78 FR 1247 - Certain Electronic Devices, Including Wireless Communication Devices, Tablet Computers, Media...

Science.gov (United States)

2013-01-08

... Wireless Communication Devices, Tablet Computers, Media Players, and Televisions, and Components Thereof... devices, including wireless communication devices, tablet computers, media players, and televisions, and... wireless communication devices, tablet computers, media players, and televisions, and components thereof...

CERN’s Computing rules updated to include policy for control systems

CERN Multimedia

IT Department

2008-01-01

The use of CERN’s computing facilities is governed by rules defined in Operational Circular No. 5 and its subsidiary rules of use. These rules are available from the web site http://cern.ch/ComputingRules. Please note that the subsidiary rules for Internet/Network use have been updated to include a requirement that control systems comply with the CNIC(Computing and Network Infrastructure for Control) Security Policy. The security policy for control systems, which was approved earlier this year, can be accessed at https://edms.cern.ch/document/584092 IT Department

The Validation of Vapor Phase Hydrogen Peroxide Microbial Reduction for Planetary Protection and a Proposed Vacuum Process Specification

Science.gov (United States)

Chung, Shirley; Barengoltz, Jack; Kern, Roger; Koukol, Robert; Cash, Howard

2006-01-01

The Jet Propulsion Laboratory, in conjunction with the NASA Planetary Protection Officer, has selected the vapor phase hydrogen peroxide sterilization process for continued development as a NASA approved sterilization technique for spacecraft subsystems and systems. The goal is to include this technique, with an appropriate specification, in NPR 8020.12C as a low temperature complementary technique to the dry heat sterilization process.To meet microbial reduction requirements for all Mars in-situ life detection and sample return missions, various planetary spacecraft subsystems will have to be exposed to a qualified sterilization process. This process could be the elevated temperature dry heat sterilization process (115 C for 40 hours) which was used to sterilize the Viking lander spacecraft. However, with utilization of such elements as highly sophisticated electronics and sensors in modern spacecraft, this process presents significant materials challenges and is thus an undesirable bioburden reduction method to design engineers. The objective of this work is to introduce vapor hydrogen peroxide (VHP) as an alternative to dry heat microbial reduction to meet planetary protection requirements.The VHP process is widely used by the medical industry to sterilize surgical instruments and biomedical devices, but high doses of VHP may degrade the performance of flight hardware, or compromise material properties. Our goal for this study was to determine the minimum VHP process conditions to achieve microbial reduction levels acceptable for planetary protection.

77 FR 27078 - Certain Electronic Devices, Including Mobile Phones and Tablet Computers, and Components Thereof...

Science.gov (United States)

2012-05-08

... Phones and Tablet Computers, and Components Thereof; Notice of Receipt of Complaint; Solicitation of... entitled Certain Electronic Devices, Including Mobile Phones and Tablet Computers, and Components Thereof... the United States after importation of certain electronic devices, including mobile phones and tablet...

31 CFR 359.31 - What definitive Series I savings bonds are included in the computation?

Science.gov (United States)

2010-07-01

... definitive Series I savings bonds are included in the computation? In computing the purchases for each person, we include the following outstanding definitive bonds purchased in that calendar year: (a) All bonds... bearing that person's TIN; and (c) All gift bonds registered in the name of that person but bearing the...

SAFT Li-ion Technology for High Rate Applications

National Research Council Canada - National Science Library

Nechev, Kamen; Deveney, Bridget; Guseynov, Teymur; Erbacher, John; Vukson, Stephen

2006-01-01

SAFT will present an update of its state-of-the art Very High Power (VHP) Lithium-ion (Li-ion) technology. The VHP cells are currently being qualified for use in military aircraft applications as well as in future military hybrid vehicles...

Computational and experimental analyses of the wave propagation through a bar structure including liquid-solid interface

Energy Technology Data Exchange (ETDEWEB)

Park, Sang Jin [UST Graduate School, Daejeon (Korea, Republic of); Rhee, Hui Nam [Division of Mechanical and Aerospace Engineering, Sunchon National University, Sunchon (Korea, Republic of); Yoon, Doo Byung; Park, Jin Ho [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2015-08-15

In this research, we study the propagation of longitudinal and transverse waves through a metal rod including a liquid layer using computational and experimental analyses. The propagation characteristics of longitudinal and transverse waves obtained by the computational and experimental analyses were consistent with the wave propagation theory for both cases, that is, the homogeneous metal rod and the metal rod including a liquid layer. The fluid-structure interaction modeling technique developed for the computational wave propagation analysis in this research can be applied to the more complex structures including solid-liquid interfaces.

