria. The Main Library is located in the Vienna General Hospital (University hospitals. During 1994 and 2003 it became the Austrian Central Library for Medicine. Since 2004 University Library of the newly founded Medical University of Vienna supplies literature and information for 8500 Students, 1800 scientists and 1600 doctors. The article describes the Library’s participation on projects of the Austrian Library Consortium and the Austrian Cooperation for E-media. It specifies the offers and use of the digital library (professional databases, electronic journals, document delivery, e-books but also the website and the “Van Swieten”-Blog which are the information and communication platforms of the University Library. The next part shows the supply of traditional library which consists of the Clinical Library, the Textbook Collection and the Students Reading Room. We report also on the Library for the History of Medicine, their precious medical historical holdings and their current activities connected with the digitalization of the card index. The library’s activities to the “Medizin Curriculum Wien”, trainings and tours are told in the chapter about the Teaching Library but also the Information Retrieval Service and the activities due to training, placement and projects of librarians. Another part speaks about the special activities in international projects like “subito”, “E-books on demand” and a gateway for PDAs. The Medical University Library was the first Austrian library who used the LinkOut function of PubMed. The library works on a project of “Wiedergutmachung” (NS-Provenienzforschung and a very ambitious Weblog for the remembrance of the displaced professors at the medical faculty of the University of Vienna in 1938. The last chapter

  15. PubMed und LinkOut als Wegweiser zu Printbeständen in der Universitätsbibliothek der Medizinischen Universität Wien / PubMed and LinkOut as guidepost to print holding on the university library of the Medical University of Vienna

    Directory of Open Access Journals (Sweden)

    Dollfuß, Helmut

    2009-09-01

    Full Text Available In the area of electronic literature research PubMed is one of the most important literature data bases. In the course of our project selected print holdings on medical journals of the university library of the medical university Vienna were integrated in PubMed. Now scientists, lecturers, students, library staff and other interested persons have an easier access via PubMed to the comprehensive print holdings of medical journals of the university library, as well as some of their branch libraries.

  16. Which brain networks related to art perception are we talking about?. Comment on "Move me, astonish me…" delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates; by Matthew Pelowski et al.

    Science.gov (United States)

    Ayala, Francisco J.; Cela-Conde, Camilo J.

    2017-07-01

    The proposal by the Vienna Integrated Model of Art Perception (Pelowski et al., [4]; VIMAP, hereafter) is a valuable and much needed attempt to summarize and understand the cognitive processes underlying art perception. Very important in their model is, as expected, to ascertain the psychological and brain processes correlated with the perception of beauty in art works. In this commentary we'll focus exclusively on the consideration of VIMAP's section 5, ;Model stages and corresponding areas of the brain.; We'll examine the evidence advanced by VIMAP in the section about brain networks related to the perception of art.

  17. Le comte qui était comtesse : un cas de gynandrie au tribunal de Vienne (1890 The Count who was a Countess: a Case of Gynandry in the Court of Vienna (1890

    Directory of Open Access Journals (Sweden)

    Patrick Pognant

    2011-03-01

    Full Text Available Il s’agit d’une des premières expertises auprès des tribunaux de la Cour impériale conduite par Krafft-Ebing alors qu’il venait d’être nommé professeur de psychiatrie à Vienne. Il eut à mener cette expertise dans une affaire de mœurs à propos d’une jeune comtesse hongroise qui, selon lui, souffrait de gynandrie, ce qui l’aurait conduite à convoler en noces illégitimes avec une jeune fille en escroquant au passage son « beau-père ». Il sera notamment intéressant de voir comment Krafft-Ebing a orienté son expertise pour la faire coïncider avec la théorie qu’il avait élaborée à propos des psychopathies sexuelles (et notamment les degrés de l’homosexualité et comment il obtint l’acquittement de la jeune femme qui, d’ailleurs, passa le reste de sa vie dans la peau (et le pantalon d’un homme en se faisant appeler M. le Comte…This article is about one of the first expert testimonies presented to the tribunals of the imperial Court, conducted by Krafft-Ebing when he had just been named professor of psychiatry at Vienna. He was called in on a case involving a young Hungarian countess – in his view, suffering from gynandrism – charged with illegitimate marriage to a young woman and knowingly misrepresenting herself to her “father-in-law” in the process.  Of particular interest is the way Krafft-Ebing oriented his testimony, aligning it with the theory he had previously elaborated regarding sexual psychopathies (notably degrees of homosexuality. Of interest, too, is his role in the acquittal of the countess, who spent the rest of her life as a man (in body and dress, identifying himself as Monsieur le Comte…

  18. Horses and Borrelia: immunoblot patterns with five Borrelia burgdorferi sensu lato strains and sera from horses of various stud farms in Austria and from the Spanish Riding School in Vienna.

    Science.gov (United States)

    Müller, Iris; Khanakah, Gelas; Kundi, Michael; Stanek, Gerold

    2002-06-01

    Grazing animals are continuously exposed to tick bites. Consequently, one may expect that horses will become infected with the various pathogens carried by ticks including Borrelia burgdorferi sensu lato. Whether horses may develop clinical disease due to this pathogen is controversially discussed. We were interested to learn about the infection of horses with Borrelia burgdorferi sensu lato within one season by studying the dynamics of the humoral immune response in paired blood samples. The majority of horses examined were Lipizzaner from the stud farm in Piber/Steiermark, and from the Spanish Riding School in Vienna. Smaller groups of animals of different breeds were from stud farms in Kärnten, Niederösterreich, Salzburg and Steiermark. Clinical status and medical history were obtained and blood was drawn at the beginning of the highest tick activity and nine months later in 1998. Immunoblot technique (Western blot) was used in order to determine the dynamics in the immune response patterns. As antigens served the genospecies Borrelia afzelii, Borrelia burgdorferi sensu stricto, Borrelia garinii, Borrelia lusitaniae, and Borrelia valaisiana. 309 horses (age median 7 years, range 1/12 to 33 years) were seen at the first round. 186 of these animals (60.2%; median age 6 years, range 4/12 to 33 years) were re-examined in the second round. All animals were in normal health condition during both rounds of examination and blood sampling. Analysis of the immunoblot patterns was based on in-house-, Pko-, Pka2-, Pbi-, and European Union Concerted Action on Lyme Borreliosis (EUCALB) 2 & 3-criteria; analyses revealed a variety of positive results with different strains and criteria. Positive immunoblot results with 186 paired samples and B. afzelii as antigen, for example, ranged from 52 to about 91% in the first, and 53 to 93% in the second round. The age dependency analyses showed that the first infection with B. burgdorferi sensu lato occurs in the first year. Re

  19. E-Books an Medizinbibliotheken – „Gekommen um zu bleiben“. Ein Erfahrungsbericht der Universitätsbibliothek der Medizinischen Universität Wien / E-Books at medical libraries: They came to stay. A report from the university library at the Medical University Vienna

    Directory of Open Access Journals (Sweden)

    Bauer, Bruno

    2011-12-01

    Full Text Available Many university libraries and in particular medical libraries have built up a considerable collection of electronic books. These E-Books are already highly accepted by patrons despite unsolved questions on technical standards and license models which have to be tackled by publishers and libraries. A short introduction on advandages and disadvantages of E-Books is followed by a presentation of E-Book collections and E-Book catalogues found on the websites of medical libraries in Berlin, Mainz, Münster and Zürich. A more detailed report is given on the E-Book situation at the library of the Medical University Vienna including problems with usage data. Results of a recent library online survey are discussed in regard to E-Books. So far the experience with E-Books at the library of the Medical University Vienna and the positive feedback by patrons suggests that E-Books came to stay in medical libraries.

  20. Representing the sublime in the VIMAP and empirical aesthetics: Reviving Edmund Burke's A Philosophical Enquiry into the Origins of Our Ideas of the Sublime and Beautiful. Comment on "Move me, astonish me... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Hur, Y.-J.; McManus, I. C.

    2017-07-01

    This commentary considers the role of the sublime in the Vienna Integrated Model of Art Perception (VIMAP; Pelowski, Markey, Forster, Gerger, & Leder [17]), and suggest that it is not precisely conceptualised in the model. In part that reflects different views and usages of the sublime in the literature, and here it is recommended that Burke's [2] view of the sublime is used as a primary framework for empirical research on the sublime.

  1. Tracing formation and durability of calcite in a Punic-Roman cistern mortar (Pantelleria Island, Italy).

    Science.gov (United States)

    Dietzel, Martin; Schön, Frerich; Heinrichs, Jens; Deditius, Artur P; Leis, Albrecht

    2016-01-01

    Ancient hydraulic lime mortar preserves chemical and isotopic signatures that provide important information about historical processing and its durability. The distribution and isotopic composition of calcite in a mortar of a well-preserved Punic-Roman cistern at Pantelleria Island (Italy) was used to trace the formation conditions, durability, and individual processing periods of the cistern mortar. The analyses of stable carbon and oxygen isotopes of calcite revealed four individual horizons, D, E, B-1 and B-2, of mortar from the top to the bottom of the cistern floor. Volcanic and ceramic aggregates were used for the production of the mortar of horizons E/D and B-1/B-2, respectively. All horizons comprise hydraulic lime mortar characterized by a mean cementation index of 1.5 ± 1, and a constant binder to aggregate ratio of 0.31 ± 0.01. This suggests standardized and highly effective processing of the cistern. The high durability of calcite formed during carbonation of slaked lime within the matrix of the ancient mortar, and thus the excellent resistance of the hydraulic lime mortar against water, was documented by (i) a distinct positive correlation of δ(18)Ocalcite and δ(13)Ccalcite; typical for carbonation through a mortar horizon, (ii) a characteristic evolution of δ(18)Ocalcite and δ(13)Ccalcite through each of the four mortar horizons; lighter follow heavier isotopic values from upper to lower part of the cistern floor, and (iii) δ(18)Ocalcite varying from -10 to -5 ‰ Vienna Pee Dee belemnite (VPDB). The range of δ(18)Ocalcite values rule out recrystallization and/or neoformation of calcite through chemical attack of water stored in cistern. The combined studies of the chemical composition of the binder and the isotopic composition of the calcite in an ancient mortar provide powerful tools for elucidating the ancient techniques and processing periods. This approach helps to evaluate the durability of primary calcite and demonstrates the

  2. System for δ13C–CO2 and xCO2 analysis of discrete gas samples by cavity ring-down spectroscopy

    Directory of Open Access Journals (Sweden)

    D. Dickinson

    2017-11-01

    Full Text Available A method was devised for analysing small discrete gas samples (50 mL syringe by cavity ring-down spectroscopy (CRDS. Measurements were accomplished by inletting 50 mL syringed samples into an isotopic-CO2 CRDS analyser (Picarro G2131-i between baseline readings of a reference air standard, which produced sharp peaks in the CRDS data feed. A custom software script was developed to manage the measurement process and aggregate sample data in real time. The method was successfully tested with CO2 mole fractions (xCO2 ranging from  <  0.1 to  >  20 000 ppm and δ13C–CO2 values from −100 up to +30 000 ‰ in comparison to VPDB (Vienna Pee Dee Belemnite. Throughput was typically 10 samples h−1, with 13 h−1 possible under ideal conditions. The measurement failure rate in routine use was ca. 1 %. Calibration to correct for memory effects was performed with gravimetric gas standards ranging from 0.05 to 2109 ppm xCO2 and δ13C–CO2 levels varying from −27.3 to +21 740 ‰. Repeatability tests demonstrated that method precision for 50 mL samples was ca. 0.05 % in xCO2 and 0.15 ‰ in δ13C–CO2 for CO2 compositions from 300 to 2000 ppm with natural abundance 13C. Long-term method consistency was tested over a 9-month period, with results showing no systematic measurement drift over time. Standardised analysis of discrete gas samples expands the scope of application for isotopic-CO2 CRDS and enhances its potential for replacing conventional isotope ratio measurement techniques. Our method involves minimal set-up costs and can be readily implemented in Picarro G2131-i and G2201-i analysers or tailored for use with other CRDS instruments and trace gases.

  3. Cyclone phyan-induced plankton community succession in the coastal waters off Goa, India

    Digital Repository Service at National Institute of Oceanography (India)

    Gauns, M.; Kurian, S.; Shenoy, D.M.; Naik, H.; Naqvi, S.W.A.

    (CaTS) station G5 (153036N; 73390E) on 4 November 2009 (CaTS-85). Following the cyclone we visited the station again on 17 November 2009 (CaTS 86). Water samples on both field trips were collected with Niskin samplers RESEARCH COMMUNICATIONS.... Isotopic ratio  13C is expressed with respect to the Pee Dee Belemnite (PDB) and the precision was better than  0.2‰ as determined Figure 2. Vertical profiles of temperature and salinity measured by CTD before (CaTS 85; ) and after (CaTS 86...

  4. ‘Hans Tietze and art history as Geisteswissenschaft in early twentieth-century Vienna’ translated by Clarice Zdanski with an introduction by Riccardo Marchi, originally published as Riccardo Marchi, ‘Hans Tietze e la storia dell’arte come scienza dello spirito nella Vienna del primo Novecento’, Arte Lombarda, 110/111, 1994, 55–66

    Directory of Open Access Journals (Sweden)

    Riccardo Marchi

    2011-12-01

    Full Text Available This article analyzes the Methode der Kunstgeschichte, published in 1913 by Hans Tietze (1880-1954, an important but often neglected figure of the Vienna school of art history, who had been a student of Franz Wickhoff and Aloïs Riegl and was one of Ernst H. Gombrich’s teachers. In the Methode Tietze developed a bold and innovative idea of art history out of a confrontation with momentous intellectual and artistic challenges. These were (1 the discussion about the object and method of the Geisteswissenschaften (human and cultural sciences in German philosophy, (2 Riegl’s and Wölfflin’s formalism, which Tietze critiqued as insufficient, also in response to the emergence of expressionism, which he courageously and precociously supported, and (3 epistemological debates that questioned notions of ‘objective’ knowledge.

  5. Wohin mit den älteren medizinischen Zeitschriftenbänden? - Die Benutzungserhebung 2004 an der Universitätsbibliothek der Medizinischen Universität Wien / Where to put the back numbers? - Usage of older medical journals at the Medical University Library Vienna in 2004

    Directory of Open Access Journals (Sweden)

    Bauer, Bruno

    2006-05-01

    Full Text Available The increasing usage of e-journals questions the library's print archive. This is particularly valid for medical libraries where mainly up to date literature is required. From March to June 2004 the use of back numbers at the Medical University Library Vienna was recorded in order to assess utilisation of print journals published before 1986. During these four month 10.286 bound volumes were taken out from the print archive. Journal title, publication year and type of usage (local or interlibrary loan was registered. A ranking list of the most used journals was compiled including their impact factor. On average it came to about 105 uses per workday. This remarkable demand for back numbers is a clear argument for keeping the library's print archive inhouse regarding the publishers' patchy online backfile collections.

  6. Medizin Curriculum Wien: neue Anforderungen an die Literatur- und Informationsversorgung für Studierende an der Universitätsbibliothek der Medizinischen Universität Wien / Medizin Curriculum Wien: New Demands for the Supply of Literature and Information to Students at the University Library of the Medical University of Vienna

    Directory of Open Access Journals (Sweden)

    Bauer, Bruno

    2005-09-01

    Full Text Available So far, students at medical faculties have intensively mainly used two services out of many, which specialized medical libraries have to offer: the textbook collection and the student reading room. Only towards the end of studies, in preparation of dissertations, do students take advantage of bibliographical databases and appropriate journals. During the last years, the medical curricula in many countries, including Germany and Austria, experienced considerable modifications. The reformation of the studies, which, in many cases, actually finds itself in the phase of implementation, is, in fact, a unique challenge for libraries. In support of medical studies, university lecturers and students expect information resources, library services and the relay of information competence, which should clearly surmount existing needs of the textbook collection and the student reading room, as shown in the available contribution, as example of the University Library of the Medical University of Vienna.

  7. On viewer motivation, unit of analysis, and the VIMAP. Comment on "Move me, astonish me ... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Tinio, Pablo P. L.

    2017-07-01

    The Vienna Integrated Model of Art Perception (VIMAP; [5]) is the most comprehensive model of the art experience today. The model incorporates bottom-up and top-down cognitive processes and accounts for different outcomes of the art experience, such as aesthetic evaluations, emotions, and physiological and neurological responses to art. In their presentation of the model, Pelowski et al. also present hypotheses that are amenable to empirical testing. These features make the VIMAP an ambitious model that attempts to explain how meaningful, complex, and profound aspects of the art experience come about, which is a significant extension of previous models of the art experience (e.g., [1-3,10]), and which gives the VIMAP good explanatory power.

  8. With the train from Paris to Vienna in fewer than four hours? A new velocity dimension for Europe: 400 kilometres per hour - what are the effects for the train operations?; Mit dem Zug von Paris nach Wien in weniger als vier Stunden? Eine neue Geschwindigkeitsdimension fuer Europa: 400 Kilometer pro Stunde - welche Effekte hat das fuer den Bahnbetrieb?

    Energy Technology Data Exchange (ETDEWEB)

    Schumann, Tilo [Deutsches Zentrum fuer Luft und Raumfahrt e.V., Braunschweig (Germany). Institut fuer Verkehrssystemtechnik; Ehrenberger, Simone [DLR Deutsches Zentrum fuer Luft- und Raumfahrt e.V., Stuttgart (Germany). Inst. fuer Fahrzeugkonzepte

    2011-06-15

    In the morning cafe-au-lait in Paris, in the afternoon Vienna Melange at the Hotel Sacher: For this line businessmen and travelers usually choose the plane, because the journey by train takes twelve hours. But a travel by train could be quite attractive if the journey time would be shorter. The travel by train has a great advantage: most stations are located in prime downtown location. Without interruption one enters directly into the city. The German Aerospace Center (Cologne, Federal Republic of Germany) developed a concept for the Next-Generation Train (NGT): This is an energy-efficient high-speed train, the train could make traveling much faster. In addition to a variety of other issues, the effects of such rapid connections between cities are examined in the NGT project.

  9. Animal pee in the sea: consumer-mediated nutrient dynamics in the world's changing oceans.

    Science.gov (United States)

    Allgeier, Jacob E; Burkepile, Deron E; Layman, Craig A

    2017-06-01

    Humans have drastically altered the abundance of animals in marine ecosystems via exploitation. Reduced abundance can destabilize food webs, leading to cascading indirect effects that dramatically reorganize community structure and shift ecosystem function. However, the additional implications of these top-down changes for biogeochemical cycles via consumer-mediated nutrient dynamics (CND) are often overlooked in marine systems, particularly in coastal areas. Here, we review research that underscores the importance of this bottom-up control at local, regional, and global scales in coastal marine ecosystems, and the potential implications of anthropogenic change to fundamentally alter these processes. We focus attention on the two primary ways consumers affect nutrient dynamics, with emphasis on implications for the nutrient capacity of ecosystems: (1) the storage and retention of nutrients in biomass, and (2) the supply of nutrients via excretion and egestion. Nutrient storage in consumer biomass may be especially important in many marine ecosystems because consumers, as opposed to producers, often dominate organismal biomass. As for nutrient supply, we emphasize how consumers enhance primary production through both press and pulse dynamics. Looking forward, we explore the importance of CDN for improving theory (e.g., ecological stoichiometry, metabolic theory, and biodiversity-ecosystem function relationships), all in the context of global environmental change. Increasing research focus on CND will likely transform our perspectives on how consumers affect the functioning of marine ecosystems. © 2017 John Wiley & Sons Ltd.

  10. Observation of electromagnetic Dalitz decays J/psi -> Pe(+)e(-)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Braun, S.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, Y.; Fava, L.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Fuks, O.; Gao, Q.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, L.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Kloss, B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D.; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, Q. J.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Lin, D. X.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, G. R.; Lu, H. J.; Lu, H. L.; Lu, J. G.; Lu, X. R.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Moeini, H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ripka, M.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, W. M.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Werner, M.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, N.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zang, S. L.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. B.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.

    2014-01-01

    Based on a sample of (225.3 +/- 2.8) x 10(6) J/psi events collected with the BESIII detector, the electromagnetic Dalitz decays of J/psi -> Pe(+)e(-)(P = eta'/eta/pi(0)) are studied. By reconstructing the pseudoscalar mesons in various decay modes, the decays J/psi -> eta'e(+)e(-), J/psi -> eta

  11. Decoupling of Serpentinization and Prehnitization in Lower East Pacific Rise Crust at Hess Dee

    Science.gov (United States)

    Deasy, R. T.; Wintsch, R. P.; Meyer, R.; Bish, D. L.; Gasaway, C.; Heimdal, T.

    2014-12-01

    Our down-hole mineralogical and geochemical analyses from the East Pacific Rise fast-spreading lower oceanic crust indicate that alteration of olivine to serpentine and of plagioclase to prehnite were independent, and neither alone monitors the total "alteration." The results are based on representative channel sub-samples recovered from every Hole J core during IODP Expedition 345 to the Hess Deep tectonic window. Samples have been analyzed for trace element, Sr isotopic, and quantitative mineralogical compositions (the latter by Rietveld refinement using X-ray diffraction data). Hole J is the most representative rock succession drilled at the Hess Deep as it penetrated the two principle plutonic lithologies: an upper gabbro and a lower troctolite. Units are significantly distinguished by XRD modal mineralogy and trace element abundances. The more heterogeneous gabbro contains 23-32 wt% clinopyroxene (cpx), 34-54 wt% plagioclase (plag), and <4 wt% olivine (ol). The troctolite contains 3-11% cpx, 14-36% plag, and ≤6% ol. Alteration minerals comprise together 18-31% in the gabbro versus 55-80% of the troctolite. The most abundant alteration products are prehnite and chlorite. Gabbro samples with lowest abundances of alteration minerals (18-20 wt%) preserve 87Sr/86Sr ratios (0.70275-0.7028) consistent with unaltered mantle. The abundance of plag in the gabbro, the major host for Sr, suggests retention of mantle Sr isotopic compositions there is due to the large reservoir of magmatic Sr. 87Sr/86Sr ratios of 0.70300-0.70342 in the troctolite samples indicate seawater interaction, even where olivine is most abundant, and serpentine is at or below the ~1% detection limit by XRD. Significant alteration of the deep crust by seawater thus predates the first appearance of serpentine. These data suggest that the timing and operation of prehnite- and serpentine-producing alteration reactions are independent.

  12. Venous thromboembolism and vascular access thrombosis in patients with end-stage renal disease on maintenance hemodialysis: Cross-sectional results of the Vienna InVestigation of AtriaL fibrillation and thromboembolism in patients on hemoDIalysis (VIVALDI).

    Science.gov (United States)

    Königsbrügge, Oliver; Lorenz, Matthias; Auinger, Martin; Schmaldienst, Sabine; Klauser-Braun, Renate; Kletzmayr, Josef; Grilz, Ella; Posch, Florian; Antlanger, Marlies; Pabinger, Ingrid; Säemann, Marcus; Ay, Cihan

    2017-08-19

    Patients with end-stage renal disease (ESRD) on maintenance hemodialysis (HD) are at risk for occurrence of vascular access thrombosis and venous thromboembolism (VTE). Understanding the extent of these complications and identifying risk factors can help improve management strategies. Adult HD patients were cross-sectionally recruited into the Vienna InVestigation of AtriaL fibrillation and thromboembolism in patients on hemoDIalysis (VIVALDI). In this investigation, retrospective data on the incidence and risk of VTE and vascular access thrombosis was analyzed using logistic regression and negative binomial regression for counts of vascular access thrombosis episodes. The analysis includes 626 patients on HD, which constitutes 73% of the total HD population in Vienna, Austria. One-hundred-seventy-eight patients (28.4%) had 275 vascular access thrombosis events during 2463.1 patient-years on HD, corresponding to an incidence rate (IR) of 111.6 events per 1000 patient-years on HD. In the multivariable negative binomial regression model, we found that patients suffered from vascular access thrombosis 2.5 times more often (IR ratio 2.63, 95% confidence interval [CI] 1.48-4.68, p=0.001) if toxic nephropathy was their cause of ESRD (n=28, 4.5%) compared to patients with other causes of ESRD. Sixty-one patients (9.7%) had a history of VTE and the IR of VTE events during the time on HD was 10.9 per 1000 patient-years on HD (women: IR 15.1, men IR 8.6). Female sex (odds ratio [OR] 1.90, 95%CI 1.07-3.36, p=0.029) and atrial fibrillation (OR 2.00, 95%CI 1.10-3.64, p=0.023) were independently associated with VTE. Thromboembolic events including vascular access thrombosis and VTE are frequent complications in patients on HD. Risk evaluation for thromboembolism, including sex and clinical parameters, may identify high-risk patients and improve their clinical management. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Virtuelle Lehrbuchsammlung und eBooks on Demand als Facetten der Hybridbibliothek: zwei innovative Services der Universitätsbibliothek der Medizinischen Universität Wien /Virtual textbook collection and eBooks on Demand as facets of the hybrid library: two innovative services of the university library of the Medical University Vienna

    Directory of Open Access Journals (Sweden)

    Miehl, Marian

    2010-12-01

    Full Text Available The university library of the Medical University of Vienna is a hybrid library and offers a huge stock of literature in print and online. Two projects were realised to improve access to this collection. The library built a catalogue for their students, which includes all relevant resources for their courses. In addition to textbooks, print and online, it includes further relevant resources. The catalogue, called Van Swieten Student 2.0, uses a lot of web 2.0 applications. Until now one had to search a card index to find rare books of historical medical interest. That changed because the card index got digitalised and machine readable. So the library could put the card index into a catalogue with web 2.0 applications to make browsing easier. Because of a ground-breaking service, called eBooks on Demand (eod, it is now possible to directly order books which are no longer under copyright out of this catalogue.

  14. Adding Gestalt to the picture. Comment on "Move me, astonish me…" delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates; by Matthew Pelowski et al.

    Science.gov (United States)

    Wagemans, Johan

    2017-07-01

    Matthew Pelowski and his colleagues from the Helmut Leder lab [17] have made a remarkable contribution to the field of art perception by reviewing the extensive and varied literature (+300 references) on all the factors involved, from a coherent, synthetic perspective-The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP). VIMAP builds on earlier attempts from the same group to provide a comprehensive theoretical framework, but it is much wider in scope and richer in the number of levels and topics covered under its umbrella. It is particularly strong in its discussion of the different psychological processes that lead to a wide range of possible responses to art-from mundane, superficial reactions to more profound responses characterized as moving, disturbing, and transformative. By including physiological, emotional, and evaluative factors, the model is able to address truly unique, even intimate responses to art such as awe, chills, thrills, and the experience of the sublime. The unique way in which this rich set of possible responses to art is achieved is through a series of five mandatory consecutive processing steps (each with their own typical duration), followed by two conditional additional steps (which take more time). Three processing checks along this cascade lead to three more or less spontaneous outcomes (art, testing specific hypotheses derived from this framework for decades to come.

  15. Twisted photon entanglement through turbulent air across Vienna.

    Science.gov (United States)

    Krenn, Mario; Handsteiner, Johannes; Fink, Matthias; Fickler, Robert; Zeilinger, Anton

    2015-11-17

    Photons with a twisted phase front can carry a discrete, in principle, unbounded amount of orbital angular momentum (OAM). The large state space allows for complex types of entanglement, interesting both for quantum communication and for fundamental tests of quantum theory. However, the distribution of such entangled states over large distances was thought to be infeasible due to influence of atmospheric turbulence, indicating a serious limitation on their usefulness. Here we show that it is possible to distribute quantum entanglement encoded in OAM over a turbulent intracity link of 3 km. We confirm quantum entanglement of the first two higher-order levels (with OAM=± 1ħ and ± 2ħ). They correspond to four additional quantum channels orthogonal to all that have been used in long-distance quantum experiments so far. Therefore, a promising application would be quantum communication with a large alphabet. We also demonstrate that our link allows access to up to 11 quantum channels of OAM. The restrictive factors toward higher numbers are technical limitations that can be circumvented with readily available technologies.

  16. Twisted photon entanglement through turbulent air across Vienna

    OpenAIRE

    Krenn, Mario; Handsteiner, Johannes; Fink, Matthias; Fickler, Robert; Zeilinger, Anton

    2015-01-01

    Photons with a twisted phase front can carry a discrete, in principle unbounded amount of orbital angular momentum (OAM). The large state space allows for complex types of entanglement, interesting both for quantum communication and for fundamental tests of quantum theory. However, the distribution of such entangled states over large distances was thought to be infeasible due to influence of atmospheric turbulence, indicating a serious limitation on their usefulness. Here we show that it is p...

  17. No Borders for Tobacco Smoke in Hospitality Venues in Vienna

    Directory of Open Access Journals (Sweden)

    Manfred Neuberger

    2011-06-01

    Full Text Available In public places many countries banned smoking as the most important indoor source of fine airborne particulate matter. In Austria partial bans have been in force since 2009, with exemptions for the hospitality industry. From February to October 2010 we investigated PM2.5 concentrations in the breathing area of guests in well frequented Viennese establishments of all sizes, and compared these chance indoor samples with PM2.5 concentrations measured during the same half hour at the next outdoor monitoring station. The laser particle counter (OPC1.108, Grimm® used for indoor measurements had been calibrated by ß-attenuation (FH 62 I-R, Eberline®, which was used outdoors. 48% of 112 venues visited did not fully comply with the law, notwithstanding its weakness.  Highest median concentrations (in µg/m3 were found in bars (443.7, followed by nightclubs/discotheques (421.1, pubs (147.7, cafes (106.1 and restaurants (23.4. Concentrations increased with number of smokers present (p < 0.01, with medians of 282.4/241,3/67.6/6.9 µg/m³ in smoking venues/smoking rooms/adjacent non-smoking rooms/exclusive non-smoking venues. Only for the latter, a significant correlation was found with outdoor concentrations (r = 0.48, p < 0.01, while concentrations in non-smoking rooms were higher (p < 0.01 and unrelated to outdoor concentrations, but significantly dependent on concentrations in the adjacent smoking room (r = 0.64, p < 0.01. In conclusion, the partial smoking ban failed and guests of Viennese hospitality venues continue to risk disease from passive smoking, even in so-called “non-smoking rooms”, which are second-hand smoke rooms.

  18. The Vienna LTE simulators - Enabling reproducibility in wireless communications research

    Science.gov (United States)

    Mehlführer, Christian; Colom Colom Ikuno, Josep; Šimko, Michal; Schwarz, Stefan; Wrulich, Martin; Rupp, Markus

    2011-12-01

    In this article, we introduce MATLAB-based link and system level simulation environments for UMTS Long-Term Evolution (LTE). The source codes of both simulators are available under an academic non-commercial use license, allowing researchers full access to standard-compliant simulation environments. Owing to the open source availability, the simulators enable reproducible research in wireless communications and comparison of novel algorithms. In this study, we explain how link and system level simulations are connected and show how the link level simulator serves as a reference to design the system level simulator. We compare the accuracy of the PHY modeling at system level by means of simulations performed both with bit-accurate link level simulations and PHY-model-based system level simulations. We highlight some of the currently most interesting research questions for LTE, and explain by some research examples how our simulators can be applied.

  19. A Great Revolution in Economics - Vienna 1871 and after

    NARCIS (Netherlands)

    Leen, A.R.; Houmanidis, L.T.

    2001-01-01

    This book contains a comprehensive perspective on both older and modern Austrian economics. The first part especially describes the older Austrian School of Economics emphasizing both its subjective feature and its theoretical feature. Both features are extensively discussed from a non-Austrian

  20. BUDAPEST, BRATISLAVA AND VIENNA CONFERENCE FACILITIES, COMPARATIVE ANALYSIS

    National Research Council Canada - National Science Library

    Endre György Bártfai

    2011-01-01

    .... The utilized data within the study was collected from different sources, like websites of the Hungarian, Slovakian and Austrian Convention Bureaus, books dealing with convention and event management...

  1. The “Second” Vienna School as Social Science

    Directory of Open Access Journals (Sweden)

    Ian Verstegen

    2012-12-01

    Full Text Available This paper addresses Kunstwollen, not as a historicized concept, but as a social scientific construct open to reinterpretation and input from the evolving sciences. Emphasizing especially the contributions of Hans Sedlmayr in his Introduction to Riegl’s Collected Works (1929 and Otto Pächt’s article on Riegl (1962, attention departs from Riegl to set the stage regarding the meaning of Kunstwollen. Emphasizing its roots in materialistic social history, inspired by evolution, the article undertakes vignettes of paired art historians and social theorists: Dvorak and Karl Mannheim, Sedlmayr and Alfred Vierkandt, and Otto Pächt and Wolfgang Metzger. It can be seen that Kunstwollen is interpreted with the tools of social science as the sociology of knowledge (Mannheim, Vierkandt with refinements from Gestalt psychology (Metzger. As the career of Pächt progresses, the Austrian art historian looks for ways to stress continuous evolution, historical determinism and compulsion, and the super-individuality of artistic tradition.

  2. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... time. And when you do, phew! Your pee smells bad. These things happen because bacteria have caused ... your pee? Is your pee cloudy? Does it smell bad when you pee? These are signs that ...

  3. Home-based chlamydia testing of young people attending a music festival - who will pee and post?

    Directory of Open Access Journals (Sweden)

    Gold Judy

    2010-06-01

    Full Text Available Abstract Background Chlamydia is most common among young people, but only a small proportion of Australian young people are tested annually. Home-based chlamydia testing has been piloted in several countries to increase testing rates, but uptake has been low. We aimed to identify predictors of uptake of home-based chlamydia testing to inform future testing programs. Methods We offered home-based chlamydia testing kits to participants in a sexual behaviour cross-sectional survey conducted at a music festival in Melbourne, Australia. Those who consented received a testing kit and were asked to return their urine or vaginal swab sample via post. Results Nine hundred and two sexually active music festival attendees aged 16-29 completed the survey; 313 (35% opted to receive chlamydia testing kits, and 67 of 313 (21% returned a specimen for testing. One participant was infected with chlamydia (1% prevalence. Independent predictors of consenting to receive a testing kit included older age, knowing that chlamydia can make women infertile, reporting more than three lifetime sexual partners and inconsistent condom use. Independent predictors of returning a sample to the laboratory included knowing that chlamydia can be asymptomatic, not having had an STI test in the past six months and not living with parents. Conclusions A low proportion of participants returned their chlamydia test, suggesting that this model is not ideal for reaching young people. Home-based chlamydia testing is most attractive to those who report engaging in sexual risk behaviours and are aware of the often asymptomatic nature and potential sequelae of chlamydia infection.

  4. Calibration of the E Si detector in a DE-E telescope with a ^212Pb pin source

    Science.gov (United States)

    Chan, Ka Pang

    2012-10-01

    In nuclear physics experiments, telescopes composed of two or more large area silicon strip detectors are used to identify charged particles. To use the energy loss method for particle identification, a thin (˜0.065mm) silicon detector (DE) is mounted in front of a thicker E detector (˜1.5 mm). The DE Si detector can be calibrated with 8.785, 6.778, 6.288, 5.685 and 5.423 MeV alpha particles emitted from a ^228Th source. However, this method cannot be used to calibrate the E detector as the alpha particles cannot penetrate the front DE detector. We have developed a method to calibrate the E detector by inserting a small irradiated dowel pin between the two Si detectors. The pin source is electroplated with ^212Pb nuclei which emit alpha particles with 8.785 MeV, 6.090 and 6.051 MeV. Insertion of the dowel pin is designed and guided so that the head of the pin lies near the center of the detector at a distance of 2.72 mm away from the surface of the E detector. In addition to providing two strong alpha peaks for calibrations, the close distance and high pixilation of the E detector allows accurate determination of the front dead layer of the E Si strip detector. This technique has been implemented successfully in calibrating the E Si detectors in the NSCL High Resolution Array (HiRA) consisting of 20 closely pack DE-E-CsI telescopes.

  5. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... long, the kidneys clean waste products from your blood. The waste becomes urine (pee), which drips into ... a tickle in your lower belly? Is there blood in your pee? Is your pee cloudy? Does ...

  6. The effect of education on adult mortality and disability: a global perspective. Vienna Yearbook of Population Research|Vienna Yearbook of Population Research 2010 8|

    OpenAIRE

    Lentzner, Harold; KC, Samir

    2010-01-01

    Contemporary research primarily in the West offers a strong case for the relationship between formal education and adult health; more education, measured either by level completed or years of schooling, is associated, often in a stepwise fashion, with lower levels of mortality, morbidity and disability. In this study, we attempt to provide a global assessment of that relationship as it pertains to adult disability, using sample data from 70 countries that participated in the World Health Surv...

  7. An analysis of the long-term variation in stream water quality for three upland catchments at Loch Dee (Galloway, S.W. Scotland under contrasting land management

    Directory of Open Access Journals (Sweden)

    S. J. Langan

    2004-01-01

    Full Text Available A long term record of water chemistry, consisting of twenty years of weekly spot samples, from three sub-catchments draining into a loch and the loch outflow in Galloway, S.W. Scotland have been analysed. The analysis undertaken consisted of a three component statistical trend model. The technique allows the identification of long-term, seasonal and short-term trends, as well as differentiation between base flow and high flow responses. The land usage in the three sub-catchments is moorland, forest and forest plus lime. The results show that, since the mid-1980s, there has been a gradual decline in stream-water sulphate of the same order as reductions in the deposition of non-marine sulphate. Superimposed on this trend are somewhat random but considerable perturbations to this decline, caused by sea-salt deposition. There is no evidence of changes in surface water nitrate concentrations. The influence of different land management is evident in the sulphate, nitrate and pH data, whilst variations in calcium concentrations are also a product of differences in hydrological routing and the impact of sea-salt episodes. Keywords: trend analysis, acid deposition, land management, water quality, sea-salts, Galloway, S.W. Scotland

  8. Dees kennisse zuldy te kope vinnen’. Liedcultuur en de waarde van ‘know how’ in de vroegmoderne Republiek

    Directory of Open Access Journals (Sweden)

    Els Stronks

    2014-12-01

    Full Text Available This article investigates the vast corpus of approximately 100,000 songs produced in the Low Countries between 1500-1800 from a new angle, taking knowledge production as its point of departure. Can the seemingly endless representations of scenes of daily life we find in these songs be regarded as stimuli for the development of 'know how' (expertise, and what were the dynamics between the book market, songs, and the production of knowledge? This last question is addressed using the approximately 44,000 songs for the young as a case study.

  9. Estimating salinity intrusion effects due to climate change along the Grand Strand of the South Carolina coast

    Science.gov (United States)

    Conrads, Paul; Roehl, Edwin A.; Sexton, Charles T.; Tufford, Daniel L.; Carbone, Gregory J.; Dow, Kristin; Cook, John B.

    2010-01-01

    The ability of water-resource managers to adapt to future climatic change is especially challenging in coastal regions of the world. The East Coast of the United States falls into this category given the high number of people living along the Atlantic seaboard and the added strain on resources as populations continue to increase, particularly in the Southeast. Increased temperatures, changes in regional precipitation regimes, and potential increased sea level would have a great impact on existing hydrological systems in the region. Six reservoirs in North Carolina discharge into the Pee Dee River, which flows 160 miles through South Carolina to the coastal communities near Myrtle Beach, SC. During the Southeast’s record-breaking drought from 1998 to 2002, salinity intrusions inundated a coastal municipal freshwater intake, limiting water supplies. Salinity intrusion results from the interaction of three principal forces - streamflow, mean tidal water levels, and tidal range. To analyze, model, and simulate hydrodynamic behaviors at critical coastal streamgages along the Atlantic Intracoastal Waterway (AIW) near Myrtle Beach, SC, data-mining techniques were applied to over 20 years of hourly streamflow, coastal water-quality, and water-level data. Artificial neural network (ANN) models were trained to learn the variable interactions that cause salinity intrusions. Streamflow from the 12,700 square-mile Pee Dee River Basin that flows into the AIW are input to the model as time-delayed variables and accumulated tributary inflows. Tidal inputs to the models were obtained by decomposing tidal water-level data into a “periodic” signal of tidal range and a “chaotic” signal of mean water levels. The ANN models were able to convincingly reproduce historical behaviors and generate alternative scenarios of interest. To evaluate the impact of climate change on salinity intrusion, inputs of streamflows and mean tidal water levels were modified to incorporate estimated

  10. Relationship between Erythrocyte Fatty Acid Composition and Psychopathology in the Vienna Omega-3 Study.

    Directory of Open Access Journals (Sweden)

    Sung-Wan Kim

    Full Text Available This study investigated the relationship between erythrocyte membrane fatty acid (FA levels and the severity of symptoms of individuals at ultra-high risk (UHR for psychosis. Subjects of the present study consisted of 80 neuroleptic-naïve UHR patients. Partial correlation coefficients were calculated between baseline erythrocyte membrane FA levels, measured by gas chromatography, and scores on the Positive and Negative Syndrome Scale (PANSS, Global Assessment of Functioning Scale, and Montgomery-Asberg Depression Rating Scale (MADRS after controlling for age, sex, smoking and cannabis use. Subjects were divided into three groups according to the predominance of positive or negative symptoms based on PANSS subscale scores; membrane FA levels in the three groups were then compared. More severe negative symptoms measured by PANSS were negatively correlated with two saturated FAs (myristic and margaric acids, one ω-9 monounsaturated FA (MUFA; nervonic acid, and one ω-3 polyunsaturated FA (PUFA; docosapentaenoic acid, and were positively correlated with two ω-9 MUFAs (eicosenoic and erucic acids and two ω-6 PUFAs (γ-linolenic and docosadienoic acids. More severe positive symptoms measured by PANSS were correlated only with nervonic acid. No associations were observed between FAs and MADRS scores. In subjects with predominant negative symptoms, the sum of the ω-9 MUFAs and the ω-6:ω-3 FA ratio were both significantly higher than in those with predominant positive symptoms, whereas the sum of ω-3 PUFAs was significantly lower. In conclusion, abnormalities in FA metabolism may contribute to the neurobiology of psychopathology in UHR individuals. In particular, membrane FA alterations may play a role in negative symptoms, which are primary psychopathological manifestations of schizophrenia-related disability.

  11. An Interdisciplinary Approach to Complexity: Migratory Decisions of Iranians in Vienna

    Directory of Open Access Journals (Sweden)

    Julia Czarnowski

    2009-07-01

    Full Text Available Iranians have come to Austria for a multitude of stated reasons. Within this paper the two authors follow their Iranian migrant interviewees' reasoning with two very different styles of analysis, each steaming from a particular scientific background. While Sociologist FLIEGENSCHNEE emphasizes schematic groupings with reference to push and pull factors, for Cultural Anthropologist CZARNOWSKI the interwovenness/interaction of these factors is more important. Together both develop a specific methodology of how to approach interview analysis with regard to migratory decision-making. URN: urn:nbn:de:0114-fqs090396

  12. Neurology in a globalizing world: World Congress of Neurology, Vienna, 2013.

    Science.gov (United States)

    Hachinski, Vladimir

    2013-06-11

    The World Congress of Neurology (figure 1) theme "Neurology in a Globalizing World" acknowledges that science and increasingly medicine and neurology are becoming globalized. The best way to manage change is to shape it. It is becoming increasingly clear that brain diseases, particularly stroke and dementia, are projected to rise at a rate that could overwhelm our clinics and hospitals. Hence a new emphasis on prevention and the need to work across disciplines beyond our traditional roles. Neurologists are the guardians of the brain and need to take the lead role in advancing new approaches in stemming the tide of neurologic diseases.

  13. The First Case(s of Botulism in Vienna in 21 Years: A Case Report

    Directory of Open Access Journals (Sweden)

    Matthias Gerhard Vossen

    2012-01-01

    Conclusion: Both patients went to a general practitioner as well as several specialists before they were sent to and correctly diagnosed at our outpatient department. To avoid long delays between intoxication and diagnosis we think it is crucial to advert to the complex symptoms a nonsevere intoxication with botulinum toxin can produce, especially since intoxications have become rare occurrences in the industrialized societies due to the high quality of industrial food production.

  14. Sustainability as the integration of economics and ethics? Baden, Vienna/Austria

    DEFF Research Database (Denmark)

    Madsen, Erik Kloppenborg

    2000-01-01

    In this study it is argued that the corporate pursuit of sustainability calls forth attitudes in the business world which seem to integrate economic, political and moral issues. The quest for sustainability calls forth reflection and reorientation in business life concerning visions, goals, role...... language, they are not merely saying things but also doing things. By doing things with words, language does not only mirror a certain reality it also has constitutive power....

  15. The CISM Oswatitsch Session in Memory of Klaus Oswatitsch, Vienna, and his Work

    CERN Document Server

    Eschenauer, Hans

    2001-01-01

    This volume provides an up-to-date overview of major advances, emerging trends, and projected industrial applications in the field of multidisciplinary optimization. It concentrates on the current status of the field, exposes commonalities, innovative, promising, and speculative methods. This book provides a view of today’s multidisciplinary optimization environment through a balenced theoretical and practical treatment. The contributors are the foremost authorities in each area of specialisation.

  16. The Dual Listing of Austrian Companies in Vienna and Frankfurt: Dependence Analysis

    OpenAIRE

    Lukasz Gurgul; Sanela Omerovic; Robert Syrek

    2015-01-01

    International capital flows can be hampered by a variety of barriers such as transaction costs, information costs, and legal restrictions. The solution in this situation can be dual listing. The framework of the research presented here assumes that domestic securities are dually listed on a foreign capital market, while none of the foreign securities is dually listed on the domestic capital market. This paper is concerned with a dependence analysis of the log-levels and r...

  17. Geometric methods for estimating representative sidewalk widths applied to Vienna's streetscape surfaces database

    Science.gov (United States)

    Brezina, Tadej; Graser, Anita; Leth, Ulrich

    2017-04-01

    Space, and in particular public space for movement and leisure, is a valuable and scarce resource, especially in today's growing urban centres. The distribution and absolute amount of urban space—especially the provision of sufficient pedestrian areas, such as sidewalks—is considered crucial for shaping living and mobility options as well as transport choices. Ubiquitous urban data collection and today's IT capabilities offer new possibilities for providing a relation-preserving overview and for keeping track of infrastructure changes. This paper presents three novel methods for estimating representative sidewalk widths and applies them to the official Viennese streetscape surface database. The first two methods use individual pedestrian area polygons and their geometrical representations of minimum circumscribing and maximum inscribing circles to derive a representative width of these individual surfaces. The third method utilizes aggregated pedestrian areas within the buffered street axis and results in a representative width for the corresponding road axis segment. Results are displayed as city-wide means in a 500 by 500 m grid and spatial autocorrelation based on Moran's I is studied. We also compare the results between methods as well as to previous research, existing databases and guideline requirements on sidewalk widths. Finally, we discuss possible applications of these methods for monitoring and regression analysis and suggest future methodological improvements for increased accuracy.

  18. 9 CFR 319.180 - Frankfurter, frank, furter, hotdog, weiner, vienna, bologna, garlic bologna, knockwurst, and...

    Science.gov (United States)

    2010-01-01

    ... or snouts; beef, veal, lamb, or goat tripe; beef, veal, lamb, goat, or pork hearts, tongues, fat... Affected, which appears in the Finding Aids section of the printed volume and on GPO Access. ...

  19. The Vienna consensus: report of an expert meeting on the development of ART laboratory performance indicators.

    Science.gov (United States)

    2017-11-01

    This proceedings report presents the outcomes from an international workshop supported by the European Society of Human Reproduction and Embryology (ESHRE) and Alpha Scientists in Reproductive Medicine, designed to establish consensus on definitions and recommended values for Indicators for the assisted reproductive technology (ART) laboratory. Minimum performance-level values ('competency') and aspirational ('benchmark') values were recommended for a total of 19 Indicators, including 12 Key Performance Indicators (KPIs), five Performance Indicators (PIs), and two Reference Indicators (RIs). Copyright © 2017 The Author(s). Published by Elsevier Ltd.. All rights reserved.

  20. OphthalNet Vienna: constructive quality assurance and resource optimization in ophthalmology.

    Science.gov (United States)

    Mitsch, Christoph; Bolz, Matthias; Sacu, Stefan; Vass, Clemens; Scholda, Christoph; Huber, Patrick; Sabutsch, Stefan; Schmidt-Erfurth, Ursula

    2014-01-01

    Significant improvements in the field of diagnostic methods and therapeutic options achieved during the last decade allow the early diagnosis, accurate follow-up and individual indication for the treatment with highly efficacious therapeutic agents in a wide range of ophthalmological pathologies. The burden on health care systems is extremely high, as treatment and diagnostic follow up has to be repeated in a regular manner. Whereas the treatment can only be applied in tertiary care centers (eye clinics), follow-up and management mainly depends on the OCT technology, which is becoming available at many field ophthalmologists' practices. This article describes the OphthalNet project, a network which optimizes collaboration between eye clinics and field ophthalmologists based on medical guidelines, workflow support and the future use of electronic infrastructure.

  1. 75 FR 9013 - Culturally Significant Objects Imported for Exhibition Determinations: “Vienna Circa 1780: An...

    Science.gov (United States)

    2010-02-26

    ... Silver Service Rediscovered'' SUMMARY: Notice is hereby given of the following determinations: Pursuant...: An Imperial Silver Service Rediscovered,'' imported from abroad for temporary exhibition within the...

  2. Cryopreservation of embryos of the Mediterranean fruit fly Ceratitis capitata Vienna 8 Genetic Sexing Strain

    Science.gov (United States)

    The Mediterranean fruit fly, Ceratitis capitata, is one of the most serious pests of fruit crops world-wide. During the last decades, area-wide pest management (AW-IPM) approaches with a sterile insect technique (SIT) component have been used to control populations of this pest in an effective and e...

  3. Enacting governance through strategy:A comparative study on governance configurations in Sydney and Vienna

    OpenAIRE

    Brandtner, Christof; Hollerer, Markus A; Meyer, Renate E.; Kornberger, Martin

    2017-01-01

    Over the past two decades, research has emphasised a shift from city government to urban governance. Such a shift brings about its very own challenges, namely governance gaps, uncertain configurations in governance and a limited capacity to act. In this paper, we argue that the concurrent rise of strategy documents in city administration addresses these challenges. Our central claim is that strategy documents can be understood as a distinct discursive device through whichlocal governments ena...

  4. European Hematology Association - 20th Annual Congress (June 11-14, 2015 - Vienna, Austria).

    Science.gov (United States)

    Croasdell, G

    2015-07-01

    The Annual Congress of the European Hematology Association, now in its 20th year, brought together specialists in all areas of hematology research to present new data on ongoing research and share innovative ideas to aid in the treatment and diagnosis of many hematological diseases. Clinical and translational research was presented along with technological advancement in diagnostics and risk-assessment strategies. The congress afforded attendees time for networking with representatives from many disciplines associated with hematological research, including academia, industry and patient advocacy groups. This report will cover the most interesting presentations relating to therapeutics for a range of hematological conditions. Copyright 2015 Prous Science, S.A.U. or its licensors. All rights reserved.

  5. International Conference on Rett Syndrome (4th, Vienna, Austria, October 2-5, 1986). Synopsis.

    Science.gov (United States)

    Percy, Alan

    Presentations from speakers at a conference on Rett Syndrome are summarized. The presentations focused on Rett Syndrome's genetic basis and identification as a clinical syndrome, involving, among other things, mental subnormality, epilepsy, infantile spasms, hand stereotypes, and poor hand use. Also discussed were: Rett Syndrome's predictive…

  6. Neutron dosimetry and damage calculations for the TRIGA MARK-II reactor in Vienna

    Science.gov (United States)

    Weber, H. W.; Böck, H.; Unfried, E.; Greenwood, L. R.

    1986-02-01

    In order to improve the source characterization of the reactor, especially for recent irradiation experiments in the central irradiation thimble, neutron activation experiments were made on 16 nuclides and the neutron flux spectrum was adjusted using the computer code STAY'SL. The results for the total, thermal and fast neutron flux density at a reactor power of 250 kW are as follows: 2.1 × 10 17, 6.1 × 10 16 ( E 0.1 MeV) and 4.0 × 10 16 ( E > 1 MeV) m -2 s -1. respectively. Calculated damage energy cross sections and gas production rates are presented for selected elements.

  7. Instruments and demonstrations in the astrological curriculum: evidence from the University of Vienna, 1500-1530.

    Science.gov (United States)

    Hayton, Darin

    2010-06-01

    Historians have used university statutes and acts to reconstruct the official astrology curriculum for students in both the arts and medical faculties, including the books studied, their order, and their relation to other texts. Statutes and acts, however, cannot offer insight into what actually happened during lectures and in the classroom: in other words, how and why astrology was taught and learned in the medieval university. This paper assumes that the astrology curriculum is better understood as the set of practices that constituted it and gave it meaning for both masters and students. It begins to reconstruct what occurred in the classroom by drawing on published and unpublished lecture notes. These offer insight into how masters presented the material as they did, and why. The paper argues three points: first, the teaching of astrology centered on demonstrations involving astrological instruments: specifically, various kinds of paper astrolabes. Second, the astrological instruction focused on conveying the pragmatics of astrology rather than esoteric, theoretical issues. Finally, astrology as it was taught in the arts curriculum was explicitly intended to provide a foundation for students who would advance to study medicine at the university.

  8. Viini (t)ööelust = On work and (night)life in Vienna / Johan Tali

    Index Scriptorium Estoniae

    Tali, Johan

    2012-01-01

    Vaadeldakse noortele loomeinimestele kuuluvaid stuudiokodusid ja ateljeesid Viinis (Atelier Madame Mohr, Büro für Mehr jt.), noorte arhitektide loometegevust pärast tööpäeva suurtes arhitektuuribüroodes. Eesmärgiks on oma oskuste ja töömeetodite arendamine. Uutest büroomudelitest

  9. Commercial sales: the Common European Sales Law compared to the Vienna Sales Convention

    NARCIS (Netherlands)

    Loos, M.B.M.; Schelhaas, H.

    2013-01-01

    If the Common European Sales Law (CESL) is adopted, commercial parties will have the opportunity to choose between two international legal instruments for the regulation of their international commercial sales contracts. Whereas CESL is available to both consumer and commercial sales contracts, the

  10. Measurement of CO{sub 2} and N{sub 2}O at nanomolar amounts using continuous-flow isotope-ratio mass spectrometry (CF-IRMS)

    Energy Technology Data Exchange (ETDEWEB)

    Patel, A; Downie, S.; Webster, E.; Hopkins, D.W.; Rennie, M.J. [Univ. of Dundee (United Kingdom)

    1994-12-01

    We are currently developing methods using Continuous Flow Isotope Ratio Mass Spectrometry (CF-IRMS) in conjunction with a thermal desorption purification unit to measure nanomolar levels of C0{sub 2} and N{sub 2}0. Samples of the pure gases diluted in He/air and transferred to septum capped Exetainers (Labco) provided a simple means to investigate the technique. We analyzed C0{sub 2} at natural abundance in the concentration range 50 to 5 nmoles and N{sub 2}0 at two concentrations between 25 and 5 nmoles. The technique was then used to measure C0{sub 2} (natural abundance and {sup 13}C-labeled) generated from the ninhydrin reaction. The results are summarized in a table; values are expressed in delta {sup 13}C notation relative to Pee Dee Belemnite. The data show that, provided care is taken to minimize or eliminate sources of contamination (air leaks, etc.), CF-IRMS coupled with a thermal desorption unit permits measurement of {sup 13}C enrichment in much smaller amounts of isolated amino acids than has been possible until now. The new methodology, including thermal desorption, should allow stable-isotope investigations on much smaller samples than are possible with other currently available techniques-while maintaining high precision.

  11. Water potential and starvation stress in deep subsurface microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Kieft, T.L.; Rosacker, L.L.; Willcox, D.; Franklin, A.J.

    1990-01-01

    Nine intact core samples, collected aseptically from depths of 10--436 m near the Savannah River Plant in South Carolina, were tested for water potential, microbial numbers, and microbial activity. Although all samples were collected from below the water table, two samples (a Pee Dee clay from 238 m and a Middendorf clay from 324 m) showed unsaturated conditions ({minus}2.7 and {minus}2.1 MPa, respectively). Both of these samples had very low numbers of culturable cells, low microbial biomass (ATP assay), and low microbial activities (measured as respiration), suggesting that low metric waterpotentials in these strata are limiting factors to microorganisms. An Acinetobacter sp. isolated from the 324 m depth was found to maintain viability under starvation conditions in sterilized aquifer material, even when subjected to severe desiccation ({minus}22 MPa). A Pseudomonas sp., with the ability to oxidize thiosulfate to sulfate, was isolated from the 378 m Middendorf clay sample. This organism survived nutrient deprivation reasonably well; however, the presence of thiosulfate appeared to interfere with its normal ability to maintain viability by endogenous metabolism. Cells cultured in the presence of thiosulfate did not undergo dwarfing and cell viability declines. These are two examples of indigenous subsurface microorganisms, each with different adaptations for long-term survival under conditions of desiccation and/or starvation.

  12. Water potential and starvation stress in deep subsurface microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Kieft, T.L.; Rosacker, L.L.; Willcox, D.; Franklin, A.J.

    1990-12-31

    Nine intact core samples, collected aseptically from depths of 10--436 m near the Savannah River Plant in South Carolina, were tested for water potential, microbial numbers, and microbial activity. Although all samples were collected from below the water table, two samples (a Pee Dee clay from 238 m and a Middendorf clay from 324 m) showed unsaturated conditions ({minus}2.7 and {minus}2.1 MPa, respectively). Both of these samples had very low numbers of culturable cells, low microbial biomass (ATP assay), and low microbial activities (measured as respiration), suggesting that low metric waterpotentials in these strata are limiting factors to microorganisms. An Acinetobacter sp. isolated from the 324 m depth was found to maintain viability under starvation conditions in sterilized aquifer material, even when subjected to severe desiccation ({minus}22 MPa). A Pseudomonas sp., with the ability to oxidize thiosulfate to sulfate, was isolated from the 378 m Middendorf clay sample. This organism survived nutrient deprivation reasonably well; however, the presence of thiosulfate appeared to interfere with its normal ability to maintain viability by endogenous metabolism. Cells cultured in the presence of thiosulfate did not undergo dwarfing and cell viability declines. These are two examples of indigenous subsurface microorganisms, each with different adaptations for long-term survival under conditions of desiccation and/or starvation.

  13. Phytoplankton and nutrient dynamics in Winyah Bay, SC.

    Science.gov (United States)

    Boneillo, G. E.; Brooks, S. S.; Brown, S. L.; Woodford, K. M.; Wright, C. R.

    2016-02-01

    Winyah Bay is a coastal plain estuary located in South Carolina that has been classified for a moderate risk of Eutrophication by NOAA. Winyah Bay receives freshwater input from four rivers, the Waccamaw, Sampit, Black, and Pee Dee Rivers. The Waccamaw, Sampit and Black River are blackwater systems that discharge elevated amounts of colored dissolved organic matter. During the summer and fall of 2015, bioassay experiments were performed to simultaneously examine both light and nutrient (nitrogen & phosphate) limitation throughout Winyah Bay. Sampling stations near the mouth of the Waccamaw and Sampit Rivers showed that phytoplankton were light limited in the late summer instead of nutrient limited. These stations were located in the industrialized area of the bay and typically had the highest nutrient concentrations and highest turbidity, with Secchi depths typically less than 0.5 meters. Results indicated that phytoplankton may be nitrogen limited near the mouth of Winyah Bay, where nutrient concentrations and turbidity were observed to be lower than locations further upstream. There was also an observed dissolved oxygen and pH gradient during the summer of 2015. Dissolved oxygen levels less than 4.0 mg/L were routinely observed near the industrialized head of the estuary and corresponded with lower pH values.

  14. Proceedings of the European ISTVS Conference (6th) , OVK Symposium (4th), On ’Off Road Vehicles in Theory and Practice’ , Held at Vienna, Austria on 28-30 September 1994 in Vienna, Austria. Volume 1.

    Science.gov (United States)

    1994-09-30

    the selection of an optimum configuration for a new, high-mobility version of an armoured vehicle (ASCOD) for a Spanish vehicle manufacturer ( Empresa ...asphalt road. Thus we all are familiar with the effect resulting from this: above all with the front axle lock actuated the vehicle shows an extreme...Ko) (2) The implications of these assumptions are illustrated in Fig. 1(a) which shows the familiar three-dimensional plot of critical state space

  15. Differential mortality patterns from hydro-meteorological disasters: Evidence from cause-of-death data by age and sex. Vienna Yearbook of Population Research|Vienna Yearbook of Population Research 2015|

    OpenAIRE

    Zagheni, Emilio; Striessnig, Erich; Muttarak, Raya

    2016-01-01

    This paper evaluates the heterogeneous impact of hydro-meteorological disasters on populations along the dimensions of age, sex, and human development. The analysis is based on previously untapped cause-of-death data over the period 1995– 2011 that were obtained from the WHO mortality database, and were based on the civil registration records of 63 countries/territories. Using these data, we evaluate patterns of mortality related to meteorological disasters in the spirit of model life tables....

  16. Observations of taxa of Melosira sensu lato among the slides from the Grunow Diatom Collection in Vienna (Austria). Part 1

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; Klee, R.; Passauer, U.

    2007-01-01

    Roč. 22, č. 1 (2007), s. 57-80 ISSN 0269-249X R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Keywords : diatom s * taxonomy * revision Subject RIV: EF - Botanics Impact factor: 0.673, year: 2007

  17. Between history, art and medicine: the Dresden-Friedrichstadt hospital, its Neptune fountain and connections to Vienna.

    Science.gov (United States)

    Wollina, Uwe; Hunger, Sabine; Koch, André; França, Katlein; Lotti, Torello; Fioranelli, Massimo; Roccia, Maria Grazia

    2017-10-01

    The Dresden-Friedrichstadt hospital originated from Marcolini's summer palace. It was founded in 1845 and opened in 1849. It is a place where history and art of European importance mixes with technical and medical innovations. We reflect on the meetings of Napoleon Bonaparte and Metternich in 1812, the creation of the famous Neptune fountain by Longuelune and Matielli and two outstanding physicians of the 19th century, the surgeon Eduard Zeis, who coined the medical term "plastic surgery", and Maximilian Nitze, inventor of the first "modern" cystoscope and the father of urology.

  18. Seasonality of New Particle Formation in Vienna, Austria - Influence of Air Mass Origin and Aerosol Chemical Composition

    Czech Academy of Sciences Publication Activity Database

    Wonaschütz, A.; Demattio, A.; Wagner, R.; Burkart, J.; Zíková, Naděžda; Vodička, Petr; Ludwig, W.; Steiner, G.; Schwarz, Jaroslav; Hitzenberger, R.

    2015-01-01

    Roč. 118, OCT 2015 (2015), s. 118-126 ISSN 1352-2310 R&D Projects: GA MŠk 7AMB12AT021; GA ČR(CZ) GBP503/12/G147 Grant - others:FWF(AT) P19515-N20 Institutional support: RVO:67985858 Keywords : urban aerosol * aerosol chemical composition * new particle formation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.459, year: 2015

  19. Tests of a new CCD-camera based neutron radiography detector system at the reactor stations in Munich and Vienna

    Energy Technology Data Exchange (ETDEWEB)

    Lehmann, E.; Pleinert, H. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Schillinger, B. [Technische Univ. Muenchen (Germany); Koerner, S. [Atominstitut der Oesterreichischen Universitaeten, Vienna (Austria)

    1997-09-01

    The performance of the new neutron radiography detector designed at PSI with a cooled high sensitive CCD-camera was investigated under real neutronic conditions at three beam ports of two reactor stations. Different converter screens were applied for which the sensitivity and the modulation transfer function (MTF) could be obtained. The results are very encouraging concerning the utilization of this detector system as standard tool at the radiography stations at the spallation source SINQ. (author) 3 figs., 5 refs.

  20. ["Dr Breuer will care for him with utmost attention." A plan for Nietzsche's neuropathological treatment in Vienna].

    Science.gov (United States)

    Müller-Buck, Renate

    2007-01-01

    This essay is about a plan for the treatment of Friedrich Nietzsche by Josef Breuer in the spring of 1878. The plan was developed by Siegfried Lipiner, a philosphy student from Galicia and an admirer of Nietzsche, who was acquainted with Breuer as well as with Freud. Lipiner was convinced that Nietzsche could be treated by the Viennese specialists and tried his best to arrange this. However all his endeavors were frustrated by the opposition of Nietzsche's advisors in Basel, as well as his docters, and ultimately of Nietzsche himself who preferred the cold-water therapy in Baden-Baden.

  1. Clinical outcome of Crohn's disease according to the Vienna classification: disease location is a useful predictor of disease course

    NARCIS (Netherlands)

    Oostenbrug, Liekele E.; van Dullemen, Hendrik M.; te Meerman, Gerard J.; Jansen, Peter L. M.; Kleibeuker, Jan H.

    2006-01-01

    OBJECTIVES: Crohn's disease (CD) is a complex genetic disease with multiple clinical patterns. Clinical classifications may help to identify subgroups of patients that have a distinct pattern of disease, and they are also a prerequisite for the conduction of genetic and therapeutic studies. The aim

  2. A simple classification of Crohn's disease: report of the Working Party for the World Congresses of Gastroenterology, Vienna 1998

    NARCIS (Netherlands)

    Gasche, C.; Scholmerich, J.; Brynskov, J.; D'Haens, G.; Hanauer, S. B.; Irvine, E. J.; Jewell, D. P.; Rachmilewitz, D.; Sachar, D. B.; Sandborn, W. J.; Sutherland, L. R.

    2000-01-01

    Crohn's disease is a heterogeneous entity. Previous attempts of classification have been based primarily on anatomic location and behavior of disease. However, no uniform definition of patient subgroups has yet achieved broad acceptance. The aim of this international Working Party was to develop a

  3. A simple classification of Crohn's disease: report of the Working Party for the World Congresses of Gastroenterology, Vienna 1998.