VIRUS OF HUMAN PAPILLOMA. EPIDEMIOLOGY, LABORATORY DIAGNOSTICS AND PREVENTION OF PAPILLOMA VIRAL INFECTION

Directory of Open Access Journals (Sweden)

O. V. Narvskaya

2011-01-01

Full Text Available Abstract. The information reflected modern knowledge about virus of human papilloma (VHP and pathogenesis of papilloma viral infection is presented in the lecture. The actual problems of epidemiology, laboratory diagnostics and prevention of VHP associated damage of cervical epithelium have been described.

A Pulmonary Rehabilitation Decisional Score to Define Priority Access for COPD Patients

Directory of Open Access Journals (Sweden)

Michele Vitacca

2017-01-01

Full Text Available This retrospective study aimed to evaluate, through an ad hoc 17-item tool, the Pulmonary Rehabilitation Decisional Score (PRDS, the priority access to PR prescription by respiratory specialists. The PRDS, scoring functional, clinical, disability, frailty, and participation parameters from 0 = low priority to 34 = very high priority for PR access, was retrospectively calculated on 124 specialist reports sent to the GP of subjects (aged 71±11 years, FEV1%  51±17 consecutively admitted to our respiratory outpatient clinic. From the specialist’s report the final subject’s allocation could be low priority (LP (>60 days, high priority (HP (30–60 days, or very high priority (VHP (<30 days to rehabilitation. The PRDS calculation showed scores significantly higher in VHP versus LP (p<0.001 and significantly different between HP and VHP (p<0.001. Comparing the specialist’s allocation decision and priority choice based on PRDS cut-offs, PR prescription was significantly more appropriate in VHP than in HP (p=0.016. Specialists underprescribed PR in 49% of LP cases and overprescribed it in 46% and 30% of the HP and VHP prescriptions, respectively. A multicomprehensive score is feasible being useful for staging the clinical priorities for PR prescription and facilitating sustainability of the health system.

Consolidation effects on tensile properties of an elemental Al matrix composite

Energy Technology Data Exchange (ETDEWEB)

Tang, F. [Building 4515, MS 6064, Metals and Ceramics Division, Oak Ridge National Lab, Oak Ridge, TN 37831 (United States)]. E-mail: tangf@ornl.gov; Meeks, H. [Ceracon Inc., 5150 Fairoaks Blvd. 01-330, Carmichael, CA 95628 (United States); Spowart, J.E. [UES Incorporated, AFRL/MLLM Building 655, 2230 Tenth St. Suite 1, Wright-Patterson AFB, OH 45433 (United States); Gnaeupel-Herold, T. [NIST Center for Neutron Research, 100 Bureau Dr. Stop 8562, Gaithersburg, MD 20899-8562 (United States); Prask, H. [NIST Center for Neutron Research, 100 Bureau Dr. Stop 8562, Gaithersburg, MD 20899-8562 (United States); Anderson, I.E. [Materials and Engineering Physics Program, Ames Laboratory, Iowa State University, Ames, IA 50011 (United States)

2004-11-25

In a simplified composite design, an unalloyed Al matrix was reinforced by spherical Al-Cu-Fe alloy particles (30 vol.%), using either commercial purity (99.7%) or high purity (99.99%) fine powders (diameter < 10 {mu}m). This composite material was consolidated by either vacuum hot pressing (VHP) or quasi-isostatic forging. The spatial distribution of reinforcement particles in both VHP and forged samples was shown to be almost the same by quantitative characterization with a multi-scale area fraction analysis technique. The tensile properties of all composite samples were tested and the forged materials showed significantly higher strength, while the elastic modulus values of all composite materials were close to the upper bound of theoretical predictions. Neutron diffraction measurements showed that there were high compressive residual stresses in the Al matrix of the forged samples and relatively low Al matrix residual stresses (predominantly compressive) in the VHP samples. By tensile tests and neutron diffraction measurements of the forged samples after annealing, it was shown that the high compressive residual stresses in the Al matrix were relieved and that tensile strength was also reduced to almost the same level as that of the VHP samples. Therefore, it was deduced that increased compressive residual stresses and enhanced dislocation densities in the forged composites raised the tensile strength to higher values than those of the VHP composites.

Successful control of 2 simultaneous outbreaks of OXA-48 carbapenemase-producing Enterobacteriaceae and multidrug-resistant Acinetobacter baumannii in an intensive care unit.