    Science.gov (United States)

    Gasche, C; Scholmerich, J; Brynskov, J; D'Haens, G; Hanauer, S B; Irvine, E J; Jewell, D P; Rachmilewitz, D; Sachar, D B; Sandborn, W J; Sutherland, L R

    2000-02-01

    Crohn's disease is a heterogeneous entity. Previous attempts of classification have been based primarily on anatomic location and behavior of disease. However, no uniform definition of patient subgroups has yet achieved broad acceptance. The aim of this international Working Party was to develop a simple classification of Crohn's disease based on objective variables. Eight outcome-related variables relevant to Crohn's disease were identified and stepwise evaluated in 413 consecutive cases, a database survey, and by clinical considerations. Allocation of variables was conducted with well-defined Crohn's disease populations from Europe and North America. Cross-table analyses were performed by chi-square testing. Three variables were finally elected: Age at Diagnosis [below 40 years (A1), equal to or above 40 years (A2)], Location [terminal ileum (L1), colon (L2), ileocolon (L3), upper gastrointestinal (L4)], and Behavior [nonstricturing nonpenetrating (B1), stricturing (B2), penetrating (B3)]. The allocation of patients to these 24 subgroups proved feasible and resulted in specific disease clusters. Cross-table analyses revealed associations between Age at Diagnosis and Location, and between Behavior and Location (all p definitions to categorize Crohn's patients into 24 subgroups. Operational guidelines should be used for the characterization of patients in clinical trials as well as for correlation of particular phenotypes with putative biologic markers or environmental factors.

  4. Resettling the Thoughts of Ernst Mach and the Vienna Circle in Europe: The Cases of Finland and Germany

    Science.gov (United States)

    Siemsen, Hayo; Siemsen, Karl Hayo

    2009-04-01

    Although it is generally assumed that the thoughts of Ernst Mach and the scientific fields he influenced (in this case psychophysics and Gestalt psychology) emigrated from Europe during Second World War they apparently survived in Finland, influencing the Finnish education system. The following article evaluates this relationship and its implications from a historical and an empirical perspective. In empirical studies comparing the education systems of different countries, such as PISA, the Finns are in general regarded as being very successful with their school system. Does this apparent success have anything to do with a Machian influence? Our current research has so far revealed that the Finns have gone through an independent cultural development in two specific aspects: in the idea of the development of the individual personality (Snellman) and in a specific phenomenalism (developed primarily by Eino Kaila, in which Kaila was heavily influenced in this by Ernst Mach). The result can be regarded as a nation-wide “Experiment”, the empirical evaluation of which can be found partly in the statistics of the PISA Studies, especially the evaluation of Finland in relation to other countries.

  5. Resettling the Thoughts of Ernst Mach and the Vienna Circle in Europe: The Cases of Finland and Germany

    Science.gov (United States)

    Siemsen, Hayo; Siemsen, Karl Hayo

    2009-01-01

    Although it is generally assumed that the thoughts of Ernst Mach and the scientific fields he influenced (in this case psychophysics and "Gestalt" psychology) emigrated from Europe during Second World War they apparently survived in Finland, influencing the Finnish education system. The following article evaluates this relationship and…

  6. International Symposium on Positive Strand RNA Viruses (2nd) Held in Vienna, Austria on June 26-30, 1989. Abstracts

    Science.gov (United States)

    1989-07-01

    e n mntaqe(nesIs ctenns-otes that eac-h of thc- nnsec-rid sroe-mI Jlfcc-tene- celatve to thin pliat agents.. tonIchs in ttce 104 acid 94 icC proteinas ...passage in several plant hosts. One -t - -. u r t I l i - -u c h O l RNA , d e riv e d d u r in g t oe ic o n s e c uiitlcu hig h m e vi . "naly...Sodepenhent cODA clones vade 1: g , -N ttiis NI RNA are rolioear deletion matants ol the h Snper viraus c onsisting6 of s e qoene fIrom hotInh te 5S "I cr

  7. Wat op dees (van aarde beteken die einde van tradisionele metafisiese taal oor God? In gesprek met die Nuwe-Testamentikus Andries Gideon van Aarde oor sy verstaan van ‘n postsekulêre spiritualiteit

    Directory of Open Access Journals (Sweden)

    Daniël P. Veldsman

    2011-06-01

    Full Text Available What does the end of traditional metaphysical language about God mean? In conversation with New Testament scholar Andries Gideon van Aarde on his understanding of a postsecular spiritualitySouth African New Testament scholar Van Aarde’s explorative search for a new direction in theological reflection is explicated in this article with reference to his discussion of Peter Berger and Charles Taylor’s contemporary contributions, which Van Aarde takes as vantage point to articulate the meaning of his ‘courage to be a religious person today’. The articulation of his ‘courage’ to pursue a post-theistic understanding of a contemporary Christian religiosity (read: spirituality that is non-fundamentalistic, non-populist and post-secular is discussed. At the same time, the basic tenets of his explorations are indicated, being constituted – negatively – by a de-centering of the power of institutional religion and, positively, by the enchantment of a Biblical hermeneutics that does not emphasise a proposition-like and moral code-like reading strategy. Finally, his ‘new direction’, which finds expression in the articulation of a ‘spirituality of living faith’, is scrutinised. It exposes the shortcomings in his (individualistic exposition within the new correlation of modernisation and pluralism, causing it subsequently to bypass the necessary contemporary outcome in social embodiment.

  8. Managing pre-eclampsia and eclampsia in Dar es Salaam public ...

    African Journals Online (AJOL)

    Introduction: Severe pre-eclampsia and eclampsia (PE/E) is associated with high maternal and neonatal morbidity and mortality. Early detection and treatment of pre-eclampsia may prevent progression to severe PE/E. When severe PE/E occurs, timely use of anticonvulsants and antihypertensives (as part of emergency ...

  9. Morphological and molecular confirmation of Myxobolus cerebralis myxospores infecting wild‑caught and cultured trout in North Carolina (SE USA).

    Science.gov (United States)

    Ruiz, Carlos F; Rash, Jacob M; Arias, Cova R; Besler, Doug A; Orélis-Ribeiro, Raphael; Womble, Matthew R; Roberts, Jackson R; Warren, Micah B; Ray, Candis L; Lafrentz, Stacey; Bullard, Stephen A

    2017-11-21

    We used microscopy and molecular biology to provide the first documentation of infections of Myxobolus cerebralis (Myxozoa: Myxobolidae), the etiological agent of whirling disease, in trout (Salmonidae) from North Carolina (USA) river basins. A total of 1085 rainbow trout Oncorhynchus mykiss, 696 brown trout Salmo trutta, and 319 brook trout Salvelinus fontinalis from 43 localities across 9 river basins were screened. Myxospores were observed microscopically in pepsin-trypsin digested heads of rainbow and brown trout from the Watauga River Basin. Those infections were confirmed using the prescribed nested polymerase chain reaction (PCR; 18S rDNA), which also detected infections in rainbow, brown, and brook trout from the French Broad River Basin and the Yadkin Pee-Dee River Basin. Myxospores were 9.0-10.0 µm (mean ± SD = 9.6 ± 0.4; N = 119) long, 8.0-10.0 µm (8.8 ± 0.6; 104) wide, and 6.0-7.5 µm (6.9 ± 0.5; 15) thick and had polar capsules 4.0-6.0 µm (5.0 ± 0.5; 104) long, 2.5-3.5 µm (3.1 ± 0.3; 104) wide, and with 5 or 6 polar filament coils. Myxospores from these hosts and rivers were morphologically indistinguishable and molecularly identical, indicating conspecificity, and the resulting 18S rDNA and ITS-1 sequences derived from these myxospores were 99.5-100% and 99.3-99.8% similar, respectively, to published GenBank sequences ascribed to M. cerebralis. This report comprises the first taxonomic circumscription and molecular confirmation of M. cerebralis in the southeastern USA south of Virginia.

  10. Towards absolute laser spectroscopic CO2 isotope ratio measurements

    Science.gov (United States)

    Anyangwe Nwaboh, Javis; Werhahn, Olav; Ebert, Volker

    2017-04-01

    Knowledge of isotope composition of carbon dioxide (CO2) in the atmosphere is necessary to identify sources and sinks of this key greenhouse gas. In the last years, laser spectroscopic techniques such as cavity ring-down spectroscopy (CRDS) and tunable diode laser absorption spectroscopy (TDLAS) have been shown to perform accurate isotope ratio measurements for CO2 and other gases like water vapour (H2O) [1,2]. Typically, isotope ratios are reported in literature referring to reference materials provided by e.g. the International Atomic Energy Agency (IAEA). However, there could be some benefit if field deployable absolute isotope ratio measurement methods were developed to address issues such as exhausted reference material like the Pee Dee Belemnite (PDB) standard. Absolute isotope ratio measurements would be particularly important for situations where reference materials do not even exist. Here, we present CRDS and TDLAS-based absolute isotope ratios (13C/12C ) in atmospheric CO2. We demonstrate the capabilities of the used methods by measuring CO2 isotope ratios in gas standards. We compare our results to values reported for the isotope certified gas standards. Guide to the expression of uncertainty in measurement (GUM) compliant uncertainty budgets on the CRDS and TDLAS absolute isotope ratio measurements are presented, and traceability is addressed. We outline the current impediments in realizing high accuracy absolute isotope ratio measurements using laser spectroscopic methods, propose solutions and the way forward. Acknowledgement Parts of this work have been carried out within the European Metrology Research Programme (EMRP) ENV52 project-HIGHGAS. The EMRP is jointly funded by the EMRP participating countries within EURAMET and the European Union. References [1] B. Kühnreich, S. Wagner, J. C. Habig,·O. Möhler, H. Saathoff, V. Ebert, Appl. Phys. B 119:177-187 (2015). [2] E. Kerstel, L. Gianfrani, Appl. Phys. B 92, 439-449 (2008).

  11. The genetic and phenotypic variability of interspecific hybrid bermudagrasses (Cynodon dactylon (L.) Pers. × C. transvaalensis Burtt-Davy) used on golf course putting greens.

    Science.gov (United States)

    Reasor, Eric H; Brosnan, James T; Trigiano, Robert N; Elsner, J Earl; Henry, Gerald M; Schwartz, Brian M

    2016-10-01

    Some interspecific hybrid bermudagrass cultivars used on golf course putting greens are genetically unstable, which has caused phenotypically different off-type grasses to occur in production nurseries and putting surfaces. Management practices to reduce the occurrence of off-type grasses in putting green surfaces and the effect they can have on putting quality and performance need to be researched until genetically stable cultivars are developed. Golf course putting green surfaces in subtropical and tropical climates are typically planted with an interspecific hybrid bermudagrass (Cynodon dactylon (L.) Pers. × C. transvaalensis Burtt-Davy), because of the superior putting quality and performance of these cultivars. 'Tifgreen' was one of the first interspecific hybrids developed for putting green use in lieu of common bermudagrass. However, off-type grasses began appearing in established Tifgreen stands soon after commercial release. Off-type grasses are those with different morphology and performance when compared to the surrounding, desirable cultivar. Off-types have the potential to decrease surface uniformity, which negatively affects putting surface quality. However, several unique off-types from Tifgreen have been selected as commercial cultivars, the first being 'Tifdwarf'; then 'Floradwarf', 'MS-Supreme', 'Pee Dee-102', and 'TL-2', identified later. The cultivars 'Champion Dwarf', 'P-18', 'RJT', and 'Emerald Dwarf' were subsequently selected as off-types in Tifdwarf. The naturally occurring off-types and cultivars that have been identified within the Tifgreen family have widely differing phenotypes; however, they are reported to be genetically similar, supporting the hypothesis that their occurrence is a result of somatic mutations. Genetic instability in currently available commercial cultivars is likely to lead to the continued presence of off-types in production nurseries and putting greens. Additional research is needed to understand the nature of

  12. The relationship between basal metabolic rate and daily energy expenditure in birds and mammals

    NARCIS (Netherlands)

    Ricklefs, RE; Konarzewski, M; Daan, S

    We examined the relationship between daily energy expenditure (DEE) and basal metabolic rate (BMR) in birds and mammals. Two models of the relationship between DEE and BMR were distinguished: a ''shared pathways'' model in which DEE replaces BMR in the active organism and a ''partitioned pathways''

  13. Preeclampsia-Eclampsia Adverse Outcomes Reduction: The Preeclampsia-Eclampsia Checklist

    Directory of Open Access Journals (Sweden)

    Oroma B. Nwanodi

    2016-05-01

    Full Text Available Globally, preeclampsia-eclampsia (PE-E is a major cause of puerperal intensive care unit admission, accounting for up to 10% of maternal deaths. PE-E primary prevention is possible. Antepartum low-dose aspirin prophylaxis, costing USD $10–24 can cut the incidence of PE-E in half. Antepartum low molecular weight heparin combined with low-dose aspirin prophylaxis can cut the incidence of early onset PE-E and fetuses that are small for their gestational age in half. Despite predictive antepartum models for PE-E prophylaxis, said prophylaxis is not routinely provided. Therefore, magnesium sulfate secondary prevention of eclampsia remains the globally recommended intervention. Implementation of a PE-E checklist is a continuous quality improvement (CQI tool facilitating appropriate antepartum PE-E prophylaxis and maternal care from the first trimester through the postpartum fourth trimester inter-partum interval. A novel clinical PE-E checklist and implementation strategy are presented below. CQI PE-E checklist implementation and appropriate PE-E prophylaxis provides clinicians and healthcare systems an opportunity to achieve Millennium Development Goals 4 and 5, reducing child mortality and improving maternal health. While CQI checklist implementation may be a tedious ongoing process requiring healthcare team resiliency, improved healthcare outcomes are well worth the effort.

  14. Proceedings of the Annual Precise Time and Time Interval (PTTI) Applications and Planning Meeting (22nd) Held in Vienna, Virginia on 4-6 Dec 1990

    Science.gov (United States)

    1991-05-01

    with another submarine fiber optic cable CARAC . The CARAC cable interconnects with Tortola in the British Virgin Islands and from there south to...TransAtlantic Cable, PTAT -1, and the Bermuda to Tortola cable, CARAC . Efficient restoration via satellite for such systems is of paramount importance

  15. Search for narrow diquonium states in pi /sup -/p interactions at 10 GeV/c Bari-Bonn-CERN-Daresbury-Glasgow-Liverpool-Milano-Vienna Collaboration

    CERN Document Server

    Evangelista, C; Best, C; Costa, G; Donald, R; Edwards, D N; French, Bernard R; Ghidini, B; Houlden, M A; Hughes, I; Lewis, G M; Mandelli, L; Mättig, P; Mitaroff, W A; Müller, K; Palano, A; Palazzi-Cerrina, C; Paul, E; Pensotti, S; Perini, L; Smith, I L; Strub, R; Tamborini, M; Thompson, A S; Turnbull, R; Zito, G

    1981-01-01

    Narrow diquonium production in the reactions pi /sup -/p to p pi p pi /sup -/pp, p pi /sup -/p pi /sup +/ and p pi /sup 0/ is investigated in a 5.3 ev/nb experiment performed at the Omega Spectrometer. The computed upper limits are compared with the predictions of the Chan- Hogaasen model, (1977). (22 refs).

  16. The Role of Knowledge, Social Norms, and Attitudes toward Organic Products and Shopping Behavior: Survey Results from High School Students in Vienna

    Science.gov (United States)

    Gotschi, Elisabeth; Vogel, Stefan; Lindenthal, Thomas; Larcher, Manuela

    2010-01-01

    In 2005 a survey was used to investigate social norms and attitudes of Viennese high school students (14-20 years, n = 340) toward organic products. Young people, who already participate in household decisions and consume organic products, have not yet been recognized sufficiently in research. The Theory of Reasoned Action and discriminant…

  17. Una classificazione gerarchica di dati geolinguistici tratti dall'AIS. Saggio di dialettometria dendrografica : collaborazione informatica: Erasmus Langer (Università Politecnica di Vienna

    Directory of Open Access Journals (Sweden)

    Hans Goebl

    1991-12-01

    Full Text Available Lo strumento euristico classico della classificazione gerarchica è l'albero (chiamato anche in modo più specialistico: grafo arborescente. La struttura ramificata dell'albero con una molteplicità di foglie, ramoscelli erami rispetto alla radice unica - poli tra i quali si inserisce uno spazio di dipendenze gerarchiche ben articolate - costituisce una rappresentazione metaforicamente molto valida per la descrizione dei risultati di qualsiasi processo evolutivo. Ora si sa che ogni evoluzione procede mediante ramificazioni, biforcazioni o frammentazioni consecutive e che nascono cosi vari raggruppamenti in classi (gruppi, unità ecc., tra i quali esistono sempre determinate dipendenze o relazioni. La lista delle scienze che si sono avvalse dell'albero in quanto mezzo euristico è lunga: oltre la zoologia, lapaleontologia, la genetica e tante altre discipline biologiche figurano anche discipline antropiche e sociali, tra cui anche la linguistica. Enoto che l'albero genealogico viene adoperato in sede linguistica sin dai tempi di August SCHLEICHER (1863. L'uso dell'albero per scopi linguistici è sempre rimasto tuttavia alquanto problematico. In effetti, lo strumento euristico "albero" offre particolari condizioni di applicazione, che fino ad oggi non sono state sufficentemente discusse. E' così rimasta, tra la stragrande maggioranza dei linguisti, una più o meno diffusa sfiducia rispetto all'albero. Cf. a questo proposito la buona documentazione storica di STEWART 1976.

  18. Flow, simulation and dynamics. Including a contribution of Vienna University (TU Wien); Stroemung, Simulation und Dynamik. Mit einem Beitrag der TU Wien

    Energy Technology Data Exchange (ETDEWEB)

    Kauder, K. [ed.

    1998-12-31

    This report covers the following topics: Gas-flow through clearances in screw vacuum pumps - part 1, gas flow research at a plane screw type machine model - part 2, two-phase screw-type engine - problems of the filling process, oil as a design parameter in screw-type engines - use of non-newtonian oils, experimental determination of the dynamic properties of screw compressors, hot gas screw-type engine - simulations as a basis for construction - part 3. [Deutsch] Dieser Bericht hat folgende Inhalte: Gasspaltstroemungen in Schraubenspindel-Vakuumpumpen - Teil 1, Gasspaltstroemungen in einem ebenen Schraubenmaschinenmodell - Teil 2, Zweiphasen-Schraubenmotor-Probleme des Fuellungsvorganges, Oel als Konstruktionselement - Einsatz nicht-newtonscher Oele, die experimentelle Bestimmung der dynamischen Eigenschaften von Schraubenkompressoren, die Heissgasschraubenmaschine - simulationsgestuetzte Auslegung - Teil 3

  19. The Royal Natural History Collection in Vienna (18th century): from possessing minerals as a private treasure towards territorial ambitions as consciousness

    NARCIS (Netherlands)

    Klemun, M.

    2004-01-01

    This paper deals with a famous private natural history collection of the court, transformed to a public collection of the state. Associated is a very important question: how cultural and political structures became a dimension of a collection. In order to establish a Court Natural History Cabinet of

  20. [Franz Coelestin Ritter von Schneider-Vienna's first medical chemist and teacher of the first Austrian hygienists. The 200th anniversary of his birthday].

    Science.gov (United States)

    Flamm, Heinz

    2013-01-01

    Franz Schneider (13.09.1812-29.11.1897) in 1850 was appointed the first lecturer on "Chemistry for physicians" by the Viennese university. Two years later he accepted the professorship in the military medical schools in the "Josephinum" from where he shifted to the philosophical faculty as professor of "Common and medical chemistry". Soon after this start in 1870 he became unable to continue his work because of an explosion during experiments. Thus in 1876 the emperor called Schneider to the Austrian public health administration as director. In the following twelve years he achieved great successes in his duties. As a scientist he had worked on various topics of organic and inorganic chemistry. But beyond that Schneider succeeded in imparting to his assistants the modality of scientific work and the way of hygienic thinking. Thus his scholars Josef Nowak, Florian Kratschmer and Max Gruber were well prepared to become Austria's first university hygienists.

  1. Proceedings of the Annual Precise Time and Time Interval (PTTI) applications and Planning Meeting (20th) Held in Vienna, Virginia on 29 November-1 December 1988

    Science.gov (United States)

    1988-12-01

    I beseech you to envision, if you can, the full magnitude of our intellectual limitations. Following the eminent example set by Socrates 2400 years...must continue with his lifelong professional education but should also sometimes start with Plato if one is an engineer, and with a course in science

  2. Die Bibliothek ohne Bibliothekar? Zur Situation der Patientenbüchereien in Wien / The Library without a Librarian? The Situation of the Patient Libraries in Vienna

    Directory of Open Access Journals (Sweden)

    Jany, Elke

    2005-12-01

    Full Text Available Libraries for patients fulfil apart from health-specific tasks politico-cultural functions too. However, substantial savings in the health service sector affect also these institutions vital for the recovery of patients. The present work offers an overview on the libraries in the Viennese hospitals with respect to new tasks and challenges that librarians must face; and it demonstrates the different conditions for private as well as public hospitals.

  3. The American Code, the Vienna Code and the resolutions of the Imperial Botanical Conference in London. Will agreement be possible in 1930?

    NARCIS (Netherlands)

    Valckenier Suringar, J.

    1929-01-01

    „The two codes have been a great help in stabilizing nomenclature. Experience has shown, however, that they lack definiteness in directing the application of names ...” (HITCHCOCK in Am. Journ. of Bot. May 1921 p. 251). „A harmonizing of the two codes appears to be impossible, if it is maintained

  4. Features of surfaces with random structure variations: Poster at Strategic Workshop "Principles and Development of Bio-Inspired Materials", 13 - 15 April 2010; Vienna, Austria

    OpenAIRE

    Mölders, N.; Nellesen, A.; Bertling, J.

    2010-01-01

    In contrast to the precision requested in industrial processing, biological structures only seem to possess a perfect, uniform regularity. Within the recurring patterns and periodic self-similar structures a randomly acting variation appears to be present. The main goal of this work is to elucidate whether these variations are irrelevant or related to the particular functionality of a surface or if they are just a result of stimulus- environmental interaction and genetical predisposition. The...

  5. Finding and identifying radioactive material by carborne search for OSI deployment: Poster at Comprehensive Nuclear-Test-Ban Treaty: Science and Technology, S&T2011, Vienna, Austria

    OpenAIRE

    Köble, Theo; Berky, Wolfram; Friedrich, Hermann; Risse, Monika; Rosenstock, Wolfgang; Schumann, Olaf

    2011-01-01

    The CTBTO verification system comprises an On-Site Inspection (OSI) to verify the suspicion of a banned nuclear test. An OSI comprises different methods of verification, one of them being the radiological survey of the inspection area. The radiological survey is done by airborne survey, carborne survey and environmental sampling, thereby narrowing the inspected area with each step. Our institute operates a measurement car with highly sensitive neutron and gamma detection systems. We investiga...

  6. Predictors of physical activity in patients with heart failure: a questionnaire study.

    Science.gov (United States)

    Chien, Hui-Chin; Chen, Hsing-Mei; Garet, Martin; Wang, Ruey-Hsia

    2014-07-01

    Adequate physical activity is believed to help decrease readmission and improve quality of life for patients with heart failure (HF). The aim of this study was to explore the predictors of physical activity level 1 month after discharge from hospital in Taiwanese patients with HF. A prospective research design was used. Overall, 111 patients with HF from a medical center in Southern Taiwan were recruited. Symptomatic distress, self-efficacy for physical activity, physical activity knowledge, and demographic and disease characteristics of patients with HF were collected at their discharge. One month later, patients' total daily energy expenditure (DEE), DEE for low-intensity physical activities (PA(low) DEE; strictly physical activities (PA(high) DEE; 3-5 METs), and DEE for intensive-intensity physical activities (PA(intensive) DEE; strictly >5 METs) were collected. The mean total DEE was 8175.85 ± 2595.12 kJ 24 h, of which 19.12% was for PAlow DEE, 7.20% was for PA(high) DEE, and only 1.42% was for PA(intensive) DEE. Body mass index (BMI), age, self-efficacy for instrumental activities of daily living, and educational level were predictors of total DEE of patients with HF 1 month after discharge. Self-efficacy for instrumental activities of daily living, gender, and BMI were predictors of PA(high) DEE. Age, BMI, and symptom distress were predictors of PA(intensive) DEE. Taiwanese patients with HF practiced lower intensity physical activities. Factors related to physical activity of patients with HF in Taiwan were similar to those of Western countries. Nurses should emphasize the importance of physical activity to patients with HF who are male, of older age, with lower educational level, or with lower BMI. Improving self-efficacy for instrumental activities and decreasing symptom distress should be incorporated into discharge planning programs for patients with HF.

  7. Accelerator mass spectrometry of the heaviest long-lived ...

    Indian Academy of Sciences (India)

    1 Vitaly Liechtenstein2. Vienna Environmental Research Accelerator, Institute for Isotopic Research and Nuclear Physics, University of Vienna, A-1090 Vienna, Austria; Russian Research Center, “Kurchatov Institute”, Institute of Nuclear Fusion, ...

  8. Seizure characteristics of epilepsy in childhood after acute encephalopathy with biphasic seizures and late reduced diffusion.

    Science.gov (United States)

    Ito, Yuji; Natsume, Jun; Kidokoro, Hiroyuki; Ishihara, Naoko; Azuma, Yoshiteru; Tsuji, Takeshi; Okumura, Akihisa; Kubota, Tetsuo; Ando, Naoki; Saitoh, Shinji; Miura, Kiyokuni; Negoro, Tamiko; Watanabe, Kazuyoshi; Kojima, Seiji

    2015-08-01

    The aim of this study was to clarify characteristics of post-encephalopathic epilepsy (PEE) in children after acute encephalopathy with biphasic seizures and late reduced diffusion (AESD), paying particular attention to precise diagnosis of seizure types. Among 262 children with acute encephalopathy/encephalitis registered in a database of the Tokai Pediatric Neurology Society between 2005 and 2012, 44 were diagnosed with AESD according to the clinical course and magnetic resonance imaging (MRI) findings and were included in this study. Medical records were reviewed to investigate clinical data, MRI findings, neurologic outcomes, and presence or absence of PEE. Seizure types of PEE were determined by both clinical observation by pediatric neurologists and ictal video-electroencephalography (EEG) recordings. Of the 44 patients after AESD, 10 (23%) had PEE. The period between the onset of encephalopathy and PEE ranged from 2 to 39 months (median 8.5 months). Cognitive impairment was more severe in patients with PEE than in those without. Biphasic seizures and status epilepticus during the acute phase of encephalopathy did not influence the risk of PEE. The most common seizure type of PEE on clinical observation was focal seizures (n = 5), followed by epileptic spasms (n = 4), myoclonic seizures (n = 3), and tonic seizures (n = 2). In six patients with PEE, seizures were induced by sudden unexpected sounds. Seizure types confirmed by ictal video-EEG recordings were epileptic spasms and focal seizures with frontal onset, and all focal seizures were startle seizures induced by sudden acoustic stimulation. Intractable daily seizures remain in six patients with PEE. We demonstrate seizure characteristics of PEE in children after AESD. Epileptic spasms and startle focal seizures are common seizure types. The specific seizure types may be determined by the pattern of diffuse subcortical white matter injury in AESD and age-dependent reorganization of the brain

  9. Chemical contaminants, health indicators, and reproductive biomarker responses in fish from rivers in the Southeastern United States

    Science.gov (United States)

    Hinck, J.E.; Blazer, V.S.; Denslow, N.D.; Echols, K.R.; Gale, R.W.; Wieser, C.; May, T.W.; Ellersieck, M.; Coyle, J.J.; Tillitt, D.E.

    2008-01-01

    Largemouth bass (Micropterus salmoides) and common carp (Cyprinus carpio) were collected from 13 sites located in the Mobile (MRB), Apalachicola-Flint-Chattahoochee (ARB), Savannah (SRB), and Pee Dee (PRB) River Basins to document spatial trends in accumulative chemical contaminants, health indicators, and reproductive biomarkers. Organochlorine residues, 2,3,7,8-tetrachlorodibenzo-p-dioxin-like activity (TCDD-EQ), and elemental contaminants were measured in composite samples of whole fish, grouped by species and gender, from each site. Mercury (Hg) and polychlorinated biphenyls (PCBs) were the primary contaminants of concern. Concentrations of Hg in bass samples from all basins exceeded toxicity thresholds for piscivorous mammals (> 0.1????g/g ww), juvenile and adult fish (> 0.2????g/g ww), and piscivorous birds (> 0.3????g/g ww). Total PCB concentrations in samples from the MRB, ARB, and PRB were > 480??ng/g ww and may be a risk to piscivorous wildlife. Selenium concentrations also exceeded toxicity thresholds (> 0.75????g/g ww) in MRB and ARB fish. Concentrations of other formerly used (total chlordanes, dieldrin, endrin, aldrin, mirex, and hexachlorobenzene) and currently used (pentachlorobenzene, pentachloroanisole, dacthal, endosulfan, ??-hexachlorocyclohexane, and methoxychlor) organochlorine residues were generally low or did not exceed toxicity thresholds for fish and piscivorous wildlife. TCDD-EQs exceeded wildlife dietary guidelines (> 5??pg/g ww) in MRB and PRB fish. Hepatic ethoxyresorufin O-deethylase (EROD) activity was generally greatest in MRB bass and carp. Altered fish health indicators and reproductive biomarker were noted in individual fish, but mean responses were similar among basins. The field necropsy and histopathological examination determined that MRB fish were generally in poorer health than those from the other basins, primarily due to parasitic infestations. Tumors were found in few fish (n = 5; 0.01%); ovarian tumors of smooth muscle

  10. Widespread occurrence of intersex in black basses (Micropterus spp.) from U.S. rivers, 1995-2004

    Science.gov (United States)

    Hinck, J.E.; Blazer, V.S.; Schmitt, C.J.; Papoulias, D.M.; Tillitt, D.E.

    2009-01-01

    Intersex occurrence in freshwater fishes was evaluated for nine river basins in the United States. Testicular oocytes (predominantly male testes containing female germ cells) were the most pervasive form of intersex observed, even though similar numbers of male (n = 1477) and female (n = 1633) fish were examined. Intersex was found in 3% of the fish collected. The intersex condition was observed in four of the 16 species examined (25%) and in fish from 34 of 111 sites (31%). Intersex was not found in multiple species from the same site but was most prevalent in largemouth bass (Micropterus salmoides; 18% of males) and smallmouth bass (M. dolomieu; 33% of males). The percentage of intersex fish per site was 8-91% for largemouth bass and 14-73% for smallmouth bass. The incidence of intersex was greatest in the southeastern United States, with intersex largemouth bass present at all sites in the Apalachicola, Savannah, and Pee Dee River Basins. Total mercury, trans-nonachlor, p,p???-DDE, p,p???-DDD, and total PCBs were the most commonly detected chemical contaminants at all sites, regardless of whether intersex was observed. Although the genotype of the intersex fish was not determined, the microscopic appearance of the gonads, the presence of mature sperm, and the concentrations of sex steroid hormones and vitellogenin indicate the intersex bass were males. Few reproductive endpoints differed significantly among male and intersex bass; plasma vitellogenin concentration in males was not a good indicator of intersex presence. Hierarchical linkages of the intersex condition to reproductive function will require a more quantitative measure of intersex (e.g. severity index) rather than presence or absence of the condition. The baseline incidence of intersex gonadal tissue in black basses and other freshwater fishes is unknown, but intersex prevalence may be related to collection season, age, and endocrine active compounds in the environment. Intersex was not found in

  11. A High-Resolution Hydrometeorological Forcing and Landscape Attributes Data Set for Hydrological Applications over the Southeastern United States

    Science.gov (United States)

    Tao, J.; Barros, A. P.; Bryant, E.; Peters-Lidard, C. D.

    2012-12-01

    In anticipation of NASA's Global Precipitation Measurement (GPM) ground-validation activities the SE United States and synergies with NOAA's Hydrometeorology Testbed-Southeast Pilot Study (HMT-SEPS) in western North Carolina, a high-resolution data set is being developed to provide the Hydrologic Modeling community with common control forcing and landscape attributes to facilitate multi-scale, multi-purpose hydrologic modeling studies ranging from flash-flood forecasting to basin-scale water resource assessments. In the first phase of the project, the goal is to generate quality hydrometeorological forcing data sets at high spatial and temporal resolution (1km×1km, hourly time step) for the five-year time period 2007-2011 with a focus on the river basins with headwaters in the Southern Appalachians: Upper Tennessee River Basin (56,573 km2), Savannah River Basin (27,110 km2), Santee River Basin (39,862 km2) and Yadkin-Pee Dee River Basin (46,310 km2). For subsequent years, the data are updated on every three months. Space-time varying land surface properties such as broadband albedo, broadband emissivity, fractional vegetation coverage and leaf area index are derived from MODIS products. The original products are re-projected and composited to the study area, bilinearly interpolated to basin grids, and then linearly interpolated into hourly time steps from the nominal daily, 8 day or 16 day. Missing data gaps are addressed using physically meaning full constraints based on ancillary data. Precipitation is generated from NCEP/EMC 4KM Gridded Data (GRIB) Stage IV hourly data using the nearest neighbor method. Integration of Stage IV data with precipitation observations from research networks in the region provides dynamic relationships for improving precipitation accuracy in mountainous terrain. The atmospheric forcing data are extracted from North American Regional Reanalysis (NARR) products originally at 32-km spatial resolution and 3-hour temporal resolution

  12. Circulatory Shock. Volume 34. Number 1. May 1991. International Conference on Shock (2nd), Meeting of European Shock Society (5th), Annual Meeting of the Shock Society (USA) (14th), Vienna Shock Form (3rd) Held in Vienna, Austria on 2-6 June 1991

    Science.gov (United States)

    1991-06-06

    toxin. NEUROLOGICAL FUNCTION AND RECOVERY IN PROFOUND hEMORRHAGIC SHOCK (HS) IN MONKF`’. G. Bar -Joseph*. P. Safar, A. Radovskv*, W.S.Stezoski*, H...reversible with therapy. Histological damage is minimal and does not seem to have any clinical significance. 1. G. Bar -Joseph et al. Resuscitation 17...bleeding. 9 5 OXYGEN CONSUMPTION IN UNCONTROLLED PRESSURE DRIVEN HEMORRHAGE IN DOGS. R ’riqt* GA Brava *_ IT Velaesn_ M Rneha & Silvn Research

  13. Posidonia oceanica (L. Delile Ethanolic Extract Modulates Cell Activities with Skin Health Applications

    Directory of Open Access Journals (Sweden)

    Laura Cornara

    2018-01-01

    Full Text Available Seagrasses are high plants sharing adaptive metabolic features with both terrestrial plants and marine algae, resulting in a phytocomplex possibly endowed with interesting biological properties. The aim of this study is to evaluate the in vitro activities on skin cells of an ethanolic extract obtained from the leaves of Posidonia oceanica (L. Delile, family Potamogetonaceae, herein named Posidonia ethanolic extract (PEE. PEE showed high radical scavenging activity, high phenolic content, and resulted rich in chicoric acid, as determined through HPLC-MS analysis. The use of MTT assay on fibroblasts showed a PEE cytotoxicity threshold (IC05 of 50 µg/mL at 48 h, while a sub-toxic dose of 20 µg/mL induced a significant increase of fibroblast growth rate after 10 days. In addition, an ELISA assay revealed that PEE doses of 5 and 10 µg/mL induced collagen production in fibroblasts. PEE induced dose-dependent mushroom tyrosinase inhibition, up to about 45% inhibition at 1000 µg/mL, while 50% reduction of melanin was observed in melanoma cells exposed to 50 µg/mL PEE. Finally, PEE lipolytic activity was assessed by measuring glycerol release from adipocytes following triglyceride degradation. In conclusion, we have collected new data about the biological activities of the phytocomplex of P. oceanica seagrass on skin cells. Our findings indicate that PEE could be profitably used in the development of products for skin aging, undesired hyperpigmentation, and cellulite.

  14. Mosquito Studies (Dipera: Culicidae) 34. A Revision of the Albimanus Section of the Subgenus Nyssorhynchus of Anopheles. (Contributions of the American Entomological Institute. Volume 15, Number 7, 1980)

    Science.gov (United States)

    1980-01-01

    Nov 1943, H. Pratt, 1L. Cayey, 2 Dee 1943, J. Maldonado -Capriles, H. Pratt, 5L. Dorado, PR 151. Fort Buchanan, 14 Dee 1942, T. Aitken, 2M, 2F; same...1943, G. Bradley, 3F. Tortuguero, Laguna, 25 Aug 1942, E. Charneco, 2L; same locality, 15 Dee 1944, H. Pratt, 2L. Yauco, 26 Dee 1942, J. Maldonado ...Canal Zone: Bar- ro Colorado Island, 20 Feb 1942, KO 111-14, 2F; same locality and date, KO 117-8, 1F. Cano Saddle, 7 May 1923, R. Shannon, 6F

  15. Quantification of physical activity using the QAPACE Questionnaire: a two stage cluster sample design survey of children and adolescents attending urban school.

    Science.gov (United States)

    Barbosa, Nicolas; Sanchez, Carlos E; Patino, Efrain; Lozano, Benigno; Thalabard, Jean C; LE Bozec, Serge; Rieu, Michel

    2016-05-01

    Quantification of physical activity as energy expenditure is important since youth for the prevention of chronic non communicable diseases in adulthood. It is necessary to quantify physical activity expressed in daily energy expenditure (DEE) in school children and adolescents between 8-16 years, by age, gender and socioeconomic level (SEL) in Bogotá. This is a Two Stage Cluster Survey Sample. From a universe of 4700 schools and 760000 students from three existing socioeconomic levels in Bogotá (low, medium and high). The random sample was 20 schools and 1840 students (904 boys and 936 girls). Foreshadowing desertion of participants and inconsistency in the questionnaire responses, the sample size was increased. Thus, 6 individuals of each gender for each of the nine age groups were selected, resulting in a total sample of 2160 individuals. Selected students filled the QAPACE questionnaire under supervision. The data was analyzed comparing means with multivariate general linear model. Fixed factors used were: gender (boys and girls), age (8 to 16 years old) and tri-strata SEL (low, medium and high); as independent variables were assessed: height, weight, leisure time, expressed in hours/day and dependent variable: daily energy expenditure DEE (kJ.kg-1.day-1): during leisure time (DEE-LT), during school time (DEE-ST), during vacation time (DEE-VT), and total mean DEE per year (DEEm-TY) RESULTS: Differences in DEE by gender, in boys, LT and all DEE, with the SEL all variables were significant; but age-SEL was only significant in DEE-VT. In girls, with the SEL all variables were significant. The post hoc multiple comparisons tests were significant with age using Fisher's Least Significant Difference (LSD) test in all variables. For both genders and for all SELs the values in girls had the higher value except SEL high (5-6) The boys have higher values in DEE-LT, DEE-ST, DEE-VT; except in DEEm-TY in SEL (5-6) In SEL (5-6) all DEEs for both genders are highest. For SEL

  16. Identification of the Subject-Specific Parameters of a Hill-type Muscle-tendon Model for Simulations of Human Motion (Identificatie van subject-specifieke parameters van een Hill-type spier-pees model voor de simulatie van menselijke beweging)

    OpenAIRE

    Van Campen, Anke

    2014-01-01

    This thesis contributes to subject-specific modeling in biomechanical an alysis by (i) designing an experimental setup to obtain a more accurate subject-specific angle-moment relationship of the knee joint (chapters 4 and 5), (ii) developing an algorithm for the estimation of the muscle-t endon parameters of the actuators of the knee joint in a simulation envi ronment and comparing its performance to the performance of the algorith m of Garner and Pandy (2003), and (iii) validating the outcom...

  17. Nanoindentation and AFM studies of PECVD DLC and reactively ...

    Indian Academy of Sciences (India)

    Austrian Centre of Competence for Tribology, Viktor Kaplan-Straße 2, A 2700 Wiener Neustadt, Austria; Institute of Industrial Electronics and Material Science, Vienna University of Technology, A 1040 Vienna, Austria; Institute of Material Science and Testing, Vienna University of Technology, A 1040 Vienna, Austria; Institute ...

  18. Prenatal ethanol exposure increases osteoarthritis susceptibility in female rat offspring by programming a low-functioning IGF-1 signaling pathway

    Science.gov (United States)

    Ni, Qubo; Tan, Yang; Zhang, Xianrong; Luo, Hanwen; Deng, Yu; Magdalou, Jacques; Chen, Liaobin; Wang, Hui

    2015-10-01

    Epidemiological evidence indicates that osteoarthritis (OA) and prenatal ethanol exposure (PEE) are both associated with low birth weight but possible causal interrelationships have not been investigated. To investigate the effects of PEE on the susceptibility to OA in adult rats that experienced intrauterine growth retardation (IUGR), and to explore potential intrauterine mechanisms, we established the rat model of IUGR by PEE and dexamethasone, and the female fetus and 24-week-old adult offspring subjected to strenuous running for 6 weeks were sacrificed. Knee joints were collected from fetuses and adult offspring for histochemistry, immunohistochemistry and qPCR assays. Histological analyses and the Mankin score revealed increased cartilage destruction and accelerated OA progression in adult offspring from the PEE group compared to the control group. Immunohistochemistry showed reduced expression of insulin-like growth factor-1 (IGF-1) signaling pathway components. Furthermore, fetuses in the PEE group experienced IUGR but exhibited a higher postnatal growth rate. The expression of many IGF-1 signaling components was downregulated, which coincided with reduced amounts of type II collagen in the epiphyseal cartilage of fetuses in the PEE group. These results suggest that PEE enhances the susceptibility to OA in female adult rat offspring by down-regulating IGF-1 signaling and retarding articular cartilage development.

  19. Daily energy expenditure of male and female Marsh Harrier nestlings

    NARCIS (Netherlands)

    Riedstra, Bernd; Dijkstra, Cornelis; Daan, Serge

    We used the doubly labeled water (DLW) method to measure daily energy expenditure (DEE) in eight brother-sister pairs of free-living Marsh Harrier (Circus aeruginosus) nestlings. We calculated metabolizable energy intake (ME) from DEE and body-mass change. In each pair, males had lower body mass,

  20. Download this PDF file

    African Journals Online (AJOL)

    of one Fanti who had only the ABO done because and oee feilowed by Dee for Fahhs ahd_ Kwahhs of technical mishap. The Kell/Cellano was done on and DeE for the Asahles and Akwaplms- The. 20 Fantis, 94- Asantes. 7s Kwahus and '18 Ak- highest frequencies of genes containing B were wapims' seen in the Asantes ...

  1. Aerodynamic shape parameterisation and optimisation of novel configurations

    NARCIS (Netherlands)

    Straathof, M.H.; Van Tooren, M.J.L.; Voskuijl, M.; Koren, B.

    2008-01-01

    The Multi-Disciplinary Design Optimisation (MDO) process can be supported by partial automation of analysis and optimisation steps. Design and Engineering Engines (DEE) are useful concepts to structure this type of automation. Within the DEE, a product can be parameterically defined using Knowledge

  2. Kuula : Tuhkatriinu ooperilaval. Jazzkaare jõulujazz

    Index Scriptorium Estoniae

    2006-01-01

    G. Rossini ooperi "Tuhkatriinu" esietendusest 10. nov. Rahvusooperis Estonia (peaosas Helen Lokuta). 11. jõulujazzist 29. nov.-14.dets. Eesti suuremates linnades. Prantsuse jazzlaulja Dee Dee Bridgewater'i kontserdist kavaga "J'ai deux amour" 2. dets. Estonia kontserdisaalis

  3. High Rate of Recurrent De Novo Mutations in Developmental and Epileptic Encephalopathies

    NARCIS (Netherlands)

    Hamdan, Fadi F.; Myers, Candace T.; Cossette, Patrick; Lemay, Philippe; Spiegelman, Dan; Laporte, Alexandre Dionne; Nassif, Christina; Diallo, Ousmane; Monlong, Jean; Cadieux-Dion, Maxime; Dobrzeniecka, Sylvia; Meloche, Caroline; Retterer, Kyle; Cho, Megan T.; Rosenfeld, Jill A.; Bi, Weimin; Massicotte, Christine; Miguet, Marguerite; Brunga, Ledia; Regan, Brigid M.; Mo, Kelly; Tam, Cory; Schneider, Amy; Hollingsworth, Georgie; FitzPatrick, David R.; Donaldson, Alan; Canham, Natalie; Blair, Edward; Kerr, Bronwyn; Fry, Andrew E.; Thomas, Rhys H.; Shelagh, Joss; Hurst, Jane A.; Brittain, Helen; Blyth, Moira; Lebel, Robert Roger; Gerkes, Erica H.; Davis-Keppen, Laura; Stein, Quinn; Chung, Wendy K.; Dorison, Sara J.; Benke, Paul J.; Fassi, Emily; Corsten-Janssen, Nicole; Kamsteeg, Erik-Jan; Mau-Them, Frederic T.; Bruel, Ange-Line; Verloes, Alain; Ounap, Katrin; Wojcik, Monica H.; Albert, Dara V. F.; Venkateswaran, Sunita; Ware, Tyson; Jones, Dean; Liu, Yu-Chi; Mohammad, Shekeeb S.; Bizargity, Peyman; Bacino, Carlos A.; Leuzzi, Vincenzo; Martinelli, Simone; Dallapiccola, Bruno; Tartaglia, Marco; Blumkin, Lubov; Wierenga, Klaas J.; Purcarin, Gabriela; O'Byrne, James J.; Stockler, Sylvia; Lehman, Anna; Keren, Boris; Nougues, Marie-Christine; Mignot, Cyril; Auvin, Stephane; Nava, Caroline; Hiatt, Susan M.; Bebin, Martina; Shao, Yunru; Scaglia, Fernando; Lalani, Seema R.; Frye, Richard E.; Jarjour, Imad T.; Jacques, Stephanie; Boucher, Renee-Myriam; Riou, Emilie; Srour, Myriam; Carmant, Lionel; Lortie, Anne; Major, Philippe; Diadori, Paola; Dubeau, Francois; D'Anjou, Guy; Bourque, Guillaume; Berkovic, Samuel F.; Sadleir, Lynette G.; Campeau, Philippe M.; Kibar, Zoha; Lafreniere, Ronald G.; Girard, Simon L.; Mercimek-Mahmutoglu, Saadet; Boelman, Cyrus; Rouleau, Guy A.; Scheffer, Ingrid E.; Mefford, Heather C.; Andrade, Danielle M.; Rossignol, Elsa; Minassian, Berge A.; Michaud, Jacques L.

    2017-01-01

    Developmental and epileptic encephalopathy (DEE) is a group of conditions characterized by the co-occurrence of epilepsy and intellectual disability (ID), typically with developmental plateauing or regression associated with frequent epileptiform activity. The cause of DEE remains unknown in the

  4. A Low-Maintenance Approach to Improving Retention: Short On-Line Tutorials in Elementary Statistics

    Science.gov (United States)

    Sargent, Carol Springer; Borthick, A. Faye; Lederberg, Amy R.; Haardorfer, Regine

    2013-01-01

    The struggle to get weak students to use learning support services plagues virtually all retention programs (Friedlander, 1980; Hodges, 2001; Karabenick & Knapp, 1988; Moore & LeDee, 2006; Simpson, Hynd, Nist, & Burrell, 1997; Webster & Dee, 1998). This study presents a cost-effective form of supplemental instruction (SI), in the form of on-line…

  5. Efficacy of natural propolis extract in the control of American Foulbrood.

    Science.gov (United States)

    Antúnez, Karina; Harriet, Jorge; Gende, Liesel; Maggi, Matías; Eguaras, Martin; Zunino, Pablo

    2008-10-15

    Paenibacillus larvae is the causative agent of American Foulbrood (AFB), a severe disease that affects larvae of the honeybees. Due to the serious effects associated with AFB and the problems related to the use of antibiotics, it is necessary to develop alternative strategies for the control of the disease. The aim of the present work was to evaluate the effect of a propolis ethanolic extract (PEE) against P. larvae and its potential for the control of AFB. In vitro activity of PEE against P. larvae isolates was evaluated by the disk diffusion method and the minimum inhibitory concentration (MIC) was determined. Toxicity for honeybees was evaluated by oral administration of PEE and its lethal concentration was assessed. Lastly, colonies from an apiary with episodes of AFB on previous years were divided into different groups and treated with sugar syrup supplemented with PEE by aspersion (group one), sugar syrup by aspersion (group two), fed with sugar syrup supplemented with PEE (group three) and fed with sugar syrup only (group four). All isolates were sensitive to PEE and the MIC median was 0.52% (range 0.32-0.64). PEE was not toxic for bees at least at 50%. Field assays showed that 21 and 42 days after the application of the treatments, the number of P. larvae spores/g of honey was significantly lower in colonies treated with PEE compared to the colonies that were not treated with PEE. To our knowledge, this is the first report about the use of propolis for the treatment of beehives affected with P. larvae spores.

  6. Common mental disorders increase pre-eclampsia/ eclampsia risks in pregnancy

    Directory of Open Access Journals (Sweden)

    Y. Wibowo

    2013-04-01

    Full Text Available Introduction Pre-eclampsia is a multisystem complication that occurs after 20 weeks of pregnancy and can cause considerable maternal and fetal morbidity and mortality. Mental health is influenced by social support, and emotional distress during pregnancy may cause pre-ecclampsia/ecclampsia (PE/E. The objective of this study was to determine the association of social support and common mental disorders (CMD with PE/E in pregnant women. Methods This study was a matched case-control study. Cases were pregnant women who had been diagnosed with PE/E. Controls were those with normal pregnancies or not diagnosed as PE/E. Instruments social support questionnaire-6 (SSQ-6 was used to measure social support and self-reporting questionnaire 20 (SRQ-20 items for measuring CMD. Conditional logistic regression was used to estimate matched odds ratios (ORs and 95% confidence intervals (95% CI. Results Low social support was not directly associated with PE/E. Compared with women with high social support, those with low social support had a 26-fold increased risk of CMD (+ (OR=26.4, 95% CI: 10.67 to 77.20, p=0.001. Several variables significantly associated with PE/E were CMD (+ (OR=6.11, 95% CI: 2.99 to 14.07, p=0.001, low family income (OR=2.93, 95% CI: 1.56 to 5.82, p=0.001, history of chronic hypertension (+ (OR=7.67, 95% CI: 2.32 to 39.89, p=0.001, history of PE/E (+ (p=0.001, and history of hereditary PE/E (+ (OR=6, 95% CI: 1.34 to 55.20, p=0.013. Conclusion Low social support was not directly associated with PE/E but was associated with CMD. To prevent CMD in pregnant women, there is a need for social support from the family.

  7. Prenatal ethanol exposure programs an increased susceptibility of non-alcoholic fatty liver disease in female adult offspring rats

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Lang; Liu, Zhongfen; Gong, Jun; Zhang, Li [Department of Pharmacology, Basic Medical School of Wuhan University, Wuhan 430071 (China); Wang, Linlong [Department of Orthopedic Surgery, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Magdalou, Jacques [UMR 7561 CNRS-Nancy Université, Faculté de Médicine, Vandoeuvre-lès-Nancy (France); Chen, Liaobin [Department of Orthopedic Surgery, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Wang, Hui, E-mail: wanghui19@whu.edu.cn [Department of Pharmacology, Basic Medical School of Wuhan University, Wuhan 430071 (China); Research Center of Food and Drug Evaluation, Wuhan University, Wuhan 430071 (China)

    2014-01-15

    Prenatal ethanol exposure (PEE) induces dyslipidemia and hyperglycemia in fetus and adult offspring. However, whether PEE increases the susceptibility to non-alcoholic fatty liver disease (NAFLD) in offspring and its underlying mechanism remain unknown. This study aimed to demonstrate an increased susceptibility to high-fat diet (HFD)-induced NAFLD and its intrauterine programming mechanisms in female rat offspring with PEE. Rat model of intrauterine growth retardation (IUGR) was established by PEE, the female fetus and adult offspring that fed normal diet (ND) or HFD were sacrificed. The results showed that, in PEE + ND group, serum corticosterone (CORT) slightly decreased and insulin-like growth factor-1 (IGF-1) and glucose increased with partial catch-up growth; In PEE + HFD group, serum CORT decreased, while serum IGF-1, glucose and triglyceride (TG) increased, with notable catch-up growth, higher metabolic status and NAFLD formation. Enhanced liver expression of the IGF-1 pathway, gluconeogenesis, and lipid synthesis as well as reduced expression of lipid output were accompanied in PEE + HFD group. In PEE fetus, serum CORT increased while IGF-1 decreased, with low body weight, hyperglycemia, and hepatocyte ultrastructural changes. Hepatic IGF-1 expression as well as lipid output was down-regulated, while lipid synthesis significantly increased. Based on these findings, we propose a “two-programming” hypothesis for an increased susceptibility to HFD-induced NAFLD in female offspring of PEE. That is, the intrauterine programming of liver glucose and lipid metabolic function is “the first programming”, and postnatal adaptive catch-up growth triggered by intrauterine programming of GC-IGF1 axis acts as “the second programming”. - Highlights: • Prenatal ethanol exposure increase the susceptibility of NAFLD in female offspring. • Prenatal ethanol exposure reprograms fetal liver’s glucose and lipid metabolism . • Prenatal ethanol exposure cause

  8. Effect of Subcritical Fluid Extraction on the High Quality of Headspace Oil from Jasminum sambac (L.) Aiton.

    Science.gov (United States)

    Ye, Qiuping; Jin, Xinyi; Wei, Shiqin; Zheng, Gongyu; Li, Xinlei

    2016-05-01

    Subcritical fluid extraction (SFE), as a novel method, was applied to investigate the yield, quality, and sensory evaluation of headspace oil from Jasminum sambac (L.) Aiton in comparison with petroleum ether extraction (PEE). The results indicated that the yield of the headspace oil using SFE was significantly higher (P headspace oil. The contents of linalool (21.90%) and benzyl acetate (16.31%) were higher via SFE than PEE. In addition, the sensory evaluation of SFE was superior to PEE, indicating a fresh, jasmine-like odor and green-yellow color. Thus, SFE is an improved method for obtaining natural headspace oil from jasmine flowers.

  9. Effect of Subcritical Fluid Extraction on the High Quality of Headspace Oil from Jasminum sambac (L.) Aiton.

    Science.gov (United States)

    2016-04-22

    Subcritical fluid extraction (SFE), as a novel method, was applied to investigate the yield, quality, and sensory evaluation of headspace oil from Jasminum sambac (L.) Aiton in comparison with petroleum ether extraction (PEE). The results indicated that the yield of the headspace oil using SFE was significantly higher (P headspace oil. The contents of linalool (21.90%) and benzyl acetate (16.31%) were higher via SFE than PEE. In addition, the sensory evaluation of SFE was superior to PEE, indicating a fresh, jasmine-like odor and green-yellow color. Thus, SFE is an improved method for obtaining natural headspace oil from jasmine flowers.

  10. Možnosti a využití objektivních testů osobnosti Vienna Test Systemu při zjišťování individuální tendence riskovat

    OpenAIRE

    Konrádová, Hana

    2013-01-01

    The theoretical part of this thesis addresses key concepts related to the individual tendency to take risks - it introduces how this trait is embedded in the concept of personality, establishes essential theoretical issues related to risk and risk-tendency, as well as related important terms, research and authors in the field in question. The key issues, too, are methods of risk behaviour detection with emphasis on current trends in psychodiagnostics, thus in the following part the fields of ...

  11. 'Laptops in Social Science Lectures - Pedagogical Challenges and Benefits' in: Walter Feichtinger, Benedikt Hensellek, (eds.):'Viribus Unitis. ISMS Annual Conference 2014. Armed Forces for 2020 and beyond - Roles, Tasks, Expectations.' Federal Ministry of Defence and Sports. Vienna, Austria

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    2015-01-01

    This presentation gives inspirations to researchers and teachers in higher military education who want to develop the students’ use of laptops in lectures. In my job as a lecturer at the Danish Defence Language Institute I conducted a pilot project in autumn 2013 – winter 2014, aimed at developing...... the students’ use of laptops during lectures to support their learning....

  12. R-Matrix Codes for Charged-Particle Induced Reactions in the Resolved Resonance Region (3), Summary Report of an IAEA Consultants' Meeting IAEA Headquarters, Vienna, Austria, 28-30 June 2017

    Energy Technology Data Exchange (ETDEWEB)

    Leeb, Helmut [Technische Univ. Wien, Vienna (Austria); Dimitriou, Paraskevi [Intl Atomic Energy Agency (IAEA), Vienna (Austria); Thompson, Ian [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-10-23

    A Consultants Meeting was held at the IAEA Headquarters, from 28 to 30 June 2017, to discuss the results of a test exercise that had been defined and assigned to all participants of the previous meeting held in December 2016. Five codes were used in this exercise: AMUR, AZURE2, RAC, SFRESCO and SAMMY. The results obtained from these codes were compared and further actions were proposed. Participants’ presentations and technical discussions, as well as proposed additional actions have been summarized in this report.

  13. Epstein–Barr virus in the multiple sclerosis brain: a controversial issue—report on a focused workshop held in the Centre for Brain Research of the Medical University of Vienna, Austria

    NARCIS (Netherlands)

    Lassmann, H.; Niedobitek, G.; Aloisi, G; Middeldorp, J.M.

    2011-01-01

    Recent epidemiological and immunological studies provide evidence for an association between Epstein-Barr virus infection and multiple sclerosis, suggesting a role of Epstein-Barr virus infection in disease induction and pathogenesis. A key question in this context is whether Epstein-Barr

  14. Epstein–Barr virus in the multiple sclerosis brain: a controversial issue—report on a focused workshop held in the Centre for Brain Research of the Medical University of Vienna, Austria

    Science.gov (United States)

    Niedobitek, Gerald; Aloisi, Francesca; Middeldorp, Jaap M.

    2011-01-01

    Recent epidemiological and immunological studies provide evidence for an association between Epstein–Barr virus infection and multiple sclerosis, suggesting a role of Epstein–Barr virus infection in disease induction and pathogenesis. A key question in this context is whether Epstein–Barr virus-infected B lymphocytes are present within the central nervous system and the lesions of patients with multiple sclerosis. Previous studies on this topic provided highly controversial results, showing Epstein–Barr virus reactivity in B cells in the vast majority of multiple sclerosis cases and lesions, or only exceptional Epstein–Barr virus-positive B cells in rare cases. In an attempt to explain the reasons for these divergent results, a workshop was organized under the umbrella of the European Union FP6 NeuroproMiSe project, the outcome of which is presented here. This report summarizes the current knowledge of Epstein–Barr virus biology and shows that Epstein–Barr virus infection is highly complex. There are still major controversies, how to unequivocally identify Epstein–Barr virus infection in pathological tissues, particularly in situations other than Epstein–Barr virus-driven lymphomas or acute Epstein–Barr virus infections. It further highlights that unequivocal proof of Epstein–Barr virus infection in multiple sclerosis lesions is still lacking, due to issues related to the sensitivity and specificity of the detection methods. PMID:21846731

  15. Report on Rudolf von Eitelberger: Netzwerker der Kunstgeschichte. Conference held for the 200th Anniversary of the birth of Rudolf Eitelberger (1817-1885. Museum of Applied Art, Vienna, 27-29 April 2017.

    Directory of Open Access Journals (Sweden)

    Matthew Rampley

    2017-06-01

    Full Text Available Rudolf von Eitelberger: Netzwerker der Kunstgeschichte was an important first step in gathering together the diverse array of projects that, different ways, refer to or focus on Eitelberger. Nevertheless, as with the best gatherings of this kind, it also highlighted how much more work there is to be done.

  16. Proceedings of the European ISTVS Conference (6th), OVK Symposium (4th), on "Off Road Vehicles in Theory and Practice", Held at Vienna, Austria on 28-30 September 1994. Appendix.

    Science.gov (United States)

    1994-09-30

    den lockeren Ackerboden emn, was zu erh~htern Roll- widerstand, geringerer Zugkraft und grof ~er Bodenverdichtung f~ihrt. Bei gleicher Last kann bei...gekennzeichnet durch emn neuartiges allradgelenktes Fahrwerk mit Einzelrad-Fijhrung fOr grof ~e Federwege und Arbeitsaufnahme, hohe 1 -16- spezifische

  17. Epstein-Barr virus in the multiple sclerosis brain: a controversial issue--report on a focused workshop held in the Centre for Brain Research of the Medical University of Vienna, Austria.

    Science.gov (United States)

    Lassmann, Hans; Niedobitek, Gerald; Aloisi, Francesca; Middeldorp, Jaap M

    2011-09-01

    Recent epidemiological and immunological studies provide evidence for an association between Epstein-Barr virus infection and multiple sclerosis, suggesting a role of Epstein-Barr virus infection in disease induction and pathogenesis. A key question in this context is whether Epstein-Barr virus-infected B lymphocytes are present within the central nervous system and the lesions of patients with multiple sclerosis. Previous studies on this topic provided highly controversial results, showing Epstein-Barr virus reactivity in B cells in the vast majority of multiple sclerosis cases and lesions, or only exceptional Epstein-Barr virus-positive B cells in rare cases. In an attempt to explain the reasons for these divergent results, a workshop was organized under the umbrella of the European Union FP6 NeuroproMiSe project, the outcome of which is presented here. This report summarizes the current knowledge of Epstein-Barr virus biology and shows that Epstein-Barr virus infection is highly complex. There are still major controversies, how to unequivocally identify Epstein-Barr virus infection in pathological tissues, particularly in situations other than Epstein-Barr virus-driven lymphomas or acute Epstein-Barr virus infections. It further highlights that unequivocal proof of Epstein-Barr virus infection in multiple sclerosis lesions is still lacking, due to issues related to the sensitivity and specificity of the detection methods.

  18. Environmental management in the context of an integrated system in the gas supply concepts of Hamburg and Vienna; Umweltmanagement im Rahmen eines integrierten Systems in der Gasversorgung in Hamburg und in Wien

    Energy Technology Data Exchange (ETDEWEB)

    Reimers, G.; Rennecke, R.W. [HEIN GAS Hamburger Gaswerke GmbH, Hamburg (Germany); Dvorak, H. [WIENGAS, Wien (Austria)

    2001-11-01

    WIENGAS implemented an environmental management system based on DIN EN ISO 14001 as integrated management system with a quality management system based on DIN EN ISO 9001:2000. The existing integrated management system of HEIN GAS was used as basis. Additional consultant was bought from Hamburg too. The following news item reports about the ecobalance of HEIN GAS and the process ratio of WIENGAS. (orig.) [German] Bei der Wiengas wurde ein Umweltmanagementsystem nach DIN EN ISO 14001 zusammen als integriertes Managementsystem mit einem Qualitaetsmanagementsystem nach DIN EN ISO 9001:2000 eingefuehrt. Bei der Einfuehrung wurde das seit 1996 existierende integrierte Managementsystem von HEINGAS als Orientierungsgrundlage herangezogen und Beratung aus Hamburg eingekauft. Im nachfolgenden Artikel soll auf die Oekobilanz von HEINGAS und auf die Prozesskennzahlen der WIENGAS eingegangen werden. (orig.)

  19. ["...such refuges are the collections and museums, which represent the current aspects of science, and prepare for its future". Social aspects of anatomy and the collections of the Vienna medical faculty, 1790 - 1840].

    Science.gov (United States)

    Oppenauer, Markus

    2014-01-01

    This paper arises out of my research which I have been conducting in the context of my dissertation project. It explores the relationship between teaching, research and collecting practices in Viennese anatomy during the late eighteenth and early nineteenth century. In a time in which Viennese medicine tried to reinvent itself through both the creation of a new curriculum and several other institutional measures the practice of establishing comparative and human anatomical collections can be seen as a strategic key field of action. By concentrating on scientific journals, popular texts, catalogues, correspondences and specimens this paper aims at revealing specific social systems which must be understood as parts of the 'social history' of Viennese anatomy. By looking closely at these social aspects of anatomical teaching and research, this work tries to contribute to recent discussions addressed by historians of science and medicine.

  20. Bruno Thüring's utopical post-war plans for Vienna (German Title: Bruno Thürings utopische Nachkriegspläne für Wien)

    Science.gov (United States)

    Schembor, Friedrich Wilhelm

    2011-08-01

    The head of the Viennese Observatory, Bruno Thüuring, as a stout National Socialist, interpreted WW2, which was already under way, as a short-time intermezzo. A new observatory, allegedly promised to him at his appointment, should have been erected after the end of WW2. Lay criteria without scientific survey let find him a suitable building site. Only his call-up to the Wehrmacht in March 1943 put a stop to further preparatory work.

  1. LEGAL REGULATION OF THE BUYER`S OBLIGATION FOR PRICE PAYMENT ACCORDING TO THE VIENNA CONVENTION ON CONTRACTS FOR THE INTERNATIONAL SALE OF GOODS WITH EMPHASIS TO ITS ORDERLINESS IN REPUBLIC OF MACEDONIA

    OpenAIRE

    Natalija Ivanova

    2014-01-01

    Contract of sale is a basic legal instrument of international trade and therefore has a major role not only in domestic but also in international commodity trade. The corpus rights and obligations represent the content of the sales contract. By concluding the sales contract, whether in internal or international law, each party undertakes certain obligations, but also it is acquired with certain rights. The obligations of the buyer represent one part of the contract`...

  2. This year the CERN Accelerator School returned to Austria after an interval of ten years and organized its Basic Accelerator Physics course together with the Austrian Academy of Sciences (HEPHY) in Baden, near Vienna, from 12-24 September, 2004.

    CERN Document Server

    2004-01-01

    The school was a resounding success with 95 students of more than 20 different nationalities attending. This particularly high attendance is very satisfying and confirms the strong interest in accelerator physics among young scientists. Feedback from the students praised the expertise of the lecturers, the high standard of the lectures as well as the pleasant environment and excellent organization.

  3. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Your pee smells bad. These things happen because bacteria have caused an infection somewhere in your urinary ... shorter than boys' urethras. The shorter urethra means bacteria can get up into the bladder more easily ...

  4. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... What Will the Doctor Do? Bye-Bye, UTI Question: What do you do five to six times ... you're having peeing problems. Ask yourself these questions and share your answers with your mom or ...

  5. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... thinking about peeing quite a lot. Why? Because it stings when you go — yow! You also might ... through the ureters down to the bladder. When it's empty, your bladder is about the same size ...

  6. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... do you do five to six times a day but never think twice about? Answer: Pee! But ... turz) bladder urethra (say: yoo-REE-thruh) All day long, the kidneys clean waste products from your ...

  7. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Diabetes Can Diabetes Be Prevented? Organize, Focus, Get It Done How Do I Help a Kid Who's ... thinking about peeing quite a lot. Why? Because it stings when you go — yow! You also might ...

  8. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Search Kids Home How the Body Works Puberty & Growing Up Staying Healthy Recipes & Cooking Staying Safe Health ... Your pee smells bad. These things happen because bacteria have caused an infection somewhere in your urinary ...

  9. Hair Loss

    Science.gov (United States)

    ... to treat acne, bipolar disorder, and ADHD. Diet pills that contain amphetamines also can cause hair loss. Alopecia areata (pronounced: al-uh-PEE-shuh air-ee-AH-tuh) . This skin disease causes hair ...

  10. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... up of these main parts: two kidneys two ureters (say: YUR-uh-turz) bladder urethra (say: yoo- ... waste becomes urine (pee), which drips into the ureters (long, thin tubes, one connected to each kidney). ...

  11. Get Your Eyes Tested

    Science.gov (United States)

    ... blurry or distorted at all distances Presbyopia (“prez-bee-OH-pee-uh”) – a condition that older adults ... sections Take Action! Take Action: Schedule Your Exam Protect your vision. Get regular eye exams so you ...

  12. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... in the night to pee? Do you feel pain, pressure, or a tickle in your lower belly? ... you feel feverish , have the chills, or have pain in your belly or back, just under your ...

  13. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... if I Have a UTI? You may notice signs of a urinary tract infection before anyone else ... it smell bad when you pee? These are signs that you might have a bladder infection, so ...

  14. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... urinary tract infection, or UTI, you're probably thinking about peeing quite a lot. Why? Because it ... Urinary Tract? Your urinary tract is actually a system made up of these main parts: two kidneys ...

  15. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... go into a bathroom and pee into a plastic cup. Your doctor will give you special wipes ... can be delivered more effectively through a tiny plastic tube inserted into a vein. Bye-Bye, UTI ...

  16. Commentary on "The value of transurethral bladder biopsy after intravesical bacillus Calmette-Guérin instillation therapy for nonmuscle invasive bladder cancer: a retrospective, single center study and cumulative analysis of the literature." Swietek N, Waldert M, Rom M, Schatzl G, Wiener HG, Susani M, Klatte T. Department of Urology, Medical University of Vienna, Vienna, Austria: J Urol 2012;188(3):748-53 [Epub 2012 Jul 20].

    Science.gov (United States)

    See, William A

    2013-07-01

    We evaluated the need of routine transurethral biopsies after an induction course of intravesical bacillus Calmette-Guérin for high grade nonmuscle invasive bladder cancer. This retrospective study included 180 patients with high grade nonmuscle invasive bladder cancer who underwent a 6-week induction course of bacillus Calmette-Guérin. Cystoscopic findings, urinary cytology and pathological results of transurethral biopsy were evaluated. For cumulative meta-analysis we systematically reviewed studies indexed in MEDLINE(®), EMBASE(®) and Web of Science(®). The records of 740 patients from a total of 7 studies were finally analyzed. Biopsy was positive in 58 patients (32%). Cystoscopy appeared normal in 75 patients (42%) and showed only erythema in 51 (28%) and tumor in 54 (30%), of whom 6 (8%), 11 (22%) and 41 (76%), respectively, showed positive findings at biopsy. The positive predictive value of erythema was 15% with negative cytology and 56% with positive cytology. The positive predictive value of a tumor with negative and positive cytology was 63% and 89%, respectively. A combination of negative cytology and normal cystoscopy was associated with a negative biopsy in 94% of cases. A total of 970 bladder biopsies were taken, of which 137 (14%) were positive, including 20 of 125 erythematous lesions (16%), 73 of 107 tumors (68%) and 44 of 738 normal-appearing areas (6%). Cumulative analysis findings were comparable. Routine transurethral bladder biopsies after a bacillus Calmette-Guérin induction course are not necessary. An individually approach is recommended, tailored from cystoscopic findings and cytology. Copyright © 2013. Published by Elsevier Inc.

  17. Effect of Moringa oleifera bark extracts on dexamethasone-induced insulin resistance in rats.

    Science.gov (United States)

    Sholapur, H N; Patil, B M

    2013-10-01

    Experimental study has revealed the antidiabetic potentials of ethanolic extract of the bark of Moringa oleifera Lam., (Moringaceae), a multipurpose tree of south Asia. To investigate the effects of alcoholic and petroleum ether extracts of Moringa oleifera bark on acute and chronic insulin resistance induced by dexamethasone in rats. Dexamethasone (dexa) was administered for 11 days (1 mg/kg, s. c., once daily) and single dose (1 mg/kg, i. p.) to induce chronic and acute insulin resistance respectively. 2 doses each of alcoholic (AE125 and AE250 mg/kg) and petroleum ether extracts (PEE30 and PEE60 mg/kg) and single dose each of alcoholic (AE250 mg/kg) and petroleum ether extract (PEE 60 mg/kg) of Moringa oleifera bark were tested in chronic and acute studies. At the end of the studies fasting plasma glucose, triglyceride levels and oral glucose tolerance were measured. In chronic study, treatment of rats with AE125 and AE250 prevented dexamethasone-induced hypertriglyceridemia and oral glucose intolerance but not fasting hyperglycemia, whereas both PEE30 and PEE60 had no effects on any of these parameters measured except that significant reduction of triglyceride level was observed in PEE60 treated rats. Oral glucose intolerance induced by single dose administration of dexamethasone was prevented by AE250 but not by PEE60. In normal rats AE250 treatment improved the glucose tolerance, where as PEE60 had no effect on this parameter. The present study indicates that AE of Moringa oleifera prevents dexamethasone-induced insulin resistance in peripheral tissues. © Georg Thieme Verlag KG Stuttgart · New York.

  18. The Native Fruit Geoffroea decorticans from Arid Northern Chile: Phenolic Composition, Antioxidant Activities and In Vitro Inhibition of Pro-Inflammatory and Metabolic Syndrome-Associated Enzymes

    Directory of Open Access Journals (Sweden)

    Felipe Jiménez-Aspee

    2017-09-01

    Full Text Available The native tree Geoffroea decorticans (chañar grows in the arid lands of northern Chile. It has been used as a food plant since prehistoric times. Phenolic-enriched extracts (PEEs of Chilean chañar fruits were assessed for their chemical composition, antioxidant properties and inhibition of pro-inflammatory and metabolic syndrome-associated enzymes. Phenolic profiles were determined by HPLC-DAD-MS/MS. The PEEs of G. decorticans showed a strong effect towards the enzymes COX-1/COX-2, with inhibition percentages ranging from inactive to 92.1% and inactive to 76.0% at 50 µg PEE/mL, respectively. The IC50 values of the PEEs towards lipoxygenase and phospholipase A2 inhibitory activity were between 43.6–96.8 and 98.9–156.0 μg PEE/mL, respectively. Samples inhibited α-glucosidase (IC50 0.8–7.3 μg PEE/mL and lipase (9.9 to >100 μg PEE/mL. However, samples did not inhibit α-amylase. The HPLC-DAD-MS analysis of the PEEs allowed the tentative identification of 53 compounds, mainly flavonol glycosides and procyanidins. The procyanidin content of the Chilean G. decorticans pulp was positively correlated with the antioxidant activity and the inhibition of the enzyme α-glucosidase. These results indicate that the Chilean chañar fruit contains bioactive polyphenols with functional properties.

  19. Ethanolic extract of dandelion (Taraxacum mongolicum) induces estrogenic activity in MCF-7 cells and immature rats.

    Science.gov (United States)

    Oh, Seung Min; Kim, Ha Ryong; Park, Yong Joo; Lee, Yong Hwa; Chung, Kyu Hyuck

    2015-11-01

    Plants of the genus Taraxacum, commonly known as dandelions, are used to treat breast cancer in traditional folk medicine. However, their use has mainly been based on empirical findings without sufficient scientific evidence. Therefore, we hypothesized that dandelions would behave as a Selective estrogen receptor modulator (SERM) and be effective as hormone replacement therapy (HRT) in the postmenopausal women. In the present study, in vitro assay systems, including cell proliferation assay, reporter gene assay, and RT-PCR to evaluate the mRNA expression of estrogen-related genes (pS2 and progesterone receptor, PR), were performed in human breast cancer cells. Dandelion ethanol extract (DEE) significantly increased cell proliferation and estrogen response element (ERE)-driven luciferase activity. DEE significantly induced the expression of estrogen related genes such as pS2 and PR, which was inhibited by tamoxifen at 1 μmol·L(-1). These results indicated that DEE could induce estrogenic activities mediated by a classical estrogen receptor pathway. In addition, immature rat uterotrophic assay was carried out to identify estrogenic activity of DEE in vivo. The lowest concentration of DEE slightly increased the uterine wet weight, but there was no significant effect with the highest concentration of DEE. The results demonstrate the potential estrogenic activities of DEE, providing scientific evidence supporting their use in traditional medicine. Copyright © 2015 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  20. Improved Pruning algorithms and Divide-and-Conquer strategies for Dead-End Elimination, with application to protein design.

    Science.gov (United States)

    Georgiev, Ivelin; Lilien, Ryan H; Donald, Bruce R

    2006-07-15

    Structure-based protein redesign can help engineer proteins with desired novel function. Improving computational efficiency while still maintaining the accuracy of the design predictions has been a major goal for protein design algorithms. The combinatorial nature of protein design results both from allowing residue mutations and from the incorporation of protein side-chain flexibility. Under the assumption that a single conformation can model protein folding and binding, the goal of many algorithms is the identification of the Global Minimum Energy Conformation (GMEC). A dominant theorem for the identification of the GMEC is Dead-End Elimination (DEE). DEE-based algorithms have proven capable of eliminating the majority of candidate conformations, while guaranteeing that only rotamers not belonging to the GMEC are pruned. However, when the protein design process incorporates rotameric energy minimization, DEE is no longer provably-accurate. Hence, with energy minimization, the minimized-DEE (MinDEE) criterion must be used instead. In this paper, we present provably-accurate improvements to both the DEE and MinDEE criteria. We show that our novel enhancements result in a speedup of up to a factor of more than 1000 when applied in redesign for three different proteins: Gramicidin Synthetase A, plastocyanin, and protein G. Contact authors for source code.

  1. Predicting diffuse light-enhancement of GPP from plant functional traits: A multi-site synthesis

    Science.gov (United States)

    O'Halloran, T. L.; Barr, J. G.; Cook, B.; Goeckede, M.; Law, B. E.; Kueppers, L. M.; Riley, W. J.

    2013-12-01

    Diffuse light enhances canopy-scale photosynthesis because isotropic diffuse light penetrates deeper into the canopy, involves more leaf area in photosynthesis, and prevents the top of the canopy from becoming light saturated. However, the observational and modeling communities still have little understanding of how the 'Diffuse light Enhancement Effect' (DEE) varies across plant functional types or is constrained by factors such as nitrogen availability and plant structure. So far, variability in the strength of DEE across plant functional types (PFTs) remains poorly constrained, but canopy models indicate leaf area index (LAI) is a primary controller. While the very few existing multi-site, measurement-based syntheses of the DEE have provided valuable information on the variability of the DEE across a few plant functional types, no study has correlated measured metrics of DEE magnitude with direct measurements of canopy physical traits across a wide range of plant functional types. Here we report a new metric that is suitable for quantifying the DEE in both flux measurements and land surface models. We also present, for the first time, an examination of the relationship between the DEE metric and plant functional traits. Results from our 70+ site AmeriFlux and FLUXNET synthesis indicate that LAI is the strongest controller of the DEE across sites and PFTs, with less significant influences from foliar nitrogen, canopy height, and mean annual precipitation. Our results will enable direct evaluation and improvement of remote sensing algorithms and light use efficiency models (e.g. MODIS GPP), which to this point regard diffuse light fraction as a source of noise. Additionally, improving resolution of the DEE in prognostic land surface models, such as the Community Land Model (CLM), will greatly improve our ability to forecast future feedbacks to terrestrial carbon sequestration from changes in cloudiness and aerosol amount.

  2. Associations between Resting, Activity, and Daily Metabolic Rate in Free-Living Endotherms: No Universal Rule in Birds and Mammals.

    Science.gov (United States)

    Portugal, Steven J; Green, Jonathan A; Halsey, Lewis G; Arnold, Walter; Careau, Vincent; Dann, Peter; Frappell, Peter B; Grémillet, David; Handrich, Yves; Martin, Graham R; Ruf, Thomas; Guillemette, Magella M; Butler, Patrick J

    2016-01-01

    Energy management models provide theories and predictions for how animals manage their energy budgets within their energetic constraints, in terms of their resting metabolic rate (RMR) and daily energy expenditure (DEE). Thus, uncovering what associations exist between DEE and RMR is key to testing these models. Accordingly, there is considerable interest in the relationship between DEE and RMR at both inter- and intraspecific levels. Interpretation of the evidence for particular energy management models is enhanced by also considering the energy spent specifically on costly activities (activity energy expenditure [AEE] = DEE - RMR). However, to date there have been few intraspecific studies investigating such patterns. Our aim was to determine whether there is a generality of intraspecific relationships among RMR, DEE, and AEE using long-term data sets for bird and mammal species. For mammals, we use minimum heart rate (fH), mean fH, and activity fH as qualitative proxies for RMR, DEE, and AEE, respectively. For the birds, we take advantage of calibration equations to convert fH into rate of oxygen consumption in order to provide quantitative proxies for RMR, DEE, and AEE. For all 11 species, the DEE proxy was significantly positively correlated with the RMR proxy. There was also evidence of a significant positive correlation between AEE and RMR in all four mammal species but only in some of the bird species. Our results indicate there is no universal rule for birds and mammals governing the relationships among RMR, AEE, and DEE. Furthermore, they suggest that birds tend to have a different strategy for managing their energy budgets from those of mammals and that there are also differences in strategy between bird species. Future work in laboratory settings or highly controlled field settings can tease out the environmental and physiological processes contributing to variation in energy management strategies exhibited by different species.

  3. Development of a new propolis microemulsion system for topical applications

    Directory of Open Access Journals (Sweden)

    Tereza N. C. Dantas

    Full Text Available Microemulsion systems (MES offer advantages as drug delivery systems, among them favour drug absorption, being in most case more efficient than other methods in delivering of drug. In this work a new MES was obtained in order to be applied as a pressurized aerosol formulation containing bee propolis ethanolic extract (PEE. For that, pseudoternary phase diagrams were used to characterize the microemulsions boundaries and also to define the Winsor IV microemulsion region of the PEE-MES system containing Tween 80 as surfactant and the cosurfactant ethyl alcohol in small percentage. The obtained results indicated that the best MES was composed by Tween 80 and ethyl alcohol with C/S (cosurfactant/surfactant ratio equal to 1.0, since it provided a large boundaries in the obtained O/W microemulsion region. This PEE-MES formulation, in which bee propolis consisting as oil phase, is herein designed for topical uses (PEE-MES spraying in order to treat mouth and throat inflammatory infections. Considering the very large uses of bee propolis in conventional vehicles, MES type of delivery system has to be compatible with achieving the highest drug aim loadings, determined substantially by the specific MES application (drug solubilization in water systems improving in this case, propolis farmacological aplications. Additionally, PEE-MES antibacterial effect was evidenced and the microemulsion system PEE-MES was also used as newest chemical approach for extraction of bee propolis material from resinous hive.

  4. Enriquecimento e alocação de 13C em plantas de eucalipto

    Directory of Open Access Journals (Sweden)

    Daniel Nolasco Machado

    2011-06-01

    Full Text Available Nas últimas décadas, a utilização de isótopos estáveis em várias áreas de pesquisa vem se destacando, como na análise de fluxos e rotas metabólicas, análise de efeitos de estresses em plantas e, em grande escala, no estudo da matéria orgânica do solo (MOS. Estudos de alterações e dinâmica da MOS usando a variação da abundância natural do 13C requerem mudanças na razão isotópica do C. Quando não existe essa possibilidade, uma das alternativas é enriquecer o material vegetal (planta com 13C, via fixação de 13CO2, de modo que a razão isotópica seja distinta daquela da MOS original. O objetivo deste trabalho foi investigar a magnitude e a homogeneidade do enriquecimento em 13C em diferentes componentes da planta de eucalipto. No processo de marcação, três plantas de eucalipto, com 4 meses de idade, cultivadas em solução nutritiva foram expostas a uma atmosfera enriquecida com 13CO2, em uma câmara de vidro (448 dm³, com temperatura em torno de 24 ºC. A concentração de CO2 e a razão 13C/12C foram monitoradas por um espectrômetro de massa de razão isotópica (IRMS em amostras de ar retiradas ao longo do processo (126 dias com três pulsos de 13CO2 semanais. Após o período de marcação, as plantas foram separadas em folha (folha-fonte e folha-dreno, galho, casca, lenho e raiz e analisadas em IRMS. O resultado foi expresso em partes por mil (‰ em relação ao padrão internacional de C denominado Pee-Dee Belemnite (PDB, obtendo-se a δ13C PDB delas: folha-fonte (828,07 ‰, folha-dreno (645,72 ‰, galho (672,49 ‰, casca (691,86 ‰, lenho (632,02 ‰ e raiz (536,55 ‰. O padrão de alocação e enriquecimento de 13C entre os componentes das plantas foi homogêneo, embora com diferenças numéricas da ordem de 291 ‰ na δ13C PDB. As plantas de eucalipto mantiveram alta taxa de absorção de CO2 e, consequentemente, alta taxa fotossintética em concentrações de CO2 muito acima (180,4 mmol L-1 - 7

  5. Historisches Archiv der Veterinärmedizinischen Universität Wien

    Directory of Open Access Journals (Sweden)

    Ráczová, Zuzana

    2017-09-01

    Full Text Available The University of Veterinary Medicine Vienna was founded by Maria Theresia in 1765. The rich history of the institution is mirrored in the Historical Archive of the University of Veterinary Medicine Vienna and its collections.

  6. Factors influencing the use of magnesium sulphate in pre-eclampsia/eclampsia management in health facilities in Northern Nigeria: a mixed methods study.

    Science.gov (United States)

    Oguntunde, Olugbenga; Charyeva, Zulfiya; Cannon, Molly; Sambisa, William; Orobaton, Nosakhare; Kabo, Ibrahim A; Shoretire, Kamil; Danladi, Saba'atu E; Lawal, Nurudeen; Sadauki, Habib

    2015-06-03

    Eclampsia remains a major cause of perinatal and maternal morbidity and mortality worldwide. We examined facilitators and barriers to the use of magnesium sulphate (MgSO4) in the management of pre-eclampsia/eclampsia (PE/E) in health facilities in Bauchi and Sokoto States in Nigeria. Data were collected from 80 health facilities using a cross-sectional, mixed method (quantitative and qualitative) design. We assessed health facility readiness to manage PE/E and use MgSO4 as the drug of choice, through provider interviews, in-depth interviews with facility managers and an inventory of equipment and supply in facilities. Bivariate and qualitative data analyses were performed to isolate the principal enabling factors and barriers to the management of PE/E and use of MgSO4. The majority of health facility providers correctly mentioned MgSO4 as the drug of choice for the prevention and termination of convulsions in severe PE/E (65 %). Sixty-four percent of the health facilities had service registers available. About 45 % of providers had been trained on the use of MgSO4 for the management of PE/E. Regarding providers' practices, 45 % of respondents indicated that MgSO4 was used to prevent and treat convulsions in severe PE/E in their facilities. Barriers to management of PE/E included inadequate numbers of skilled providers, frequent shortages of MgSO4, lack of essential equipment and supplies, irregular supply of electricity and water, and non-availability of guidelines and clinical protocols at the health facilities. Technical support to providers was inadequate. The study revealed that a constellation of factors adversely affect the management of PE/E and especially the use of MgSO4 by service providers. Efforts to improve the management of PE/E in facilities should include integrated programs that substantially improve provider and facility readiness to manage PE/E for better maternal and newborn health outcomes in Northern Nigeria.

  7. 2017-10-07T23:18:58Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    The Intercontinental Schizophrenia Outpatient Health Outcomes Study Treuer, Tamas; Eli Lilly Regional Operations, Vienna, Austria; Dozzenbach, Martin; Eli Lilly Regional Operations, Vienna, Austria; Bitter, Istvan; Eli Lilly Regional Operations, Vienna, Austria; Birsöz, Sunar; Akdeniz University, Antalya, Turkey Belaid, ...

  8. Toward SC2

    CERN Multimedia

    1975-01-01

    Internal view of the housing of the rotary condenser, of the sixteen sets of shaped stator blades (external conductor) and of the stationary disk of gap capacitor(internal conductor), with sign of discharges . (Camera is directed to the dee)

  9. What's Sweat?

    Science.gov (United States)

    ... Weight for Me? Your Teeth Heart Murmurs What's Sweat? KidsHealth > For Kids > What's Sweat? Print A A ... dehydrated (say: dee-HI-drayt-ed). Why Does Sweat Smell? Sweat isn't just wet — it can ...

  10. Daily energy expenditure, physical activity, and weight loss in Parkinson's disease patients

    Science.gov (United States)

    Patients with Parkinson's disease (PD) commonly exhibit weight loss (WL) which investigators attribute to various factors, including elevated energy expenditure. We tested the hypothesis that daily energy expenditure (DEE) and its components, resting energy expenditure (REE) and physical activity (P...

  11. Balance Disorders

    Science.gov (United States)

    ... rate and blood pressure, and fear, anxiety, or panic. Symptoms may come and go over short time ... perilymph fistula. Mal de Debarquement [dee-BARK-ment] syndrome (MdDS): A feeling of continuously rocking or bobbing, ...

  12. 76 FR 23286 - North American Free Trade Agreement (NAFTA), Article 1904 Binational Panel Reviews: Notice of...

    Science.gov (United States)

    2011-04-26

    ... International Trade Administration North American Free Trade Agreement (NAFTA), Article 1904 Binational Panel Reviews: Notice of Completion of Panel Review AGENCY: NAFTA Secretariat, United States Section...: Valerie Dees, United States Secretary, NAFTA Secretariat, Suite 2061, 14th and Constitution Avenue...

  13. EXPERIMENTAL INVESTIGATIONS OF REAL TIME SECONDARY CO-INJECTION OF WATER – DIETHYL ETHER SOLUTION IN DI-DIESEL ENGINE FUELLED WITH PALM KERNEL METHYL ESTER

    Directory of Open Access Journals (Sweden)

    Y. V. V. SATYANARAYANAMURTHY

    2012-12-01

    Full Text Available In this investigation tests were conducted on single cylinder diesel engine fuelled with neat diesel and biodiesel palm kernel methyl ester as a base line fuel with secondary injection of Water-DEE solution through the inlet manifold. A real time control systems consists of electronic unit pump that delivers 5% to 25% vol. Water-DEE solution through injector tip mounted nearer to the inlet manifold under a pressure of 3 kgf/cm2. NOx emissions reduced to a level of 500 ppm with simultaneous reduction of soot especially for PKME. However for 15% vol. of Water-DEE injection the HC emissions are closely tallying with that of neat diesel. A global overview of the results has shown that the 15% Water-DEE solution is the optimal blend based on performance and emission characteristics.

  14. Model for teaching distributed computing in a distance-based educational environment

    CSIR Research Space (South Africa)

    le Roux, P

    2010-10-01

    Full Text Available , teaching students in these new technologies remains a challenge. Even though several models for teaching computer programming and teaching programming in a distance-based educational environment (DEE) exist, limited literature is available on models...

  15. Daily energy expenditure and physical activity measured in Parkinson's disease patients with and without weight loss

    Science.gov (United States)

    Patients with Parkinson's disease (PD) commonly exhibit weight loss, which investigators attribute to various factors, including elevated resting energy expenditure. We tested the hypothesis that daily energy expenditure (DEE) and its components, resting energy expenditure (REF) and physical activit...

  16. Comment on the Nanoparticle Conclusions in Crüts et al. (2008, "Exposure to diesel exhaust induces changes in EEG in human volunteers"

    Directory of Open Access Journals (Sweden)

    Long Christopher M

    2008-07-01

    Full Text Available Abstract A recent publication in this journal reported interesting changes in electroencephalographic (EEG waves that occurred in 10 young, male volunteers following inhalation for one hour of elevated levels of diesel-engine exhaust fumes 1. The authors then proposed a chain of causal events that they hypothesized underlay their observed EEG changes. Their reasoning linked the observed results to nanoparticles in diesel-engine exhaust (DEE, and went on to suggest that associations between changes in ambient particulate matter (PM levels and changes in health statistics might be due to the effects of diesel-engine exhaust (DEE nanoparticles on EEG. We suggest that the extrapolations of the Crüts et al. EEG findings to casual mechanisms about how ambient levels of DEE particulate might affect electrical signals in the brain, and subsequently to how DEE particulate might alter disease risk, are premature.

  17. The biological control of voluntary exercise, spontaneous physical activity and daily energy expenditure in relation to obesity : human and rodent perspectives

    NARCIS (Netherlands)

    Garland, Theodore; Schutz, Heidi; Chappell, Mark A.; Keeney, Brooke K.; Meek, Thomas H.; Copes, Lynn E.; Acosta, Wendy; Drenowatz, Clemens; Maciel, Robert C.; van Dijk, Gertjan; Kotz, Catherine M.; Eisenmann, Joey C.; Garland, Jr.

    Mammals expend energy in many ways, including basic cellular maintenance and repair, digestion, thermoregulation, locomotion, growth and reproduction. These processes can vary tremendously among species and individuals, potentially leading to large variation in daily energy expenditure (DEE).

  18. Mutations of PTPN23 in developmental and epileptic encephalopathy

    KAUST Repository

    Sowada, Nadine

    2017-10-31

    Developmental and epileptic encephalopathies (DEE) are a heterogeneous group of neurodevelopmental disorders with poor prognosis. Recent discoveries have greatly expanded the repertoire of genes that are mutated in epileptic encephalopathies and DEE, often in a de novo fashion, but in many patients, the disease remains molecularly uncharacterized. Here, we describe a new form of DEE in patients with likely deleterious biallelic variants in PTPN23. The phenotype is characterized by early onset drug-resistant epilepsy, severe and global developmental delay, microcephaly, and sometimes premature death. PTPN23 encodes a tyrosine phosphatase with strong brain expression, and its knockout in mouse is embryonically lethal. Structural modeling supports a deleterious effect of the identified alleles. Our data suggest that PTPN23 mutations cause a rare severe form of autosomal-recessive DEE in humans, a finding that requires confirmation.

  19. Saksamaa teatrilavadel taas 1920. aastad / Erkki Otsman

    Index Scriptorium Estoniae

    Otsman, Erkki, 1966-

    2006-01-01

    Berliinis ja Hamburgis nähtud kabaree-etendustest : Bertolt Brechti "Kolmekrossiooper" Berliini uues teater-kontserdisaalis Admiralspalast (lavastaja Klaus Maria Brandauer), Max Raabe ja Palast Orchesteri kontsertetendus "Palast Revue" Hamburgi Thalia teatris, Georgette Dee kontsert Brechti lauludest

  20. Diethyl Ether as an Ignition Enhancer for Naphtha Creating a Drop in Fuel for Diesel

    KAUST Repository

    Vallinayagam, R.

    2016-12-01

    Direct use of naphtha in compression ignition (CI) engines is not advisable because its lower cetane number negatively impacts the auto ignition process. However, engine or fuel modifications can be made to operate naphtha in CI engines. Enhancing a fuel’s auto ignition characteristics presents an opportunity to use low cetane fuel, naphtha, in CI engines. In this research, Di-ethyl ether (DEE) derived from ethanol is used as an ignition enhancer for light naphtha. With this fuel modification, a “drop-in” fuel that is interchangeable with existing diesel fuel has been created. The ignition characteristics of DEE blended naphtha were studied in an ignition quality tester (IQT); the measured ignition delay time (IDT) for pure naphtha was 6.9 ms. When DEE was added to naphtha, IDT decreased and D30 (30% DEE + 70% naphtha) showed comparable IDT with US NO.2 diesel. The derived cetane number (DCN) of naphtha, D10 (10% DEE + 90% naphtha), D20% DEE + 80% naphtha) and D30 were measured to be 31, 37, 40 and 49, respectively. The addition of 30% DEE in naphtha achieved a DCN equivalent to US NO.2 diesel. Subsequent experiments in a CI engine exhibited longer ignition delay for naphtha compared to diesel. The peak in-cylinder pressure is higher for naphtha than diesel and other tested fuels. When DEE was added to naphtha, the ignition delay shortened and peak in-cylinder pressure is reduced. A 3.7% increase in peak in-cylinder pressure was observed for naphtha compared to US NO.2 diesel, while D30 showed comparable results with diesel. The pressure rise rate dropped with the addition of DEE to naphtha, thereby reducing the ringing intensity. Naphtha exhibited a peak heat release rate of 280 kJ/m3deg, while D30 showed a comparable peak heat release rate to US NO.2 diesel. The amount of energy released during the premixed combustion phase decreased with the increase of DEE in naphtha. Thus, this study demonstrates the suitability of DEE blended naphtha mixtures as a

  1. Improving Vegetable Oil Fueled CI Engine Characteristics Through Diethyl Ether Blending

    KAUST Repository

    Vedharaj, S.

    2016-12-01

    In this research, the flow and ignition properties of vegetable oil (VO) are improved by blending it with diethyl ether (DEE). DEE, synthesized from ethanol, has lower viscosity than diesel and VO. When DEE is blended with VO, the resultant DEEVO mixtures have favorable properties for compression ignition (CI) engine operation. As such, DEEVO20 (20% DEE + 80% VO) and DEEVO40 (40% DEE + 60% VO) were initially considered in the current study. The viscosity of VO is 32.4*10−6 m2/s; the viscosity is reduced with the increase of DEE in VO. In this study, our blends were limited to a maximum of 40% DEE in VO. The viscosity of DEEVO40 is 2.1*10−6 m2/s, which is comparable to that of diesel (2.3*10−6 m2/s). The lower boiling point and flash point of DEE improves the fuel spray and evaporation for DEEVO mixtures. In addition to the improvement in physical properties, the ignition quality of DEEVO mixtures is also improved, as DEE is a high cetane fuel (DCN = 139). The ignition characteristics of DEEVO mixtures were studied in an ignition quality tester (IQT). There is an evident reduction in ignition delay time (IDT) for DEEVO mixtures compared to VO. The IDT of VO (4.5 ms), DEEVO20 (3.2 ms) and DEEVO40 (2.7 ms) was measured in IQT. Accordingly, the derived cetane number (DCN) of DEEVO mixtures increased with the increase in proportion of DEE. The reported mixtures were also tested in a single cylinder CI engine. The start of combustion (SOC) was advanced for DEEVO20 and DEEVO40 compared to diesel, which is attributed to the high DCN of DEEVO mixtures. On the other hand, the peak heat release rate decreased for DEEVO mixtures compared to diesel. Gaseous emissions such as nitrogen oxide (NOX), total hydrocarbon (THC) and smoke were reduced for DEEVO mixtures compared to diesel. The physical and ignition properties of VO are improved by the addition of DEE, and thus, the need for the trans-esterification process is averted. Furthermore, this blending strategy is simpler

  2. Bagatellid : Maailm / Nele-Eva Steinfeld, Ivo Heinloo

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2010-01-01

    Muusikasõnumeid maailmast: ECHO Klassik aasta dirigent on Paavo Järvi. Lahkus tunnustatud dirigent Charles Mackerras (1925-2010).Kristjan Järvi sõlmis lepingu plaadifirmaga Sony Classical. Kuninganna Elisabethi konkursi võitis pianist Denis Kozhukhin. Suri pianist Yvonne Loriod (1924-2010). Mary J. Blige kehastab filmis Nina Simone'i. Suri Hank Jones. Dee Dee Bridgewater tähistab juubelit erilise albumiga. Prince plaanib korraldada jazzifestivali

  3. Experimental and Numerical Investigation of Ethanol/Diethyl Ether Mixtures in a CI Engine

    KAUST Repository

    Sivasankaralingam, Vedharaj

    2016-10-17

    The auto-ignition characteristics of diethyl ether (DEE)/ethanol mixtures are investigated in compression ignition (CI) engines both numerically and experimentally. While DEE has a higher derived cetane number (DCN) of 139, ethanol exhibits poor ignition characteristics with a DCN of 8. DEE was used as an ignition promoter for the operation of ethanol in a CI engine. Mixtures of DEE and ethanol (DE), i.e., DE75 (75% DEE + 25% ethanol), DE50 (50% DEE + 50% ethanol) and DE25 (25% DEE + 75% ethanol), were tested in a CI engine. While DE75 and DE50 auto-ignited at an inlet air pressure of 1.5 bar, DE25 failed to auto-ignite even at boosted pressure of 2 bar. The peak in-cylinder pressure for diesel and DE75 were comparable, while DE50 showed reduced peak in-cylinder pressure with delayed start of combustion (SOC). Numerical simulations were conducted to study the engine combustion characteristics of DE mixture. A comprehensive detailed chemical kinetic model was created to represent the combustion of DE mixtures. The detailed mechanism was then reduced using standard direct relation graph (DRG-X) method and coupled with 3D CFD code, CONVERGE, to simulate the experimental data. The simulation results showed that the effects of physical properties on DE50 combustion are negligible. Simulations of DE50 mixture revealed that the combustion is nearly homogenous, while diesel (n-heptane used as a surrogate) and DE75 showed similar combustion behavior with flame liftoff and diffusion controlled combustion. Diesel exhibited auto-ignition at an equivalence ratio of 2, while DE75 and DE50 showed auto-ignition in the equivalence ratio range of 1-1.5 and 0-1, respectively. The experiments and numerical simulations demonstrate how the high reactivity of DEE supports the auto-ignition of ethanol, while ethanol acts as a radical scavenger.

  4. Associations between DNA methylation in DNA damage response-related genes and cytokinesis-block micronucleus cytome index in diesel engine exhaust-exposed workers.

    Science.gov (United States)

    Zhang, Xiao; Li, Jie; He, Zhini; Duan, Huawei; Gao, Weimin; Wang, Haisheng; Yu, Shanfa; Chen, Wen; Zheng, Yuxin

    2016-08-01

    Recently, diesel engine exhaust (DEE) was reclassified as a known carcinogen to humans. DNA methylation alterations in DNA damage response (DDR)-related genes have the potential to affect DEE exposure-related cancer risk. However, the evidence regarding the association between DEE exposure and methylation alterations in DDR-related genes is limited. In 117 DEE-exposed workers and 112 non-DEE-exposed workers, we measured urinary concentrations of six mono-hydroxylated polycyclic aromatic hydrocarbons (OH-PAHs). We also determined the methylation levels of three DDR-related genes (p16, RASSF1A, and MGMT) and LINE-1 by bisulfite-pyrosequencing assay. We found that DEE-exposed workers exhibited significantly lower mean promoter methylation levels of p16, RASSF1A, and MGMT than non-DEE-exposed workers (all p methylation in p16, RASSF1A, and MGMT decreased by 0.36 % [95 % confidential interval (CI): -0.60, -0.11 %], 0.46 % (95 % CI: -0.79, -0.14 %), and 0.55 % (95 % CI: -0.95, -0.15 %), respectively, in association with highest versus lowest quartile of urinary summed OH-PAHs. In addition, p16, RASSF1A, MGMT, and LINE-1 methylation levels showed negative correlations with cytokinesis-block micronucleus cytome index which was previously measured in the same workers (all p < 0.05). In conclusion, our results clearly indicated that DEE exposure and increased genetic damage were associated with hypomethylation of p16, RASSF1A, and MGMT. Future studies with larger sample size are needed to confirm these associations.

  5. Artificial Light at Night Reduces Daily Energy Expenditure in Breeding Great Tits (Parus major)

    OpenAIRE

    Welbers, Anouk A. M. H.; van Dis, Natalie E.; Kolvoort, Anne M.; Ouyang, Jenny; Visser, Marcel E.; Spoelstra, Kamiel; Davide M. Dominoni

    2017-01-01

    The ecological impact of artificial light at night (ALAN) is an increasingly recognized process that accompanies expanding urbanization. Yet, we have limited knowledge on the impact of ALAN on wild species, and on the potential to mitigate any negative effects by using different light sources and colors. In birds, effects of ALAN on activity levels are reported for several species and, hence, their daily energy expenditure (DEE) may be affected. DEE is a potent mediator of life-history trade-...

  6. UPPER TROPOSPHERIC ND STR TOSPHERIC OZONE OVER ...

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... from ERA-interim, gridded at 0.75 degree resolution (Dee et al., 2011) was used in this study to ..... A.H. (2009). Increasing ozone in marine boundary layer inflow at the west coasts of North America and. Europe. Atmospheric Chemistry and. Physics,. 9:1303-1323, doi:10.5194/acp-9-1303-2009. Dee, D.P. ...

  7. Energetics in Homo erectus and other early hominins: the consequences of increased lower-limb length.

    Science.gov (United States)

    Steudel-Numbers, Karen L

    2006-11-01

    Previous studies of daily energy expenditure (DEE) in hominin fossils have estimated locomotor costs using a formula that was based on six species, all 18 kg or less in mass, including no primates, and that has a number of other problems when applied in an ecological context. It is well established that the energetic cost of human walking is lower than that of representative mammals, particularly for individuals with long lower limbs. The current study reevaluates the daily energy expenditures of a variety of hominin species using more appropriate approaches to estimating locomotor costs. To estimate DEE for primates, I relied on published data on body mass, day range, and the percentage of time spent in various activities. Based on those data, I calculated a value for nonlocomotor DEE. I then used a variant of a method that I have suggested elsewhere to calculate the daily cost due to locomotion (DEEL) and summed the two to calculate total DEE. The more up-to-date methods for calculating the cost of travel result in lower estimates of this aspect of the energy budget than seen in previous studies. Values obtained here for DEE in various representatives of Australopithecus are lower than reported previously by around 200 kcal/day. Taking into account the greater economy of human walking, particularly the effect of the longer lower limbs found in many later Homo species, also results in lowered estimates of DEE. Elongation of the lower limbs in H. erectus reduced relative travel costs nearly 50% in comparison to A.L. 288-1 (A. afarensis). The present method for calculating DEE indicates that female H. erectus DEE was 84% greater than that of female Australopithecus; this disparity is even larger than that suggested by previous workers.

  8. High Rate of Recurrent De Novo Mutations in Developmental and Epileptic Encephalopathies.

    Science.gov (United States)

    Hamdan, Fadi F; Myers, Candace T; Cossette, Patrick; Lemay, Philippe; Spiegelman, Dan; Laporte, Alexandre Dionne; Nassif, Christina; Diallo, Ousmane; Monlong, Jean; Cadieux-Dion, Maxime; Dobrzeniecka, Sylvia; Meloche, Caroline; Retterer, Kyle; Cho, Megan T; Rosenfeld, Jill A; Bi, Weimin; Massicotte, Christine; Miguet, Marguerite; Brunga, Ledia; Regan, Brigid M; Mo, Kelly; Tam, Cory; Schneider, Amy; Hollingsworth, Georgie; FitzPatrick, David R; Donaldson, Alan; Canham, Natalie; Blair, Edward; Kerr, Bronwyn; Fry, Andrew E; Thomas, Rhys H; Shelagh, Joss; Hurst, Jane A; Brittain, Helen; Blyth, Moira; Lebel, Robert Roger; Gerkes, Erica H; Davis-Keppen, Laura; Stein, Quinn; Chung, Wendy K; Dorison, Sara J; Benke, Paul J; Fassi, Emily; Corsten-Janssen, Nicole; Kamsteeg, Erik-Jan; Mau-Them, Frederic T; Bruel, Ange-Line; Verloes, Alain; Õunap, Katrin; Wojcik, Monica H; Albert, Dara V F; Venkateswaran, Sunita; Ware, Tyson; Jones, Dean; Liu, Yu-Chi; Mohammad, Shekeeb S; Bizargity, Peyman; Bacino, Carlos A; Leuzzi, Vincenzo; Martinelli, Simone; Dallapiccola, Bruno; Tartaglia, Marco; Blumkin, Lubov; Wierenga, Klaas J; Purcarin, Gabriela; O'Byrne, James J; Stockler, Sylvia; Lehman, Anna; Keren, Boris; Nougues, Marie-Christine; Mignot, Cyril; Auvin, Stéphane; Nava, Caroline; Hiatt, Susan M; Bebin, Martina; Shao, Yunru; Scaglia, Fernando; Lalani, Seema R; Frye, Richard E; Jarjour, Imad T; Jacques, Stéphanie; Boucher, Renee-Myriam; Riou, Emilie; Srour, Myriam; Carmant, Lionel; Lortie, Anne; Major, Philippe; Diadori, Paola; Dubeau, François; D'Anjou, Guy; Bourque, Guillaume; Berkovic, Samuel F; Sadleir, Lynette G; Campeau, Philippe M; Kibar, Zoha; Lafrenière, Ronald G; Girard, Simon L; Mercimek-Mahmutoglu, Saadet; Boelman, Cyrus; Rouleau, Guy A; Scheffer, Ingrid E; Mefford, Heather C; Andrade, Danielle M; Rossignol, Elsa; Minassian, Berge A; Michaud, Jacques L

    2017-11-02

    Developmental and epileptic encephalopathy (DEE) is a group of conditions characterized by the co-occurrence of epilepsy and intellectual disability (ID), typically with developmental plateauing or regression associated with frequent epileptiform activity. The cause of DEE remains unknown in the majority of cases. We performed whole-genome sequencing (WGS) in 197 individuals with unexplained DEE and pharmaco-resistant seizures and in their unaffected parents. We focused our attention on de novo mutations (DNMs) and identified candidate genes containing such variants. We sought to identify additional subjects with DNMs in these genes by performing targeted sequencing in another series of individuals with DEE and by mining various sequencing datasets. We also performed meta-analyses to document enrichment of DNMs in candidate genes by leveraging our WGS dataset with those of several DEE and ID series. By combining these strategies, we were able to provide a causal link between DEE and the following genes: NTRK2, GABRB2, CLTC, DHDDS, NUS1, RAB11A, GABBR2, and SNAP25. Overall, we established a molecular diagnosis in 63/197 (32%) individuals in our WGS series. The main cause of DEE in these individuals was de novo point mutations (53/63 solved cases), followed by inherited mutations (6/63 solved cases) and de novo CNVs (4/63 solved cases). De novo missense variants explained a larger proportion of individuals in our series than in other series that were primarily ascertained because of ID. Moreover, these DNMs were more frequently recurrent than those identified in ID series. These observations indicate that the genetic landscape of DEE might be different from that of ID without epilepsy. Copyright © 2017 American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  9. Physical activity energy expenditure has not declined since the 1980s and matches energy expenditures of wild mammals.

    Science.gov (United States)

    Westerterp, K R; Speakman, J R

    2008-08-01

    Obesity results from protracted energy imbalance. Whether this comprises excessive energy intake, lowered physical activity or both, remains disputed. Physical activity energy expenditure, evaluated in three different ways from daily energy expenditure (DEE) measured using doubly labelled water, was examined for trends over time. Data included subjects in Europe (Maastricht, the Netherlands) and North America extending back to the 1980s. These data were compared with measures from the third world, and measures made on wild terrestrial mammals. Physical activity expenditure in Europe (residual of the regression of DEE on basal energy expenditure (BEE)) has slightly but significantly increased since the 1980s. There was no trend over time in physical activity level (PAL=DEE/BEE), or in the residual variance in DEE once mass, sex and age were accounted for. This latter index of physical activity expenditure also significantly increased over time in North America. DEE of individuals in Europe and North America was not significantly different from individuals measured in the third world. In wild terrestrial mammals, DEE mostly depended on body mass and ambient temperature. Predicted DEE for a 78 kg mammal living at 20 degrees C was 9.2 MJ per day (95% CI: 7.9-12.9 MJ per day), not significantly different from the measured DEE of modern humans (around 10.2-12.6 MJ per day). As physical activity expenditure has not declined over the same period that obesity rates have increased dramatically, and daily energy expenditure of modern man is in line with energy expenditure in wild mammals, it is unlikely that decreased expenditure has fuelled the obesity epidemic.

  10. Occupational exposure to diesel engine exhaust and serum cytokine levels.

    Science.gov (United States)

    Dai, Yufei; Ren, Dianzhi; Bassig, Bryan A; Vermeulen, Roel; Hu, Wei; Niu, Yong; Duan, Huawei; Ye, Meng; Meng, Tao; Xu, Jun; Bin, Ping; Shen, Meili; Yang, Jufang; Fu, Wei; Meliefste, Kees; Silverman, Debra; Rothman, Nathaniel; Lan, Qing; Zheng, Yuxin

    2017-10-12

    The International Agency for Research on Cancer has classified diesel engine exhaust (DEE) as a human lung carcinogen. Given that inflammation is suspected to be an important underlying mechanism of lung carcinogenesis, we evaluated the relationship between DEE exposure and the inflammatory response using data from a cross-sectional molecular epidemiology study of 41 diesel engine testing workers and 46 unexposed controls. Repeated personal exposure measurements of PM2.5 and other DEE constituents were taken for the diesel engine testing workers before blood collection. Serum levels of six inflammatory biomarkers including interleukin (IL)-1, IL-6, IL-8, tumor necrosis factor (TNF)-α, macrophage inflammatory protein (MIP)-1β, and monocyte chemotactic protein (MCP)-1 were analyzed in all subjects. Compared to unexposed controls, concentrations of MIP-1β were significantly reduced by ∼37% in DEE exposed workers (P 397 µg/m3 ) compared to unexposed controls. Further, significant inverse exposure-response relationships for IL-8 and MCP-1 were also found in relation to increasing PM2.5 levels among the DEE exposed workers. Given that IL-8, MIP-1β, and MCP-1 are chemokines that play important roles in recruitment of immunocompetent cells for immune defense and tumor cell clearance, the observed lower levels of these markers with increasing PM2.5 exposure may provide insight into the mechanism by which DEE promotes lung cancer. Environ. Mol. Mutagen., 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  11. Thyroid hormones correlate with resting metabolic rate, not daily energy expenditure, in two charadriiform seabirds

    Directory of Open Access Journals (Sweden)

    Kyle H. Elliott

    2013-04-01

    Thyroid hormones affect in vitro metabolic intensity, increase basal metabolic rate (BMR in the lab, and are sometimes correlated with basal and/or resting metabolic rate (RMR in a field environment. Given the difficulty of measuring metabolic rate in the field—and the likelihood that capture and long-term restraint necessary to measure metabolic rate in the field jeopardizes other measurements—we examined the possibility that circulating thyroid hormone levels were correlated with RMR in two free-ranging bird species with high levels of energy expenditure (the black-legged kittiwake, Rissa tridactyla, and thick-billed murre, Uria lomvia. Because BMR and daily energy expenditure (DEE are purported to be linked, we also tested for a correlation between thyroid hormones and DEE. We examined the relationships between free and bound levels of the thyroid hormones thyroxine (T4 and triiodothyronine (T3 with DEE and with 4-hour long measurements of post-absorptive and thermoneutral resting metabolism (resting metabolic rate; RMR. RMR but not DEE increased with T3 in both species; both metabolic rates were independent of T4. T3 and T4 were not correlated with one another. DEE correlated with body mass in kittiwakes but not in murres, presumably owing to the larger coefficient of variation in body mass during chick rearing for the more sexually dimorphic kittiwakes. We suggest T3 provides a good proxy for resting metabolism but not DEE in these seabird species.

  12. Genotype by Energy Expenditure Interaction and Body Composition Traits: The Portuguese Healthy Family Study

    Directory of Open Access Journals (Sweden)

    D. M. Santos

    2014-01-01

    Full Text Available Background and Aims. Energy expenditure has been negatively correlated with fat accumulation. However, this association is highly variable. In the present study we applied a genotype by environment interaction method to examine the presence of Genotype x by Total Daily Energy Expenditure and Genotype x by Daily Energy Expenditure interactions in the expression of different body composition traits. Methods and Results. A total of 958 subjects from 294 families of The Portuguese Healthy Family Study were included in the analysis. TDEE and DEE were assessed using a physical activity recall. Body fat percentages were measured with a bioelectrical impedance scale. GxTDEE and GxDEE examinations were performed using SOLAR 4.0 software. All BC traits were significantly heritable, with heritabilities ranging from 21% to 34%. The GxTDEE and GxDEE interaction models fitted the data better than the polygenic model for all traits. For all traits, a significant GxTDEE and GxDEE interaction was due to variance heterogeneity among distinct levels of TDEE and DEE. For WC, GxTDEE was also significant due to the genetic correlation function. Conclusions. TDEE and DEE are environmental constraints associated with the expression of individuals’ BC genotypes, leading to variability in the phenotypic expression of BC traits.

  13. Non-Thermal Plasma Combined with Cordierite-Supported Mn and Fe Based Catalysts for the Decomposition of Diethylether

    Directory of Open Access Journals (Sweden)

    Quang Hung Trinh

    2015-04-01

    Full Text Available The removal of dilute diethylether (DEE, concentration: 150 ppm from an air stream (flow rate: 1.0 L min−1 using non-thermal plasma combined with different cordierite-supported catalysts, including Mn, Fe, and mixed Mn-Fe oxides, was investigated. The experimental results showed that the decomposition of DEE occurred in a one-stage reactor without the positive synergy of plasma and supported catalysts, by which ca. 96% of DEE was removed at a specific input energy (SIE of ca. 600 J L−1, except when the mixed Mn-Fe/cordierite was used. Among the catalysts that were examined, Mn-Fe/cordierite, the catalyst that was the most efficient at decomposing ozone was found to negatively affect the decomposition of DEE in the one-stage reactor. However, when it was utilized as a catalyst in the post-plasma stage of a two-part hybrid reactor, in which Mn/cordierite was directly exposed to the plasma, the reactor performance in terms of DEE decomposition efficiency was improved by more than 10% at low values of SIE compared to the efficiency that was achieved without Mn-Fe/cordierite. The ozone that was formed during the plasma stage and its subsequent catalytic dissociation during the post-plasma stage to produce atomic oxygen therefore played important roles in the removal of DEE.

  14. Association between the Fatty Liver Index and Risk of Type 2 Diabetes in the EPIC-Potsdam Study.

    Science.gov (United States)

    Jäger, Susanne; Jacobs, Simone; Kröger, Janine; Stefan, Norbert; Fritsche, Andreas; Weikert, Cornelia; Boeing, Heiner; Schulze, Matthias B

    2015-01-01

    The fatty liver index (FLI) predicts fatty liver by using BMI, waist circumference, γ-glutamyltransferase and triglycerides. We investigated the association between the FLI and the risk of type 2 diabetes and evaluated to what extent single FLI components contribute to the diabetes risk. We analysed a case-cohort study (random sub-cohort: 1922; incident cases: 563) nested within the European Prospective Investigation into Cancer and Nutrition (EPIC)-Potsdam study. The proportion of exposure effect (PEE) explained by single FLI components was evaluated and effect decomposition using inverse probability weighting (IPW) was applied. Women and men with a FLI ≥ 60 compared to those with a FLI < 30 had a multivariable-adjusted Hazard Ratio (HR) of 17.6; 95% confidence interval (CI) 11.1-28.0 and HR: 10.9; 95% CI 6.22-19.2, respectively. Adjustment for BMI or waist circumference attenuated this association in men [PEE BMI (95% CI) = 53.8% (43.9%-65.8%); PEE waist (95% CI) = 54.8% (44.2%-68.8%)]. In women, adjustment for waist circumference attenuated the association to a lesser degree than in men [PEE waist (95% CI) = 31.1%; (21.9%-43.1%)] while BMI had no appreciable effect [PEE BMI (95% CI) = 11.0% (2.68%-21.0%)]. γ-glutamyltransferase and triglycerides showed only a small attenuation in women [PEE GGT(95% CI) = 3.11% (-0.72%-4.48%); PEE TG (95% CI) = 6.36% (3.81%-9.92%)] and in men [PEE GGT = 0%; PEE TG (95% CI) = 6.23% (2.03%-11.8%)]. In women, the total effect was decomposed into a direct effect and 4 indirect effects (HR BMI = 1.10; HR waist = 1.28; HR GGT = 0.97 and HR TG = 1.03). In men, the 4 indirect effects were HR BMI = 1.25; HR waist = 1.29; HR GGT = 0.97 and HR TG = 0.99. These data suggest that the FLI, as a proxy for fatty liver, is associated with risk of type 2 diabetes. This association is only partly explained by standard estimates of overall and abdominal body fatness, particularly among women.

  15. Association between the Fatty Liver Index and Risk of Type 2 Diabetes in the EPIC-Potsdam Study.

    Directory of Open Access Journals (Sweden)

    Susanne Jäger

    Full Text Available The fatty liver index (FLI predicts fatty liver by using BMI, waist circumference, γ-glutamyltransferase and triglycerides. We investigated the association between the FLI and the risk of type 2 diabetes and evaluated to what extent single FLI components contribute to the diabetes risk. We analysed a case-cohort study (random sub-cohort: 1922; incident cases: 563 nested within the European Prospective Investigation into Cancer and Nutrition (EPIC-Potsdam study. The proportion of exposure effect (PEE explained by single FLI components was evaluated and effect decomposition using inverse probability weighting (IPW was applied. Women and men with a FLI ≥ 60 compared to those with a FLI < 30 had a multivariable-adjusted Hazard Ratio (HR of 17.6; 95% confidence interval (CI 11.1-28.0 and HR: 10.9; 95% CI 6.22-19.2, respectively. Adjustment for BMI or waist circumference attenuated this association in men [PEE BMI (95% CI = 53.8% (43.9%-65.8%; PEE waist (95% CI = 54.8% (44.2%-68.8%]. In women, adjustment for waist circumference attenuated the association to a lesser degree than in men [PEE waist (95% CI = 31.1%; (21.9%-43.1%] while BMI had no appreciable effect [PEE BMI (95% CI = 11.0% (2.68%-21.0%]. γ-glutamyltransferase and triglycerides showed only a small attenuation in women [PEE GGT(95% CI = 3.11% (-0.72%-4.48%; PEE TG (95% CI = 6.36% (3.81%-9.92%] and in men [PEE GGT = 0%; PEE TG (95% CI = 6.23% (2.03%-11.8%]. In women, the total effect was decomposed into a direct effect and 4 indirect effects (HR BMI = 1.10; HR waist = 1.28; HR GGT = 0.97 and HR TG = 1.03. In men, the 4 indirect effects were HR BMI = 1.25; HR waist = 1.29; HR GGT = 0.97 and HR TG = 0.99. These data suggest that the FLI, as a proxy for fatty liver, is associated with risk of type 2 diabetes. This association is only partly explained by standard estimates of overall and abdominal body fatness, particularly among women.

  16. Experimental and analytical studies on multiple tuned mass dampers for seismic protection of porcelain electrical equipment

    Science.gov (United States)

    Bai, Wen; Dai, Junwu; Zhou, Huimeng; Yang, Yongqiang; Ning, Xiaoqing

    2017-10-01

    Porcelain electrical equipment (PEE), such as current transformers, is critical to power supply systems, but its seismic performance during past earthquakes has not been satisfactory. This paper studies the seismic performance of two typical types of PEE and proposes a damping method for PEE based on multiple tuned mass dampers (MTMD). An MTMD damping device involving three mass units, named a triple tuned mass damper (TTMD), is designed and manufactured. Through shake table tests and finite element analysis, the dynamic characteristics of the PEE are studied and the effectiveness of the MTMD damping method is verified. The adverse influence of MTMD redundant mass to damping efficiency is studied and relevant equations are derived. MTMD robustness is verified through adjusting TTMD control frequencies. The damping effectiveness of TTMD, when the peak ground acceleration far exceeds the design value, is studied. Both shake table tests and finite element analysis indicate that MTMD is effective and robust in attenuating PEE seismic responses. TTMD remains effective when the PGA far exceeds the design value and when control deviations are considered.

  17. Validation of a non-invasive blood-sampling technique for doubly-labelled water experiments.

    Science.gov (United States)

    Voigt, Christian C; Helversen, Otto Von; Michener, Robert H; Kunz, Thomas H

    2003-04-01

    Two techniques for bleeding small mammals have been used in doubly-labeled water (DLW) studies, including vena puncture and the use of starved nymphal stages of hematophagous reduviid bugs (Reduviidae, Hemiptera). In this study, we tested the validity of using reduviid bugs in doubly-labeled water experiments. We found that the isotope enrichment in initial blood samples collected with bugs was significantly lower compared to isotope enrichment in blood samples obtained using vena puncture. We therefore used the desiccation method for estimating total body water (TBW) in DLW experiments because TBW calculated using the isotope dilution method was overestimated when blood samples were collected using reduviid bugs. In our validation experiment with nectar-feeding bats (Glossophaga soricina), we compared estimates of daily energy expenditure (DEE) using DLW with those derived from the energy balance method. We considered Speakman's equation (controlling for 25% fractionated water loss) as the most appropriate for our study animal and calculated DEE accordingly. On average, DEE estimated with DLW was not significantly different from the mean value obtained with the energy balance method (mean deviation 1.2%). We conclude that although bug hemolymph or intestinal liquids most likely contaminate the samples, estimates of DEE are still valid because the DLW method does not depend on absolute isotope enrichments but on the rate of isotope decrease over time. However, dilution of blood with intestinal liquids or hemolymph from a bug may lead to larger variation in DEE estimates. We also tested how the relative error of DLW estimates changed with varying assumptions about fractionation. We used three additional equations for calculating DEE in DLW experiments. The basic equation for DLW experiments published by Lifson and McClintock (LM-6) assumes no fractionation, resulted in an overestimate of DEE by 10%. Nagy's equation (N-2) controls for changes in body mass but not for

  18. Microspheres made of poly(epsilon-caprolactone)-based amphiphilic copolymers: potential in sustained delivery of proteins.

    Science.gov (United States)

    Quaglia, Fabiana; Ostacolo, Luisanna; Nese, Giuseppe; De Rosa, Giuseppe; La Rotonda, Maria Immacolata; Palumbo, Rosario; Maglio, Giovanni

    2005-10-20

    Microspheres of amphiphilic multi-block poly(ester-ether)s (PEE)s and poly(ester-ether-amide)s (PEEA)s based on poly(epsilon-caprolactone) (PCL) were investigated as delivery systems for proteins. The interest was mainly focused on the effect of their molecular structure and composition on the overall properties of the microspheres, encapsulating bovine serum albumin (BSA) as a model protein. PEEs and PEEAs were prepared using a alpha,omega-dihydroxy-terminated PCL macromer (Mn= 2.0 kDa) as a hydrophobic component. Hydrophilic oxyethylene sequences were generated using poly(ethylene oxide)s (PEO)s of different molecular mass (Mn= 300-600 Da) in the case of PEEs, or 4,7,10-trioxa-1,13-tridecanediamine (Trioxy) and PEO150 (Mn= 150 Da) in the case of PEEAs. The copolymers showed a decrease of Tm and crystallinity values as compared with PCL. Within each class of copolymers, the bulk hydrophilicity increased with increasing the number of oxyethylene groups in the chain repeat unit. PEEAs were more hydrophilic than PEEs with a similar number of oxyethylene groups. Discrete spherical particles were prepared by both PEEs and PEEAs and their BSA encapsulation efficiency related to copolymer properties. Interestingly, the insertion of short hydrophilic segments is enough to significantly affect protein distribution inside microspheres and its release profiles, as compared to PCL microspheres. Different degradation rates and mechanisms were observed for copolymer microspheres, mainly depending on the distribution of oxyethylene units along the chain. The results highlight that a fine control over the structural parameters of amphiphilic PCL-based multi-block copolymers is a key factor for their application in the field of protein delivery.

  19. Prenatal ethanol exposure-induced adrenal developmental abnormality of male offspring rats and its possible intrauterine programming mechanisms.

    Science.gov (United States)

    Huang, Hegui; He, Zheng; Zhu, Chunyan; Liu, Lian; Kou, Hao; Shen, Lang; Wang, Hui

    2015-10-01

    Fetal adrenal developmental status is the major determinant of fetal tissue maturation and offspring growth. We have previously proposed that prenatal ethanol exposure (PEE) suppresses fetal adrenal corticosterone (CORT) synthesis. Here, we focused on PEE-induced adrenal developmental abnormalities of male offspring rats before and after birth, and aimed to explore its intrauterine programming mechanisms. A rat model of intrauterine growth retardation (IUGR) was established by PEE (4g/kg·d). In PEE fetus, increased serum CORT concentration and decreased insulin-like growth factor 1 (IGF1) concentration, with lower bodyweight and structural abnormalities as well as a decreased Ki67 expression (proliferative marker), were observed in the male fetal adrenal cortex. Adrenal glucocorticoid (GC)-metabolic activation system was enhanced while gene expression of IGF1 signaling pathway with steroidogenic acute regulatory protein (StAR), 3β-hydroxysteroid dehydrogenase (3β-HSD) was decreased. Furthermore, in the male adult offspring of PEE, serum CORT level was decreased but IGF1 was increased with partial catch-up growth, and Ki67 expression demonstrated no obvious change. Adrenal GC-metabolic activation system was inhibited, while IGF1 signaling pathway and 3β-HSD was enhanced with the steroidogenic factor 1 (SF1), and StAR was down-regulated in the adult adrenal. Based on these findings, we propose a "two-programming" mechanism for PEE-induced adrenal developmental toxicity: "the first programming" is a lower functional programming of adrenal steroidogenesis, and "the second programming" is GC-metabolic activation system-related GC-IGF1 axis programming. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. Comparison of a Handheld Indirect Calorimetry Device and Predictive Energy Equations Among Individuals on Maintenance Hemodialysis.

    Science.gov (United States)

    Morrow, Ellis A; Marcus, Andrea; Byham-Gray, Laura

    2017-11-01

    Practical methods for determining resting energy expenditure (REE) among individuals on maintenance hemodialysis (MHD) are needed because of the limitations of indirect calorimetry. Two disease-specific predictive energy equations (PEEs) have been developed for this metabolically complex population. The aim of this study was to compare estimated REE (eREE) by PEEs to measured REE (mREE) with a handheld indirect calorimetry device (HICD). A prospective pilot study of adults on MHD (N = 40) was conducted at 2 dialysis clinics in Houston and Texas City, Texas. mREE by an HICD was compared with eREE determined by 6 PEEs using Bland-Altman analysis with a band of acceptable agreement of ±10% of the group mean mREE. Paired t-test and the intraclass correlation coefficient were also used to compare the alternate methods of measuring REE. A priori alpha was set at P Maintenance Hemodialysis Equation-Creatinine version (MHCD-CR) was the most accurate PEE with 52.5% of values within the band of acceptable agreement, followed by the Mifflin-St. Jeor Equation and the Vilar et al. Equation at 45.0% and 42.5%, respectively. When compared with mREE by the HICD, the MHDE-CR was more accurate and precise than other PEEs evaluated; however, this must be interpreted with caution as mREE was consistently lower than eREE from all PEEs. Further research is needed to validate the MHDE-CR and other practical methods for determining REE among individuals on MHD. Copyright © 2017 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  1. Resistência de Cooperia spp. e Haemonchus spp. às avermectinas em bovinos de corte Resistance of Cooperia spp. and Haemonchus spp. to avermectins in beef cattle

    OpenAIRE

    V.B. Rangel; R.C. Leite; P.R. Oliveira; E.J. Santos Jr

    2005-01-01

    Foram realizados dois testes de redução de ovos de helmintos por grama de fezes em bovinos naturalmente infectados. No primeiro teste utilizaram-se quatro grupos tratados: ivermectina 1% (IVM), produto endectocida experimental (PEE), ivermectina LA 1% (IVMLA) e doramectina 1% (DRM). A contagem de ovos por gramas de fezes (OPG) foi realizada durante 14 dias pós-tratamento. Foram observadas as seguintes taxas de eficácia: IVM, -1,3%; PEE, 100%; IVMLA, 18,9% e DRM 50,6%. Os gêneros de helmintos ...

  2. Artificial Light at Night Reduces Daily Energy Expenditure in Breeding Great Tits (Parus major

    Directory of Open Access Journals (Sweden)

    Anouk A. M. H. Welbers

    2017-05-01

    Full Text Available The ecological impact of artificial light at night (ALAN is an increasingly recognized process that accompanies expanding urbanization. Yet, we have limited knowledge on the impact of ALAN on wild species, and on the potential to mitigate any negative effects by using different light sources and colors. In birds, effects of ALAN on activity levels are reported for several species and, hence, their daily energy expenditure (DEE may be affected. DEE is a potent mediator of life-history trade-offs and fitness and thus an important aspect to consider when examining the potential long-term ecological effects of ALAN. Previous work has suggested that birds exposed to ALAN show higher levels of provisioning and nocturnal activity, suggesting that white ALAN increases DEE. Other factors regulating DEE, such as provisioning behavior and food availability, might also respond to ALAN and thus indirectly affect DEE. We tested the hypothesis that ALAN increases DEE using an experimental setup where four previously unlit transects were illuminated with either white, green, or red LED light, or left dark as a control treatment. This setup was replicated in eight locations across the Netherlands. We measured DEE of our focal species, the great tit (Parus major, using a novel doubly labeled water technique that uses breath rather than blood samples. Contrary to our expectations, birds feeding their offspring under white and green ALAN showed lower DEE compared to birds in the control dark treatment. Differences in chick provisioning activity did not explain this result, as neither visit rates nor daily activity timing was affected by light treatment. However, food availability under white and green light was much higher compared to red light and the dark control. This difference strongly suggests that the lower DEE under white and green ALAN sites is a consequence of higher food availability in these treatments. This result shows that there can be positive

  3. Conceptions of the temporal course of aesthetic engagement. Comment on "Move me, astonish me…" delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates; by Matthew Pelowski et al.

    Science.gov (United States)

    Kuiken, Don; Jacobs, Arthur M.

    2017-07-01

    Pelowski et al. [9] propose a constructive and expansive theoretical framework of response to an important section of the world of art, i.e. visual art, excluding verbal art and other forms. More than its conceptual predecessors, this framework is intended to guide investigation (1) not only of the influence of personality variations but also of the viewer's hierarchically structured self-image (ideal traits, general schemas, specific goals, action goals; p. 15); (2) not only of initial responses to low-level features but also of how those initial responses become the focus of high-level reactions (p. 7-8); and (3) not only of the sources of pleasure, interest, and appreciation but also of ;transformative; aesthetic outcomes (p. 35ff).

  4. The forgotten artist: Why to consider intentions and interaction in a model of aesthetic experience. Comment on "Move me, astonish me... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Brattico, Elvira; Brattico, Pauli; Vuust, Peter

    2017-07-01

    In their target article published in this journal issue, Pelowski et al. [1] address the question of how humans experience, and respond to, visual art. They propose a multi-layered model of the representations and processes involved in assessing visual art objects that, furthermore, involves both bottom-up and top-down elements. Their model provides predictions for seven different outcomes of human aesthetic experience, based on few distinct features (schema congruence, self-relevance, and coping necessity), and connects the underlying processing stages to ;specific correlates of the brain; (a similar attempt was previously done for music by [2-4]). In doing this, the model aims to account for the (often profound) experience of an individual viewer in front of an art object.

  5. Psicoanálisis y pedagogía: Un análisis de las actas de la sociedad psicoanalítica de Viena (1906-1923) Psychoanalysis And Pedagogy: An Examination Of The Minutes Of The Vienna Psychoanalytic Society (1906-1923)

    OpenAIRE

    Mauro Vallejo

    2008-01-01

    El presente escrito analiza la presencia de problemáticas pedagógicas en los registros de las discusiones que los psicoanalistas vieneses sostuvieron en las primeras dos décadas del siglo pasado. Partiendo de algunas consideraciones referidas a los llamados estudios de recepción, el trabajo propone un examen detallado de los enunciados e hipótesis que Freud y sus discípulos vertieron acerca de la educación de los niños -y fundamentalmente sobre el esclarecimiento sexual- en el transcurso de l...

  6. Learning dynamics by theoretical tools of game theory. Comment on "Move me, astonish me...delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by M. Pelowski et al.

    Science.gov (United States)

    Burini, Diletta; De Lillo, Silvana

    2017-07-01

    The VIMAP model presented in the survey [5] aims at analyzing the processes that can occur in the human perception in the front of an artwork. Such a model combines the bottom-up (artwork derived) processes with the top-down mechanisms which describe how individuals adapt or change their own art processing experience. The cognitive flow consists of seven stages connected to five outcomes, which account for all the main ways of responding to art. Moreover this model can also identify the specific regions of the brain that are posited to be main centers of the processes that may coincide with the proposed cognitive checks.

  7. Women and Peace [And] Vienna Conference: Women and Disarmament [And] Women, Power and Alternative Futures, Part I: Women and World Order [And] Women, Power and Alternative Futures, Part II: Women and Power. The Whole Earth Papers. Vol. 1, No. 6-8, Spring, 1978.

    Science.gov (United States)

    Rubin, Josephine; Mische, Patricia

    Four papers explore the role of women in promoting a peaceful world order. The volume is intended to increase understanding of the linkages between local and global issues, and to examine them as interrelated issues in an interdependent world. The first paper, "Women and Peace," is a historical analysis of the role of individual women, feminists,…

  8. Medizinbibliotheken als Treiber von Innovationen für die Digitale Bibliothek: Metamorphose von wissenschaftlichen Bibliotheken am Beispiel der Universitätsbibliothek der Medizinischen Universität Wien [Medical libraries boost innovations for the digital library: The university library of the Medical University Vienna as an example for the metamorphosis of scientific libraries

    Directory of Open Access Journals (Sweden)

    Bauer, Bruno

    2013-11-01

    Full Text Available [english] This paper discusses the massive changes over the last 25 years particularly in medical libraries. The modernisation and upgrade of catalogues, bibliographies and journals is been accomplished by now while the transformation in the book sector is only in the beginning. With the help of new search engine technology the idea of a one-stop-shop was implemented to complete the change from printed to online media. In order to outlast future years medical libraries will have to handle the constant pressure for change and innovations while budgets are shrinking.[german] Der Beitrag thematisiert die massiven Veränderungen, die von wissenschaftlichen Bibliotheken, insbesondere Medizinbibliotheken, in den letzten 25 Jahren bewältigt worden sind. Während der Medienwandel beim Katalog, den Bibliografien und den Zeitschriften vollständig vollzogen worden ist, ist der Zeitpunkt der vollständigen Transformation der Bücher noch offen. Ergänzend zum Wandel von Print zu Online-Medien wurde die Idee des One-Stop-Shops umgesetzt, was mittels Suchmaschinentechnologie ermöglicht worden ist. Um in Zukunft bestehen zu können, werden Medizinbibliotheken auch weiterhin den Veränderungs- bzw. Innovationsdruck, in immer kürzeren Intervallen bei zunehmend limitierten Budgets, bewältigen müssen.

  9. On the complex interaction between mathematics and the sciences of living systems. Comment on "Move me, astonish me...delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Bellomo, Nicola; Outada, Nisrine

    2017-07-01

    Cultural framework: Our comment looks at the general framework given by the interactions between the so-called ;soft; and ;hard; sciences. Specifically, it looks at the development of a mathematics for living systems. Our comment aims at showing how the interesting survey [11] can contribute to the aforementioned challenging task.

  10. Beauty and sublime. Comment on "Move me, astonish me…" delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates; by Matthew Pelowski et al.

    Science.gov (United States)

    Perlovsky, Leonid

    2017-07-01

    The VIMAP model presented in this review [1] is an interesting and detailed model of neural mechanisms of aesthetic perception. In this Comment I address one deficiency of this model: it does not address in details the fundamental notions of the VIMAP, beauty and sublime. In this regard VIMAP is similar to other publications on aesthetics.

  11. Aesthetic episodes, domains, and the mind. Comment on: "Move me, astonish me... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Jacobsen, Thomas

    2017-07-01

    Aesthetic episodes, as all behavior, are situated. They take place as an interaction of person and situation variables [1]. There are different artistic and aesthetic domains that afford, in part, mutual mental processes, but also fundamentally different, e.g., modality-specific ones [2]. For the infinite number of possible aesthetic episodes a plethora of component processes can be selectively combined and dynamically configured. Following psychophysics' pragmatic dualism of mind and body, this results in dynamically configured (neuro-) biological networks subserving these mental processes [1]. These are, of course, also subject to evolutionary, biological, historical, cultural, and social change [1,3].

  12. Descriptive models of major uranium deposits in China - Some results of the Workshop on Uranium Resource Assessment sponsored by the International Atomic Energy Agency, Vienna, Austria, in cooperation with China National Nuclear Corporation, Beijing, and the U.S. Geological Survey, Denver, Colorado, and Reston, Virginia

    Science.gov (United States)

    Finch, W.I.; Feng, S.; Zuyi, C.; McCammon, R.B.

    1993-01-01

    Four major types of uranium deposits occur in China: granite, volcanic, sandstone, and carbonaceous-siliceous-pelitic rock. These types are major sources of uranium in many parts of the world and account for about 95 percent of Chinese production. Descriptive models for each of these types record the diagnostic regional and local geologic features of the deposits that are important to genetic studies, exploration, and resource assessment. A fifth type of uranium deposit, metasomatite, is also modeled because of its high potential for production. These five types of uranium deposits occur irregularly in five tectonic provinces distributed from the northwest through central to southern China. ?? 1993 Oxford University Press.

  13. Psicoanálisis y pedagogía: Un análisis de las actas de la sociedad psicoanalítica de Viena (1906-1923 Psychoanalysis And Pedagogy: An Examination Of The Minutes Of The Vienna Psychoanalytic Society (1906-1923

    Directory of Open Access Journals (Sweden)

    Mauro Vallejo

    2008-12-01

    Full Text Available El presente escrito analiza la presencia de problemáticas pedagógicas en los registros de las discusiones que los psicoanalistas vieneses sostuvieron en las primeras dos décadas del siglo pasado. Partiendo de algunas consideraciones referidas a los llamados estudios de recepción, el trabajo propone un examen detallado de los enunciados e hipótesis que Freud y sus discípulos vertieron acerca de la educación de los niños -y fundamentalmente sobre el esclarecimiento sexual- en el transcurso de las reuniones de los miércoles. De esa forma, se intenta subrayar que muchos de tales enunciados eran consustanciales a una preocupación tanto por la relación padres-hijos como por el papel de otras instancias de socialización.This work describes the presence of pedagogic problems in the records of the debates held by the viennese psychoanalysts during the first two decades of the last century. This text begins with some considerations about the so called reception studies and proposes an examination of the hypothesis and sentences that Freud and his disciples made about the children education -and fundamentally about the sexual enlightenment- during the wednesday meetings. Consequently, the article remarks that those sentences were a continuation of a concern about the relationships inside the family and the function of other socialization institutions.

  14. Ugliness as the fourth wall-breaker. Comment on "Move me, astonish me... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Ishizu, Tomohiro; Sakamoto, Yasuhiro

    2017-07-01

    In this extensive and valuable theoretical article, Pelowski et al. propose a psychological architecture in art appreciation by introducing the concepts of early/bottom-up and relatively late/top-down stages. The former is dictated as automatic processing on perceptual features of visual images, while the latter comprises cognitive and evaluative processes where modulations from acquired knowledge and memories come into play with recurrent loops to form final experiences, as well as brain areas/networks which possibly have a role in each processing component [9].

  15. Top-down and bottom-up: Front to back. Comment on "Move me, astonish me... delight my eyes and brain: The Vienna Integrated Model of top-down and bottom-up processes in Art Perception (VIMAP) and corresponding affective, evaluative, and neurophysiological correlates" by Matthew Pelowski et al.

    Science.gov (United States)

    Nadal, Marcos; Skov, Martin

    2017-07-01

    The model presented here [1] is the latest in an evolving series of psychological models aimed at explaining the experience of art, first proposed by Leder and colleagues [2]. The aim of this new version is to ;explicitly connect early bottom-up, artwork-derived processing sequence and outputs to top-down, viewer-derived contribution to the processing sequence; [1, p. 5f & 6]. The ;meeting; of these two processing sequences, the authors contend, is crucial to the understanding of people's responses to art [sections 3.6ff & 4], and therefore the new model's principal motivation.

  16. ‘Josef Strzygowski. Lecture Two: “The History of Art”’, originally published as ‘Zweiter Vortrag. “Kunstgeschichte”’ Josef Strzygowski, Die Krisis der Geisteswissenschaften Vorgeführt am Beispiele der Forschung über bildende Kunst Ein grundsätzlicher Rahmenversuch, Vienna: Schroll, 1923, 35-60

    Directory of Open Access Journals (Sweden)

    Karl Johns

    2017-12-01

    Full Text Available Josef Strzygowski (1862-1941 is remembered primarily as attracting a Pan-Germanic audience when his early career and most prominent publications actually promoted materials from outside of the classical tradition then being overlooked or ignored. From the list of his students and their topics of study, it is clear that his audience was probably more diverse than most. The list of his publications and his students and their topics of study should give some idea of this. Some of his emphasis was actually typical of his time and place and reflected the growth in popular tourism and travel. His expeditions by camel to photograph remote architecture and sculpture in near eastern areas prone to earthquakes and plagued by armed conflicts have preserved many important examples of art that have since been damaged or lost.

  17. Volatile phytochemical composition of rhizome of ginger after extraction by headspace solid-phase microextraction, petrol ether extraction and steam distillation extraction

    Directory of Open Access Journals (Sweden)

    Zhan-nan Yang

    2009-06-01

    Full Text Available The sampling techniques headspace solid-phase microextraction (HS-SPME, petrol ether extraction (PEE and steam distillation extraction (SDE were compared for the GC-MS of volatile constituents present in ginger (Zingiber officinale. The effects of different parameters, such as extraction fibers, extraction time, extraction temperature and particle size ranges, on the HSSPME of rhizome of ginger were investigated. Zingiberene (53.12% were predominant components of ginger samples obtained by HS-SPME whereas those levels were 39.01% in the same samples by PEE and 35.05% in those by SDE, respectively. HS-SPME with polydimethylsiloxane (PDMS fiber was more selective and particularly efficient for the isolation of volatile phytochemical composition and afforded a higher yield of total compounds than PEE and SDE. The specifically compound isolated by SPME, which due to effective fiber, was much larger than that isolated by PEE or SDE. HS-SPME is a powerful tool for determining the volatile constitutes present in the traditional Chinese medicines.

  18. AHP 47: TRICKING THE LANDLORD'S DAUGHTER AGAIN

    Directory of Open Access Journals (Sweden)

    Tshe dbang rdo rje ཚེ་དབང་རྡོ་རྗེ། (Caixiangduojie 才项多杰

    2017-10-01

    Full Text Available One afternoon, Lha mo's best friend, Sgrol ma, came to visit. It was right after Uncle Ston pa left Lha mo's room after "taking her pee." Seeing that Lha mo looked very tired, Sgrol ma asked, "Are you OK? You look exhausted!" ...

  19. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... REE-thruh) All day long, the kidneys clean waste products from your blood. The waste becomes urine (pee), which drips into the ureters ( ... You'll also want to stay away from foods and drinks that contain caffeine , such as cola ...

  20. Environ: E00051 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00051 Orange peel tincture (JP16) Orange peel tincture, sweet (NF) Crude drug d-Li...] Same as: D06500 Orange peel tincture: Rutaceae (rue family) Citrus aurantium peel Major component: Limonene [CPD:C06078] Orange pee...l tincture, sweet: Rutaceae (rue family) Citrus sinensis peel ...

  1. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-10

    Nov 10, 2017 ... Anuario de Psicología, 2012,. 42(1):35-50. [6] Mohtaram S, Pee N C, Sibgatullah A S. Mobile dyslexia screening test: A new approach through multiple deficit model mobile game to screen developmental dyslexia children. In. Malaysia University Conference Engineering Technology, 2014,pp. 10. [7] Fuchs ...

  2. Investment in Education and Economic Growth in Nigeria: 1981 ...

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    2013-12-01

    Dec 1, 2013 ... David E., David Canning and Jay pee Sevilla (2001). The Effect of Health on. Economic Growth: Theory and Evidence. NBER Working Paper NO. 8587. November. [9] Bratti, M., Bucci A.and Moretti (2004) “Demographic Trends, Human Capital and economic. Growth in Developing Countries: Theory and ...

  3. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... is so your urine sample won't contain germs from outside your body. If the doctor finds germs in your pee, it's a sign of infection ... or she will want to be sure those germs are coming from the inside , not the outside. ...

  4. Thermodynamics and historical relevance of a jetting thermometer made of Chinese zisha ceramic

    Science.gov (United States)

    Lee, Vincent; Attinger, Daniel

    2016-01-01

    Following a recent trend of scientific studies on artwork, we study here the thermodynamics of a thermometer made of zisha ceramic, related to the Chinese tea culture. The thermometer represents a boy who “urinates” shortly after hot water is poured onto his head. Long jetting distance is said to indicate that the water temperature is hot enough to brew tea. Here, a thermodynamic model describes the jetting phenomenon of that pee-pee boy. The study demonstrates how thermal expansion of an interior air pocket causes jetting. A thermodynamic potential is shown to define maximum jetting velocity. Seven optimization criteria to maximize jetting distance are provided, including two dimensionless numbers. Predicted jetting distances, jet durations, and temperatures agree very well with infrared and optical measurements. Specifically, the study confirms that jetting distances are sensitive enough to measure water temperature in the context of tea brewing. Optimization results show that longer jets are produced by large individuals, with low body mass index, with a boyhood of medium size inclined at an angle π/4. The study ends by considering the possibility that ceramic jetting artifacts like the pee-pee boy might have been the first thermometers known to mankind, before Galileo Galilei’s thermoscope. PMID:27431925

  5. Stress Analysis of the External Stores DP Ejection Launcher/Inner Tube Subsystem.

    Science.gov (United States)

    1978-11-01

    of 2 543 21 G * F E IU JIUF PEE- 1!111IS FAGM SPS To DDC I1~~ hVJ - _______ ___CKET_ __ 1 2 2! - 9 569-48 JSCRE*CAP 4N -1 4IN -~~~ /-41-- -- MSI1?,!V 0 RINC PARTS IS T DETENT 5 4 31 F I;URE 5.

  6. Chemical profile of the endocarp and exocarp of yellow monkey cola ...

    African Journals Online (AJOL)

    The results of phytochemical screening of water extract (WE) of both endocarp and exocarp of cola lepidota shows the presence of polyphenols, reducing sugars, cardiac glycosides and saponins and the absence of phlobatannins, tannins, anthranoids and anthraquinones. The petroleum ether extract (PEE) revealed the ...

  7. Getting a Urine Test (For Kids)

    Medline Plus

    Full Text Available ... español Obtención de un análisis de orina (video) It may seem gross and embarrassing to pee in ... hurt. And if you know what to expect, it doesn't have to be embarrassing either. About ...

  8. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... very sick. How Do I Know if I Have a UTI? You may notice signs of a ... hurt or sting when you pee? Do you have to go to the bathroom much more often ... a little bit at a time? Do you have to get up many times in the night ...

  9. Prevention and management of severe pre-eclampsia/eclampsia in Afghanistan

    NARCIS (Netherlands)

    Kim, Y.M.; Ansari, N.; Kols, A.; Tappis, H.; Currie, S.; Zainullah, P.; Bailey, P.; van Roosmalen, J.; Stekelenburg, J.

    2013-01-01

    Background: An evidence-based strategy exists to reduce maternal morbidity and mortality associated with severe pre-eclampsia/eclampsia (PE/E), but it may be difficult to implement in low-resource settings. This study examines whether facilities that provide emergency obstetric and newborn care

  10. Getting a Urine Test (For Kids)

    Medline Plus

    Full Text Available ... Diabetes Can Diabetes Be Prevented? Organize, Focus, Get It Done How Do I Help a Kid Who's ... español Obtención de un análisis de orina (video) It may seem gross and embarrassing to pee in ...

  11. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Up Staying Healthy Recipes & Cooking Staying Safe Health Problems Illnesses & Injuries Health Problems of Grown Ups People, Places & Things That Help ... with a parent if you're having peeing problems. Ask yourself these questions and share your answers ...

  12. ORF Alignment: NC_006856 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available urium] gb|AAV49008.1| Kanamycin ... resistance protein [Suicide plasmid pEE3] ... ref|NP_47814...promoter-probe vector pET2] tpe|CAH17840.1| ... TPA: kanamycin resistance protein [Suicide vector pTE

  13. Bedwetting: Glossary for Kids

    Science.gov (United States)

    ... Newsroom Latest News Contact Us You are here Home » Glossary for Kids BEHAVIOR MODIFICATION: If you use a "moisture alarm", a ... you start to pee is one example of BEHAVIOR MODIFICATION. BIOFEEDBACK: A ... This is the tube digested food passes through before you poop (have a bowel ...

  14. Visible sub-band gap photoelectron emission from nitrogen doped and undoped polycrystalline diamond films

    Science.gov (United States)

    Elfimchev, S.; Chandran, M.; Akhvlediani, R.; Hoffman, A.

    2017-07-01

    In this study the origin of visible sub-band gap photoelectron emission (PEE) from polycrystalline diamond films is investigated. The PEE yields as a function of temperature were studied in the wavelengths range of 360-520 nm. Based on the comparison of electron emission yields from diamond films deposited on silicon and molybdenum substrates, with different thicknesses and nitrogen doping levels, we suggested that photoelectrons are generated from nitrogen related centers in diamond. Our results show that diamond film thickness and substrate material have no significant influence on the PEE yield. We found that nanocrystalline diamond films have low electron emission yields, compared to microcrystalline diamond, due to the presence of high amount of defects in the former, which trap excited electrons before escaping into the vacuum. However, the low PEE yield of nanocrystalline diamond films was found to increase with temperature. The phenomenon was explained by the trap assisted photon enhanced thermionic emission (ta-PETE) model. According to the ta-PETE model, photoelectrons are trapped by shallow traps, followed by thermal excitation at elevated temperatures and escape into the vacuum. Activation energies of trap levels were estimated for undoped nanocrystalline, undoped microcrystalline and N-doped diamond films using the Richardson-Dushman equation, which gives 0.13, 0.39 and 0.04 eV, respectively. Such low activation energy of trap levels makes the ta-PETE process very effective at elevated temperatures.

  15. Fathers' Career Aspirations for Sons in Competitive Ice Hockey Programs.

    Science.gov (United States)

    Berlage, Gai Ingham

    A survey was made of 107 fathers of boys aged 11 and 12 competing in the Pee Wee Level Division III of the Connecticut State Ice Hockey Tournament. The questionnaire was designed to examine the career aspirations of the fathers for their sons in ice hockey, and to determine their attitudes toward their son's participation in the sport as it…

  16. AcEST: DK959380 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q2S1N7|IF2_SALRD Translation initiation factor IF-2 OS=Salini... 40 0.011 sp|Q01042|IE68_SHV21 Immediate...PADQETPKKQRIRQRGKKNKTSSGNTPVPEE 438 AD+ET + + PEE Sbjct: 258 VSADKETASAEEADDHASDEHAPDEDAEAPEE 289 >sp|Q01042|IE68_SHV21 Immediate

  17. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... REE-thruh) All day long, the kidneys clean waste products from your blood. The waste becomes urine (pee), which drips into the ureters ( ... drink something, no matter how busy you are. Water and cranberry juice are two good choices. Those ...

  18. Investigation of antihyperglycaemic activity of aqueous and petroleum ether extract of stem bark of Pongamia pinnata on serum glucose level in diabetic mice.

    Science.gov (United States)

    Badole, Sachin L; Bodhankar, Subhash L

    2009-05-04

    The aim of the study was to evaluate the antihyperglycaemic activity of aqueous (PPSB-AQE) and petroleum ether (PPSB-PEE) extract of stem bark Pongamia pinnata in alloxan induced diabetic mice. Diabetes was induced in mice by alloxan (80 mg/kg, i.v.). After acute and subacute treatment serum glucose was determined. OGTT was performed in PPSB-PEE pretreated animals. PPSB-PEE (25, 50, 100, 200 and 400mg/kg) showed significant reduction in serum glucose level in acute and subacute studies. The antihyperglycaemic effects of PPSBPE (100, 200 and 400mg/kg) showed onset at 2h and peak effect at 6h and the effect was sustained until 24 th h with 400mg/kg. In subacute study, antihyperglycaemic effect was observed on 21st day. In PPSBPE treated mice the body weight was not reduced in contrast to that in vehicle group. In OGTT, increased glucose utilization was observed. It is concluded that PPSB-PEE but not PPSB-AQE showed antihyperglycaemic activity.

  19. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ebaryomyces ... hansenii] ... Length = 134 ... Query: 65 ... TLNSYVTPLEIDMYMHKSNSTYFLDLDIARTKLLTRLFQ...TYWWSCYDNENGKFKKSHTLA 124 ... T+ +YV+PLE+DMYMHKSNSTY +DLDIART ++T++FQ +W+ ... YDNEN +F K ... +L+ Sbjct: 1 ... TMETYVSPLELDMYMHKSNSTYSIDLDIARTNVVTKIFQRFWYKYYDNENKEF-KGISLS 59 ... Query: 184 VFKVG-RLTIAPEE 196 ... VFK ... R+TI PEE Sbjct: 120 VFKKKQRITIKPEE 133

  20. Proceeding of the 1999 Particle Accelerator Conference. Volume 4

    Science.gov (United States)

    1999-04-02

    G. Verdd, J. I. Villaescusa, J. M. Campayo, "Cmculo culations and with values recommended by the DIN-6847 de dosis y estudio de blindajes en un...both radial andvertical focusing occurdi closure ~ ~ ~ ~ ~ ~ M caso th n pee -s howriiier i for n= 1/2, which is optiriir for rnay p~oses tion), line

  1. Getting a Urine Test (For Kids)

    Medline Plus

    Full Text Available ... to School? Breast Cancer Getting a Urine Test (Video) KidsHealth > For Kids > Getting a Urine Test (Video) Print A A A en español Obtención de un análisis de orina (video) It may seem gross and embarrassing to pee ...

  2. Is there an accurate method to measure metabolic requirement of institutionalized children with spastic cerebral palsy?

    Science.gov (United States)

    Lee, Siu Pik Peggy; Cheung, Ka Ming; Ko, Chun Hung; Chiu, Heung Chin

    2011-07-01

    This study hypothesized that there is no difference between energy expenditure measured by indirect calorimetry (IC) and that estimated by predicted formulas compared with the actual intake of children with spastic cerebral palsy (CP). Fifteen children aged 3 to 18 years with spastic CP and associated complications were recruited. IC was used to measure mean energy expenditure (MEE) compared with 3 predicted equations for energy expenditure (PEE), including body surface area (BSA), the recommended daily allowance (RDA), and an equation designed specifically for patients with CP. Friedman and paired t tests were used to examine the variance between PEE and MEE. Intraclass correlation coefficient (ICC) was used to explore the correlation between MEE and PEE. The pretest and posttest core temperatures were compared using the Wilcoxon signed rank test. Mean ± standard deviation MEE was 800.5 ± 295.7 kcal/d; BSA was 1,213.4 ± 171.2 kcal/d; RDA was 1,928.1 ± 341.0 kcal/d; and CP was 1,603.1 ± 215.8 kcal/d. The actual diet intake provided 935.3 ± 222.9 kcal/d. Post hoc analysis revealed a significant difference between mean MEE and PEE (P children with spastic CP.

  3. Prevention and management of severe pre-eclampsia/eclampsia in Afghanistan.

    Science.gov (United States)

    Kim, Young Mi; Ansari, Nasratullah; Kols, Adrienne; Tappis, Hannah; Currie, Sheena; Zainullah, Partamin; Bailey, Patricia; van Roosmalen, Jos; Stekelenburg, Jelle

    2013-10-12

    An evidence-based strategy exists to reduce maternal morbidity and mortality associated with severe pre-eclampsia/eclampsia (PE/E), but it may be difficult to implement in low-resource settings. This study examines whether facilities that provide emergency obstetric and newborn care (EmONC) in Afghanistan have the capacity to manage severe PE/E cases. A further analysis was conducted of the 2009-10 Afghanistan EmONC Needs Assessment. Assessors observed equipment and supplies available, and services provided at 78 of the 127 facilities offering comprehensive EmONC services and interviewed 224 providers. The providers also completed a written case scenario on severe PE/E. Descriptive statistics were used to summarize facility and provider characteristics. Student t-test, one-way ANOVA, and chi-square tests were performed to determine whether there were significant differences between facility types, doctors and midwives, and trained and untrained providers. The median number of severe PE/E cases in the past year was just 5 (range 0-42) at comprehensive health centers (CHCs) and district hospitals, compared with 44 (range 0-130) at provincial hospitals and 108 (range 32-540) at regional and specialized hospitals (p magnesium sulfate (MgSO4). One-third of the smallest facilities and half of larger facilities reported administering a second-line drug, diazepam, in some cases. In the case scenario, 96% of doctors and 89% of midwives recognized that MgSO4 should be used to manage severe PE/E, but 42% of doctors and 58% of midwives also thought diazepam had a role to play. Providers who were trained on the use of MgSO4 scored significantly higher than untrained providers on six of 20 items in the case scenario. Providers at larger facilities significantly outscored those at smaller facilities on five items. There was a significant difference between doctors and midwives on only one item: continued use of anti-hypertensives after convulsions are controlled. Drugs and

  4. Prevention and management of severe pre-eclampsia/eclampsia in Afghanistan

    Science.gov (United States)

    2013-01-01

    Background An evidence-based strategy exists to reduce maternal morbidity and mortality associated with severe pre-eclampsia/eclampsia (PE/E), but it may be difficult to implement in low-resource settings. This study examines whether facilities that provide emergency obstetric and newborn care (EmONC) in Afghanistan have the capacity to manage severe PE/E cases. Methods A further analysis was conducted of the 2009–10 Afghanistan EmONC Needs Assessment. Assessors observed equipment and supplies available, and services provided at 78 of the 127 facilities offering comprehensive EmONC services and interviewed 224 providers. The providers also completed a written case scenario on severe PE/E. Descriptive statistics were used to summarize facility and provider characteristics. Student t-test, one-way ANOVA, and chi-square tests were performed to determine whether there were significant differences between facility types, doctors and midwives, and trained and untrained providers. Results The median number of severe PE/E cases in the past year was just 5 (range 0–42) at comprehensive health centers (CHCs) and district hospitals, compared with 44 (range 0–130) at provincial hospitals and 108 (range 32–540) at regional and specialized hospitals (p Afghanistan, but providers lack knowledge in some areas, especially concerning the use of MgSO4 and diazepam. Providers who have specialized training or work at larger facilities are better at managing cases of severe PE/E. The findings suggest a need to clarify service delivery guidelines, offer refresher training, and reinforce best practices with supervision and reinforcement. PMID:24119329

  5. Policy change eliminating body checking in non-elite ice hockey leads to a threefold reduction in injury and concussion risk in 11- and 12-year-old players.

    Science.gov (United States)

    Black, Amanda M; Macpherson, Alison K; Hagel, Brent E; Romiti, Maria A; Palacios-Derflingher, Luz; Kang, Jian; Meeuwisse, Willem H; Emery, Carolyn A

    2016-01-01

    In ice hockey, body checking is associated with an increased risk of injury. In 2011, provincial policy change disallowed body checking in non-elite Pee Wee (ages 11-12 years) leagues. To compare the risk of injury and concussion between non-elite Pee Wee ice hockey players in leagues where body checking is permitted (2011-12 Alberta, Canada) and leagues where policy change disallowed body checking (2011-12 Ontario, Canada). Non-elite Pee Wee players (lower 70%) from Alberta (n=590) and Ontario (n=281) and elite Pee Wee players (upper 30%) from Alberta (n=294) and Ontario (n=166) were recruited to participate in a cohort study. Baseline information, injury and exposure data was collected using validated injury surveillance. Based on multiple Poisson regression analyses (adjusted for clustering by team, exposure hours, year of play, history of injury/concussion, level of play, position and body checking attitude), the incidence rate ratio (IRR) associated with policy allowing body checking was 2.97 (95% CI 1.33 to 6.61) for all game injury and 2.83 (95% CI 1.09 to 7.31) for concussion. There were no differences between provinces in concussion [IRR=1.50 (95% CI 0.84 to 2.68)] or injury risk [IRR=1.22 (95% CI 0.69 to 2.16)] in elite levels of play where both provinces allowed body checking. The rate of injury and concussion were threefold greater in non-elite Pee Wee ice hockey players in leagues where body checking was permitted. The rate of injury and concussion did not differ between provinces in elite levels, where body checking was allowed. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  6. High resolution IR diode laser study of collisional energy transfer between highly vibrationally excited monofluorobenzene and CO2: the effect of donor fluorination on strong collision energy transfer.

    Science.gov (United States)

    Kim, Kilyoung; Johnson, Alan M; Powell, Amber L; Mitchell, Deborah G; Sevy, Eric T

    2014-12-21

    Collisional energy transfer between vibrational ground state CO2 and highly vibrationally excited monofluorobenzene (MFB) was studied using narrow bandwidth (0.0003 cm(-1)) IR diode laser absorption spectroscopy. Highly vibrationally excited MFB with E' = ∼41,000 cm(-1) was prepared by 248 nm UV excitation followed by rapid radiationless internal conversion to the electronic ground state (S1→S0*). The amount of vibrational energy transferred from hot MFB into rotations and translations of CO2 via collisions was measured by probing the scattered CO2 using the IR diode laser. The absolute state specific energy transfer rate constants and scattering probabilities for single collisions between hot MFB and CO2 were measured and used to determine the energy transfer probability distribution function, P(E,E'), in the large ΔE region. P(E,E') was then fit to a bi-exponential function and extrapolated to the low ΔE region. P(E,E') and the biexponential fit data were used to determine the partitioning between weak and strong collisions as well as investigate molecular properties responsible for large collisional energy transfer events. Fermi's Golden rule was used to model the shape of P(E,E') and identify which donor vibrational motions are primarily responsible for energy transfer. In general, the results suggest that low-frequency MFB vibrational modes are primarily responsible for strong collisions, and govern the shape and magnitude of P(E,E'). Where deviations from this general trend occur, vibrational modes with large negative anharmonicity constants are more efficient energy gateways than modes with similar frequency, while vibrational modes with large positive anharmonicity constants are less efficient at energy transfer than modes of similar frequency.

  7. Are national policies and programs for prevention and management of postpartum hemorrhage and preeclampsia adequate? A key informant survey in 37 countries.

    Science.gov (United States)

    Smith, Jeffrey Michael; Currie, Sheena; Cannon, Tirza; Armbruster, Deborah; Perri, Julia

    2014-08-01

    Although maternal mortality has declined substantially in recent years, efforts to address postpartum hemorrhage (PPH) and preeclampsia/eclampsia (PE/E) must be systematically scaled up in order for further reduction to take place. In 2012, a key informant survey was conducted to identify both national and global gaps in PPH and PE/E program priorities and to highlight focus areas for future national and global programming. Between January and March 2012, national program teams in 37 countries completed a 44-item survey, consisting mostly of dichotomous yes/no responses and addressing 6 core programmatic areas: policy, training, medication distribution and logistics, national reporting of key indicators, programming, and challenges to and opportunities for scale up. An in-country focal person led the process to gather the necessary information from key local stakeholders. Some countries also provided national essential medicines lists and service delivery guidelines for comparison and further analysis. Most surveyed countries have many elements in place to address PPH and PE/E, but notable gaps remain in both policy and practice. Oxytocin and magnesium sulfate were reported to be regularly available in facilities in 89% and 76% of countries, respectively. Only 27% of countries, however, noted regular availability of misoprostol in health facilities. Midwife scope of practice regarding PPH and PE/E is inconsistent with global norms in a number of countries: 22% of countries do not allow midwives to administer magnesium sulfate and 30% do not allow them to perform manual removal of the placenta. Most countries surveyed have many of the essential policies and program elements to prevent/manage PPH and PE/E, but absence of commodities (especially misoprostol), limitations in scope of practice for midwives, and gaps in inclusion of maternal health indicators in the national data systems have impeded efforts to scale up programs nationally.

  8. Extract of Bauhinia vahlii Shows Antihyperglycemic Activity, Reverses Oxidative Stress, and Protects against Liver Damage in Streptozotocin-induced Diabetic Rats.

    Science.gov (United States)

    Elbanna, Ahmed H; Nooh, Mohammed M; Mahrous, Engy A; Khaleel, Amal E; Elalfy, Taha S

    2017-10-01

    Several studies have affirmed the effectiveness of some Bauhinia plants as antihyperglycemic agents. We investigated the possible effect of Bauhinia vahlii leaves extract in reducing hyperglycemia and reversing signs of organ damage associated with diabetes in streptozotocin (STZ) rat model. Both polar fraction of the B. vahlii leaves (defatted ethanolic extract [DEE]) and nonpolar fraction (n-hexane extract) were evaluated in vitro for α-glucosidase inhibition and 2,2-diphenyl-1-picrylhydrazyl radical scavenging potential. DEE was selected for further in vivo studies and was administered at two doses, i.e., 150 or 300 mg/kg to STZ-diabetic rats for 4 weeks. Only DEE exhibited in vitro antioxidant and antihyperglycemic activities and its oral administration at both dose levels resulted in significant reduction in fasting blood glucose and glycated hemoglobin. Furthermore, signs of oxidative stress as indicated by hepatic reduced glutathione, nitric oxide, and malondialdehyde levels were completely reversed. In addition, histopathological examination and measurement of serum aspartate transaminase and alanine transaminase levels showed that DEE protected the liver from signs of liver pathogenesis when compared to diabetic untreated animals and those treated with metformin. Phytochemical analysis of DEE showed high flavonoids content with quercitrin as the major constituent along with other quercetin glycosides. This study strongly highlights the possible beneficial effect of B. vahlii leaves extract in relieving hyperglycemia and liver damage in STZ-diabetic rats and recommends further investigation of the value of quercetin derivatives in controlling diabetes and ameliorating liver damage associated with it. The polar fraction of the Bauhinia vahlii leaves (defatted ethanolic extract [DEE]) exhibited both in vitro antioxidant activity in 2,2-diphenyl-1-picrylhydrazyl scavenging assay and strong α-glucosidase inhibition while the nonpolar fraction (n

  9. Simulation of salinity intrusion along the Georgia and South Carolina coasts using climate-change scenarios

    Science.gov (United States)

    Conrads, Paul; Roehl, Edwin A.; Daamen, Ruby C.; Cook, John B.

    2013-01-01

    streamflow increased the percentage of time to 16.6 percent. Precipitation and temperature data from a global circulation model were used, after scale adjustments, as input to a watershed model of the Yadkin-Pee Dee River basin, which flows into the Waccamaw River and Atlantic Intracoastal Waterway study area in South Carolina. The simulated streamflow for historical conditions and projected climate change in the future was used as input for the ANN model in decision support system. Results of simulations incorporating climate-change projections for alterations in streamflow indicate an increase in the frequency of salinity-intrusion events and a shift in the seasonal occurrence of the intrusion events from the summer to the fall.

  10. 75 FR 43945 - Convention on Supplementary Compensation for Nuclear Damage Contingent Cost Allocation

    Science.gov (United States)

    2010-07-27

    ... CSC and its provisions is contained in ``The 1997 Vienna Convention on Civil Liability for Nuclear... July 1960 (``Paris Convention''), the Vienna Convention on Civil Liability for Nuclear Damage of 21 May... (``IAEA'').\\1\\ The CSC provides the basis for a global nuclear liability regime. Such a regime is an...

  11. A sketch of Arnfried Antonius (1934 - 2010)

    OpenAIRE

    Steiner, Sascha CC

    2015-01-01

    Arnfried Antonius  studied Zoology, Paleontology and Ethnology at the University of Vienna, Austria, gradually focusing his attention on the ecology and graphic microanatomical reconstructions of marine invertebrates Arnfried Antonius studied Zoology, Paleontology and Ethnology at the University of Vienna, Austria, gradually focusing his attention on the ecology and graphic microanatomical reconstructions of marine invertebrates

  12. Regime and Periphery in Northern Yemen: The Huthi Phenomenon

    Science.gov (United States)

    2010-01-01

    Sylvia Haas, and Gabriele Palczek, eds., Vienna Contributions to Ethnology and Anthropology, Volume 5. Horn-Wien: Verlag Ferdinand Berger & Sohne...Gingrich, Siegried Haas, Sylvia Haas, and Gabriele Palczek, eds., Vienna Contributions to Ethnology and Anthropology, Volume 5, Horn-Wien: Verlag

  13. Working group report: High energy and collider physics

    Indian Academy of Sciences (India)

    ... Johns Hopkins University, Baltimore, MD, USA; Institute of Physics, 751 005, Bhubaneswar, India; Indian Institute of Science, 560 012, Bangalore, India; Brookhaven National Laboratory, Upton, NY, USA; Institute for Theoretical Physics, University of Vienna, Vienna, Austria; Indian Association for the Cultivation of Science ...

  14. Tree of Life: Gustav with Gusto

    Science.gov (United States)

    Sterling, Joan

    2010-01-01

    Gustav Klimt was born in Vienna in 1862. At age 14, he received a scholarship to the Vienna Public Art School. After graduating, he painted realistic portraits and later began to paint landscapes. Klimt was best known for creating a style known as Art Nouveau, in answer to the Industrial Revolution of the early 20th century. Art Nouveau was a…

  15. Accelerating growth of HFC-227ea (1,1,1,2,3,3,3-heptafluoropropane) in the atmosphere

    DEFF Research Database (Denmark)

    Laube, J.C.; Martinerie, P.; Witrant, E.

    2010-01-01

    We report the first measurements of 1,1,1,2,3,3,3-heptafluoropropane (HFC-227ea), a substitute for ozone depleting compounds, in air samples originating from remote regions of the atmosphere and present evidence for its accelerating growth. Observed mixing ratios ranged from below 0.01 ppt in dee...

  16. Energy expenditure, nestling age, and brood size : an experimental study of parental behavior in the great tit Parus major

    NARCIS (Netherlands)

    Sanz, JJ; Tinbergen, JM

    1999-01-01

    A brood manipulation experiment on great tits Parus major was performed to study the effects of nestling age and brood size on parental care and offspring survival. Daily energy expenditure (DEE) of females feeding nestlings of 6 and 12 days of age was measured using the doubly-labeled water

  17. Tropospheric biennial oscillation and South Asian summer monsoon ...

    Indian Academy of Sciences (India)

    20

    In the present study, we have used the 10 ensemble member mean for detailed analysis. European Centre for Medium-Range Weather. Forecasts (ECMWF) reanalysis (ERA-Interim; Dee et al. 2011) surface, 850 hPa and 200 hPa level winds, mean sea level pressure (MSLP), air-temperature and Climate Prediction Center.

  18. A substitution mutation in OsCCD7 cosegregates with dwarf and ...

    Indian Academy of Sciences (India)

    ∗For correspondence. E-mail: rpsnrcpb@yahoo.co.in. Dee-geo-woo-gen, which was used to develop the semidwarf cultivar IR8 that produced record yields throughout Asia and formed the basis for the development of several high yield, semidwarf varieties. Since then, sd1 has remained the pre- dominant dwarfing gene to ...

  19. Foraminifera and paleoenvironment of the Plio-Pleistocene Kallithea Bay section, Rhodes, Greece: Evidence for cyclic sedimentation and shallow-water sapropels

    DEFF Research Database (Denmark)

    Rasmussen, Tine Lander; Thomsen, Erik

    2005-01-01

    Nearly 250 species of benthic foraminifera have been identified from the Plio-Pleistocene strata of the Kallithea Bay section on the eastern coast of Rhodes. The section comprises an overall transgressive succession ranging from fluviatile and brackish-water gravel at the base to fine-grained dee...

  20. Plaadid / Heidi Purga

    Index Scriptorium Estoniae

    Purga, Heidy, 1975-

    2006-01-01

    Uutest heliplaatidest Jay Dee/J Dilla "Donuts", The Strokes "First Impressions Of Earth", Jools Holland & His R&B orchestra "Swinging the Blues, Dancing The Ska", "The Sound Of Music", Karin Clercq "Apres l'amour", Mest "Photographs", The Notorious B.I.G. "Duets"

  1. Late Paleocene–early Eocene carbon isotope stratigraphy from a ...

    Indian Academy of Sciences (India)

    11 = DSDP 577; 12 = Mead Stream, New Zealand, 13 = Dee Stream, New Zealand. (b) Detailed geological map of Vastan area. Equatorial or shallow marine records of these. EEHs are rare, viz., only at DSDP/ODP sites 577,. 1215, and off-New Zealand coast. Almost com- pletely absent are the tropical terrestrial records.

  2. Service-Learning and Integrated Course Redesign: Principles of Management and the Campus Kitchen Metaproject

    Science.gov (United States)

    Flannery, Brenda L.; Pragman, Claudia H.

    2010-01-01

    This article describes the process of redesigning a Principles of Management course to integrate a service-learning metaproject. The metaproject was Campus Kitchen, a food recovery and delivery program operated on a handful of university campuses across the United States. We used L. Dee Fink's integrated course design approach as well as systems…

  3. Stakeholders and quality assurance in higher education

    NARCIS (Netherlands)

    Leisyte, Liudvika; Westerheijden, Donald F.; Eggins, Heather

    2014-01-01

    The various changes in post-bureaucratic organising, which are moving towards network approaches, coupled with the managerial agenda of corporate governance, have redefined the roles of various internal and external stakeholders in the governance of higher education institutions (Leisyte and Dee,

  4. G.J. van Wyk (tegn. red.), A.E. Cloete, A. Jordaan, H.C. Liebenberg

    African Journals Online (AJOL)

    rbr

    bord; met metatesis in bv. ferweel en kaperjol. Ekspres se variant aspris (met die verlaging van die sjwa in die eerste sillabe) word nie behandel nie. Leksikale eenhede kleiner as die woord behoort opgeneem te word, soos. -a (waarna in boeta verwys word), -erig (vgl. nukkerig) en dees-/dus- (deeskant, duskant).

  5. Diagnóstico de la situación del deporte en edad escolar en la ciudad de Segovia

    Directory of Open Access Journals (Sweden)

    Luis Alberto Gonzalo Arranz

    2015-06-01

    Full Text Available La finalidad principal del presente estudio es realizar un adecuado diagnóstico de la situación actual del deporte en edad escolar (DEE en la ciudad de Segovia, así como el nivel de realización de la actividad física regular en la franja de población de 7-16 años, como paso fundamental para elaborar posteriormente un programa de intervención. Los objetivos del estudio son los siguientes: (1 conocer el nivel de realización de AFD en los diferentes agentes implicados (alumnado, familias, profesorado de educación física (EF y monitores deportivos; (2 analizar la implicación de los diferentes agentes participantes en los programas de DEE; (3 conocer el grado de profesionalización de las monitoras y monitores y la titulación que poseen; (4 estudiar el pensamiento de los diferentes agentes sobre los valores asociados al DEE; (5 conocer el modelo de organización y gestión del DEE.

  6. Organizational Adaptation to the Rapidly Changing External Environment: A Case Study of Strategic Marketing at Notre Dame College in Ohio

    Science.gov (United States)

    Brown, Shawn M.

    2012-01-01

    This thesis examined the role of strategic marketing in organizational adaptation to a rapidly changing and competitive external environment among institutions of higher education. Colleges and universities adapt to external pressures as open systems operating within a broader external environment (Bess & Dee, 2008; Keller, 1983). How does…

  7. CMS ECAL Endcap (EE) - Preparatory work for umbilical noise studies

    CERN Multimedia

    Lodge, T

    2007-01-01

    Possible mapping solution, done inside connector, top and bottom sides of MB MB with umbilical + free pins, all identical until position on Dee known Then pins to connector in specific order for that position. All SC umbilicals to mating connector identical.

  8. Daily energy expenditure of great cormorants Phalacrocorax carbo sinensis wintering at Lake Chiemsee, Southern Germany

    NARCIS (Netherlands)

    Keller, T.M; Visser, G.H.

    1999-01-01

    In the winters of 1993/94 and 1994/95 the daily energy expenditure (DEE) of Great Cormorants Phalacrocorax carbo sinensis was measured using the doubly labelled water technique (DLW). This was the first time the method has been used on a Phalacrocoracid species. DLW trials were carried out on 5

  9. Daily energy expenditure and short-term reproductive costs in free-ranging Eurasian Kestrels (Falco tinnunculus)

    NARCIS (Netherlands)

    Jonsson, K.I.; Korpimaki, E.; Pen, I.R.; Tolonen, P.

    1. The relationship between daily energy expenditure (DEE), measured using the doubly labelled water technique, and flight activity, rate of food delivery, daily mass change and body condition was studied in a population of the Eurasian Kestrel in Finland. Only female Kestrels were recorded for

  10. Inspiration and Intellect: Significant Learning in Musical Forms and Analysis

    Science.gov (United States)

    Kelley, Bruce C.

    2009-01-01

    In his book "Creating Significant Learning Experiences" (2003), Dee Fink challenges professors to create a deep vision for the courses they teach. Educators often have a vision for what their courses could be, but often lack a model for instituting change. Fink's book provides that model. In this article, the author describes how this model helped…

  11. Culture, Leadership, and Activism: Translating Fink's Taxonomy of Significant Learning into Pedagogical Practice

    Science.gov (United States)

    Jenkins, Toby S.

    2016-01-01

    Through the article, I share the theoretical foundations, structure, knowledge acquisition, and outcomes of a cultural leadership course. The process for course development integrates several theories and research methods into practice: L. Dee Fink's Taxonomy of Significant Learning, Feminist Theory, Critical Race Theory, and…

  12. A Convergence Analysis of an H-Version Finite Element Method with High Order Elements for Two Dimensional Elasto-Plasticity Problems.

    Science.gov (United States)

    1994-01-01

    CLA33I1ICATION OF ?HIS PAGE IWrm De.e Entereed) ’ REPORT DO -PlENTATION PAGE ’ -100- REING STR UCTIONS BEFOR.r COMPLETING FORM V. 9POkT Numset GOVT ACCL...Integration over Simplezes and Cones, Math. Tabl. Natn. IRes. Coun. Wash ., 10, 130-137, 1956. [10] Claes Johnson, Ezistence theorems for plasticity

  13. The elusive ≡C-H···O complex in the hydrogen bonded systems of ...

    Indian Academy of Sciences (India)

    Abstract. Hydrogen-bonded complexes of phenylacetylene (PhAc) with methanol (MeOH) and diethylether. (DEE) were studied using matrix isolation infrared spectroscopy. This study specifically searched for the ≡C-. H···O hydrogen bonded complex in these systems, which manifest a n-σ* interaction and which is a local.

  14. Genetic variants of retinol-binding protein 4 in adolescents are ...

    Indian Academy of Sciences (India)

    Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance. Chin-Jung Lin Nain-Feng Chu Yi-Jen Hung Dee Pei Chien-Hsing Lee Fone-Ching Hsiao Chieh-Hua Lu Chang-Hsun Hsieh. Research Note Volume 94 Issue 3 ...

  15. Reframing Knowing, Being, and Doing in the Seminary Classroom

    Science.gov (United States)

    Cahalan, Kathleen A.

    2011-01-01

    Seminary education requires that students learn a complex body of theological knowledge, engage in the practices of ministry, and develop as persons of faith and vocation. Utilizing the six aspects of significant learning experiences defined by L. Dee Fink--foundational knowledge, application, integration, the human dimension, caring, and learning…

  16. Bibliography of Publications and Presentations from July 1971 Through December 1981

    Science.gov (United States)

    1982-01-01

    of New Mexico , 1963. The Effect of Various Levels of Auditory Feedback on Pursuit Rotor V. - Performance, by Richard W. Sheldon, Elmo E. Miller and...IQ as a Prediotor of Performance,- by James W. Dees, presentation to the Mid-South Educacional Research Association, New Orleans, LA., November 1972. U

  17. Effects of foraging mode and season on the energetics of the Marine Iguana, Amblyrhynchus cristatus

    NARCIS (Netherlands)

    Drent, J; Lichtenbelt, WDV; Wikelski, M

    1, Marine Iguanas (Amblyrhynchus cristatus) inhabiting the rocky shores of the Galapagos Islands apply two foraging strategies, intertidal and subtidal foraging, in a seasonal climate. Effects of both foraging strategy and seasonality on the daily energy expenditure (DEE) were measured using doubly

  18. ENERGY BUDGETS IN FREE-LIVING GREEN IGUANAS IN A SEASONAL ENVIRONMENT

    NARCIS (Netherlands)

    LICHTENBELT, WDV; WESSELINGH, RA; VOGEL, JT; ALBERS, KBM

    Using a variety of techniques we estimated energy expenditure and allocation of energy in free-living green iguanas (Iguana iguana) in a seasonal environment on Curacao, Netherlands Antilles. 1) Daily energy expenditure (DEE) was measured by means of the doubly labeled water (DLW) technique, using

  19. The Shock and Vibration Digest. Volume 13, Number 4

    Science.gov (United States)

    1981-04-01

    concern are telephone switching centres, electrical «witchgeer stations, hospitals and similar utilities and public services. This peper examines the...Analysis Y.W. Lukand L.D.Mitchell Virginia Polytechnic Inst. and State Univ., Blacks - burg, VA, ASME Paper No. 79-DE-E-4 Key Words: Computer

  20. 1265- IJBCS - Article-OBI Ejeatuluchukwu

    African Journals Online (AJOL)

    hp

    androgen depletion at the target level in the cauda epididymis, thereby affecting the physiological maturation of sperm (Chinoy et al., 1999). U and Dee Sweet bitter, a registered herbal supplement marketed in. Nigeria has been reported to be toxic for the accessory sex organs of male albino rats (Obi and Orisakwe, 2011).

  1. The elusive≡ CH··· O complex in the hydrogen bonded systems of ...

    Indian Academy of Sciences (India)

    Hydrogen-bonded complexes of phenylacetylene (PhAc) with methanol (MeOH) and diethylether (DEE) were studied using matrix isolation infrared spectroscopy. This study specifically searched for the ≡CH · · ·O hydrogen bonded complex in these systems, which manifest a n-σ* interaction and which is a local minimum ...

  2. Male weasels decrease activity and energy expenditure in response to high ambient temperatures.

    Directory of Open Access Journals (Sweden)

    Karol Zub

    Full Text Available The heat dissipation limit (HDL hypothesis suggests that the capacity of endotherms to dissipate body heat may impose constraints on their energy expenditure. Specifically, this hypothesis predicts that endotherms should avoid the detrimental consequences of hyperthermia by lowering their energy expenditure and reducing their activity in response to high ambient temperatures (T(a. We used an extensive data set on the daily energy expenditure (DEE, n = 27 and the daily activity time (AT, n = 48 of male weasels (Mustela nivalis during the spring and summer breeding season to test these predictions. We found that T(a was related in a "hump-shaped" (i.e. convex manner to AT, DEE, resting metabolic rate (RMR and metabolic scope (the ratio of DEE to RMR. These results support the HDL hypothesis because in response to warm Tas male weasels reduced their AT, DEE, and RMR. Although the activity and energy expenditure of large endotherms are most likely to be constrained in response to warm Tas because they are less able to dissipate heat, our results suggest that small endotherms may also experience constraints consistent with the HDL hypothesis.

  3. Energy expenditure during egg laying is equal for early and late breeding free-living female great tits

    NARCIS (Netherlands)

    te Marvelde, Luc; Webber, Simone L.; Meijer, Harro A. J.; Visser, Marcel E.; Lehikoinen, Esa

    In many bird populations, variation in the timing of reproduction exists but it is not obvious how this variation is maintained as timing has substantial fitness consequences. Daily energy expenditure (DEE) during the egg laying period increases with decreasing temperatures and thus perhaps only

  4. Energy expenditure during egg laying is equal for early and late breeding free-living female great tits

    NARCIS (Netherlands)

    te Marvelde, L.; Webber, S.L.; Meijer, H.A.J.; Visser, M.E.

    2012-01-01

    In many bird populations, variation in the timing of reproduction exists but it is not obvious how this variation is maintained as timing has substantial fitness consequences. Daily energy expenditure (DEE) during the egg laying period increases with decreasing temperatures and thus perhaps only

  5. ELECTROMAGNETIC CALORIMETER (ECAL)

    CERN Multimedia

    Philippe Bloch

    ECAL Barrel (EB) As already mentioned in June, the Barrel ECAL is fully commissioned and routinely used during CRUZET runs.  Good progress has been made in the last months to ensure a stable and fully reliable operation, in particular for the Trigger path. More details can be found in the DPG report in this bulletin.     ECAL Endcaps (EE) In the June CMS bulletin, it had been announced that the Dee’s mechanical assembly had been finished end of May. However the electronics integration was still going on for the first Dee. The Summer has seen a spectacular breakthrough of the Endcap project. The electronics integration of Dee1 was completed early July, and this first Dee was transported to point 5 on July 8th. The completion of the three other Dees followed at a pace of one per week. In all cases the quality of the detector as measured in the assembly center was excellent, with all channels active and  the expected noise performance (see for example the reports pr...

  6. Increased energy expenditure by a seabird in response to higher food abundance

    NARCIS (Netherlands)

    Jodice, PGR; Roby, DD; Suryan, RM; Irons, DB; Turco, KR; Brown, ED; Thedinga, JF; Visser, GH

    2006-01-01

    Variability in forage fish abundance strongly affects seabird behavior and reproductive success, although details of this relationship are unclear. During 1997 and 1998, we measured (1) daily energy expenditure (DEE) of 80 parent black-legged kittiwakes Rissa tridactyla at 2 colonies in Prince

  7. Significant Learning Experiences for English Foreign Language Students (Experiencias significativas para estudiantes de inglés como lengua extranjera)

    Science.gov (United States)

    Becerra, Luz María; McNulty, Maria

    2010-01-01

    This action research examines experiences that students in a grade 10 EFL class had with redesigning a grammar-unit into a topic-based unit. Strategies were formulating significant learning goals and objectives, and implementing and reflecting on activities with three dimensions of Dee Fink's (2003) taxonomy of significant learning: the human…

  8. Vocal signals in a tropical avian species, the redvented bulbul ...

    Indian Academy of Sciences (India)

    Unknown

    Evans R M 1994 Cold-induced calling and shivering in young. American white pelicans: Honest signaling of offspring need for warmth in a functionally integrated thermoregulatory system; Behaviour 129 13–34. Ficken M S, Hailman E D and Hailman J P 1994 The Chick-a- dee call system of the Mexican Chickadee; Condor ...

  9. Direct-to-consumer advertising of prescription medicines: a counter argument.

    Science.gov (United States)

    Mintzes, Barbara; Mangin, Dee

    2009-12-01

    Direct-to-consumer advertising of prescription-only medicines is currently only permitted in the USA and New Zealand. Barbara Mintzes and Dee Mangin provide their case against direct-to-consumer advertising of prescription medicines, arguing that its wider introduction would lead to a 'Pharma-knows-best' culture.

  10. Karusoo toob välja sõjateemalise lavastuse

    Index Scriptorium Estoniae

    2005-01-01

    M. Karusoo toob 24. märtsil Rakvere Teatris lavale Afganistani sõja teemalise lavastuse "Misjonärid", mis põhineb Dee Browni indiaanisõdade raamatul "Mata mu süda Wounded Knees" ja Afganistanis sõdinud meestega tehtud intervjuudel

  11. Lavastaja mõõdab sõdade varje / Merle Karusoo ; interv. Inna Grünfeldt

    Index Scriptorium Estoniae

    Karusoo, Merle, 1944-

    2005-01-01

    M. Karusoo Afganistani sõja teemaline lavastus "Misjonärid", mis põhineb Dee Browni indiaanisõdade raamatul "Mata mu süda Wounded Knees" ja Afganistanis sõdinud meestega tehtud intervjuudel. Lavastajaga lavastusest ja selle tegemise vajadusest

  12. Valus lugu valgetest sõduritest / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2005-01-01

    M. Karusoo tõi 24. märtsil Rakvere Teatris lavale Afganistani sõja teemalise lavastuse "Misjonärid", mis põhineb Dee Browni indiaanisõdade raamatul "Mata mu süda Wounded Knees" ja Afganistanis sõdinud meestega tehtud intervjuudel

  13. "Iial ei anta andeks sellele, kellele on tehtud ülekohut" / Merle Karusoo ; interv. Aigi Viira

    Index Scriptorium Estoniae

    Karusoo, Merle, 1944-

    2005-01-01

    M. Karusool valmib Rakvere teatri näitlejatega dokumentaalprojekt "Misjonärid", mis põhineb Afganistani sõjas käinud sõdurite mälestustel ning Dee Browni indiaanisõdade raamatul "Mata mu süda Wounded Knees"

  14. Inimesed lahinguväljal ehk Karmid pildid tegelikkusest / Enn Mälgand

    Index Scriptorium Estoniae

    Mälgand, Enn

    2005-01-01

    M. Karusoo Afganistani sõja teemaline lavastus "Misjonärid", mis põhineb Dee Browni indiaanisõdade raamatul "Mata mu süda Wounded Knees" ja Afganistanis sõdinud meestega tehtud intervjuudel. Esietendus Rakvere Teatris 24. märtsil 2005

  15. Teaching and learning in the interactive classroom.

    Science.gov (United States)

    Silverthorn, D U

    2006-12-01

    The Claude Bernard Distinguished Lectureship of the Teaching of Physiology Section is presented annually at the Experimental Biology meeting. The lectureship is named for Prof. Claude Bernard, the experimental physiologist who is credited with introducing the concept of homeostasis. The 2006 Claude Bernard Distinguished Lecture was given by Dr. Dee U. Silverthorn from the University of Texas at Austin, TX.

  16. Treatment of Memory Impairment and Sensorimotor Deficits in an Animal Model for the Gulf War Veterans Illnesses

    Science.gov (United States)

    2010-09-01

    oxidative DNA da mage in rat urin e following a single derm al dose of DEE T (N,N- diethyl-m-toluamide) and permethrin, alone and in combination... methamphetamine -induced dopam inergic neurotoxi city by flupirtine: microdialysis study on dopamine release and free radical generation. J. Neural Transm. 110:171

  17. STOMACH CONTENT ANALYSES OF MULLET FROM THE ...

    African Journals Online (AJOL)

    detailed description of the habitats and lif e-forms of benthic diatoms is given by Round (1971). The size of the motile ... small diatoms lived on the fine sticky silt of the Dee Estuary while larger diatoms lived on the sand. .... there was more animal material present including ciliates, fragments of crustacea, Rotifera, nematodes ...

  18. Rotationally resolved IR-diode laser studies of ground-state CO2 excited by collisions with vibrationally excited pyridine.

    Science.gov (United States)

    Johnson, Jeremy A; Kim, Kilyoung; Mayhew, Maurine; Mitchell, Deborah G; Sevy, Eric T

    2008-03-27

    Relaxation of highly vibrationally excited pyridine (C5NH5) by collisions with carbon dioxide has been investigated using diode laser transient absorption spectroscopy. Vibrationally hot pyridine (E' = 40,660 cm(-1)) was prepared by 248 nm excimer laser excitation followed by rapid radiationless relaxation to the ground electronic state. Pyridine then collides with CO2, populating the high rotational CO2 states with large amounts of translational energy. The CO2 nascent rotational population distribution of the high-J (J = 58-80) tail of the 00(0)0 state was probed at short times following the excimer laser pulse to measure rate constants and probabilities for collisions populating these CO2 rotational states. Doppler spectroscopy was used to measure the CO2 recoil velocity distribution for J = 58-80 of the 00(0)0 state. The energy-transfer distribution function, P(E,E'), from E' - E approximately 1300-7000 cm(-1) was obtained by re-sorting the state-indexed energy-transfer probabilities as a function of DeltaE. P(E,E') is fit to an exponential or biexponential function to determine the average energy transferred in a single collision between pyridine and CO2. Also obtained are fit parameters that can be compared to previously studied systems (pyrazine, C6F6, methylpyrazine, and pyrimidine/CO2). Although the rotational and translational temperatures that describe pyridine/CO2 energy transfer are similar to previous systems, the energy-transfer probabilities are much smaller. P(E,E') fit parameters for pyridine/CO2 and the four previously studied systems are compared to various donor molecular properties. Finally, P(E,E') is analyzed in the context of two models, one indicating that P(E,E') shape is primarily determined by the low-frequency out-of-plane donor vibrational modes, and the other that indicates that P(E,E') shape can be determined from how the donor molecule final density of states changes with DeltaE.

  19. Suppression of urinary bladder urothelial carcinoma cell by the ethanol extract of pomegranate fruit through cell cycle arrest and apoptosis.

    Science.gov (United States)

    Lee, Song-Tay; Lu, Min-Hua; Chien, Lan-Hsiang; Wu, Ting-Feng; Huang, Li-Chien; Liao, Gwo-Ing

    2013-12-21

    Pomegranate possesses many medicinal properties such as antioxidant, anti-inflammation and antitumor. It has been extensively used as a folk medicine by many cultures. Pomegranate fruit has been shown to have the inhibitory efficacy against prostate cancer and lung cancer in vitro and in vivo. It can be exploited in chemoprevention and chemotherapy of prostate cancer. In this study we examined the anti-cancer efficacy of pomegranate fruit grown in Taiwan against urinary bladder urothelial carcinoma (UBUC) and its mechanism of action. Edible portion of Taiwanese pomegranate was extracted using ethanol and the anti-cancer effectiveness of ethanol extract was evaluated by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Flow cytometry and western immunoblotting were exploited to uncover the molecular pathways underlying anti-UBUC activity of Taiwanese pomegranate ethanol extract. This study demonstrated that Taiwanese pomegranate fruit ethanol extract (PEE) could effectively restrict the proliferation of UBUC T24 and J82 cells. Cell cycle analyses indicated that the S phase arrest induced by PEE treatment might be caused by an increase in cyclin A protein level and a decrease in the expression of cyclin-dependent kinase 1. The results of western immunoblotting demonstrated that PEE treatment could not only evoke the activation of pro-caspase-3, -8,-9 but also increase Bax/Bcl-2 ratio in T24 cells. The above observations implicated that PEE administration might trigger the apoptosis in T24 cells through death receptor signaling and mitochondrial damage pathway. Besides we found that PEE exposure to T24 cells could provoke intensive activation of procaspase-12 and enhance the expressions of CHOP and Bip, endoplasmic reticulum (ER) stress marker, suggesting that ER stress might be the cardinal apoptotic mechanism of PEE-induced inhibition of bladder cancer cell. The analytical results of this study help to provide insight into the molecular mechanism

  20. Suppression of urinary bladder urothelial carcinoma cell by the ethanol extract of pomegranate fruit through cell cycle arrest and apoptosis

    Science.gov (United States)

    2013-01-01

    Background Pomegranate possesses many medicinal properties such as antioxidant, anti-inflammation and antitumor. It has been extensively used as a folk medicine by many cultures. Pomegranate fruit has been shown to have the inhibitory efficacy against prostate cancer and lung cancer in vitro and in vivo. It can be exploited in chemoprevention and chemotherapy of prostate cancer. In this study we examined the anti-cancer efficacy of pomegranate fruit grown in Taiwan against urinary bladder urothelial carcinoma (UBUC) and its mechanism of action. Methods Edible portion of Taiwanese pomegranate was extracted using ethanol and the anti-cancer effectiveness of ethanol extract was evaluated by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Flow cytometry and western immunoblotting were exploited to uncover the molecular pathways underlying anti-UBUC activity of Taiwanese pomegranate ethanol extract. Results This study demonstrated that Taiwanese pomegranate fruit ethanol extract (PEE) could effectively restrict the proliferation of UBUC T24 and J82 cells. Cell cycle analyses indicated that the S phase arrest induced by PEE treatment might be caused by an increase in cyclin A protein level and a decrease in the expression of cyclin-dependent kinase 1. The results of western immunoblotting demonstrated that PEE treatment could not only evoke the activation of pro-caspase-3, -8,-9 but also increase Bax/Bcl-2 ratio in T24 cells. The above observations implicated that PEE administration might trigger the apoptosis in T24 cells through death receptor signaling and mitochondrial damage pathway. Besides we found that PEE exposure to T24 cells could provoke intensive activation of procaspase-12 and enhance the expressions of CHOP and Bip, endoplasmic reticulum (ER) stress marker, suggesting that ER stress might be the cardinal apoptotic mechanism of PEE-induced inhibition of bladder cancer cell. Conclusions The analytical results of this study help to provide