Science.gov (United States)

Robustillo-Rodela, A; Pérez-Blanco, V; Espinel Ruiz, M A; Ruiz Carrascoso, G; Figueira Iglesias, J C; Abad Martín, D

2017-12-01

This report describes a double outbreak of OXA-48-producing Enterobacteriaceae (OXA-48-PE) and multidrug-resistant Acinetobacter baumannii (MRAB) in an intensive care unit (ICU) and the effectiveness of measures implemented, including decontamination with vaporized hydrogen peroxide (VHP). Affected patients were isolated in a confined area and cared for by dedicated personnel. Four percent chlorhexidine soap was used for patient daily hygiene. All patients are subjected to contact precautions. An in-depth cleaning of the ICU was performed with a chlorine solution, followed by decontamination with VHP. Environmental samples were taken before and after the decontamination. From July-October 2015, 13 patients were colonized or infected by OXA-48-PE and 18 by MRAB in the ICU. The cumulative incidence of OXA-48-PE and MRAB was 3.48% and 4.81%, respectively. In the period after the intervention, they were 0.8% and 0%, respectively (P control of outbreaks caused by microorganisms of high environmental impact. The rapid effect after the VHP treatment suggests an influence of this measure in eradication. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

77 FR 34063 - Certain Electronic Devices, Including Mobile Phones and Tablet Computers, and Components Thereof...

Science.gov (United States)

2012-06-08

... Phones and Tablet Computers, and Components Thereof Institution of Investigation AGENCY: U.S... the United States after importation of certain electronic devices, including mobile phones and tablet... mobile phones and tablet computers, and components thereof that infringe one or more of claims 1-3 and 5...

The Model of the Software Running on a Computer Equipment Hardware Included in the Grid network

Directory of Open Access Journals (Sweden)

T. A. Mityushkina

2012-12-01

Full Text Available A new approach to building a cloud computing environment using Grid networks is proposed in this paper. The authors describe the functional capabilities, algorithm, model of software running on a computer equipment hardware included in the Grid network, that will allow to implement cloud computing environment using Grid technologies.

Top 10 Threats to Computer Systems Include Professors and Students

Science.gov (United States)

Young, Jeffrey R.

2008-01-01

User awareness is growing in importance when it comes to computer security. Not long ago, keeping college networks safe from cyberattackers mainly involved making sure computers around campus had the latest software patches. New computer worms or viruses would pop up, taking advantage of some digital hole in the Windows operating system or in…

Virtual health platform for medical tourism purposes.

Science.gov (United States)

Martinez, Debora; Ferriol, Pedro; Tous, Xisco; Cabrer, Miguel; Prats, Mercedes

2008-01-01

This paper introduces an overview of the Virtual Health Platform (VHP), an alternative approach to create a functional PHR system in a medical tourism environment. The proposed platform has been designed in order to be integrated with EHR infrastructures and in this way it expects to be useful and more advantageous to the patient or tourist. Use cases of the VHP and its potential benefits summarize the analysis.

Materials development for ITER shielding and test blanket in China

Energy Technology Data Exchange (ETDEWEB)

Chen, J.M., E-mail: Chenjm@swip.ac.cn [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041 (China); Wu, J.H.; Liu, X.; Wang, P.H. [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041 (China); Wang, Z.H.; Li, Z.N. [Ningxia Orient Non-ferrous Metals Group Co. Ltd., P.O. Box 105, Shizuishan (China); Wang, X.S.; Zhang, P.C. [China Academy of Engineering Physics, P.O. Box 919-71, Mianyang 621900 (China); Zhang, N.M.; Fu, H.Y.; Liu, D.H. [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041 (China)

2011-10-01

China is a member of the ITER program and is developing her own materials for its shielding and test blanket modules. The materials include vacuum-hot-pressing (VHP) Be, CuCrZr alloy, 316L(N) and China low activation ferritic/martensitic (CLF-1) steels. Joining technologies including Be/Cu hot isostatic pressing (HIP) and electron beam (EB) weldability of 316L(N) were investigated. Chinese VHP-Be showed good properties, with BeO content and ductility that satisfy the ITER requirements. Be/Cu mock-ups were fabricated for Be qualification tests at simulated ITER vertical displacement event (VDE) and heat flux cycling conditions. Fine microstructure and good mechanical strength of the CuCrZr alloy were achieved by a pre-forging treatment, while the weldability of 316L(N) by EB was demonstrated for welding depths varying from 5 to 80 mm. Fine microstructure, high strength, and good ductility were achieved in CLF-1 steel by an optimized normalizing, tempering and aging procedure.

78 FR 63492 - Certain Electronic Devices, Including Mobile Phones and Tablet Computers, and Components Thereof...

Science.gov (United States)

2013-10-24

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-847] Certain Electronic Devices, Including Mobile Phones and Tablet Computers, and Components Thereof; Notice of Request for Statements on the Public Interest AGENCY: U.S. International Trade Commission. ACTION: Notice. SUMMARY: Notice is...

31 CFR 351.66 - What book-entry Series EE savings bonds are included in the computation?

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What book-entry Series EE savings... DEBT OFFERING OF UNITED STATES SAVINGS BONDS, SERIES EE Book-Entry Series EE Savings Bonds § 351.66 What book-entry Series EE savings bonds are included in the computation? (a) We include all bonds that...

High Pressure Germination of Bacillus subtilis Spores with Alterations in Levels and Types of Germination Proteins

Science.gov (United States)

2014-01-01

1ITLE AND SUBTITLE 5a CONTRACTNUMBER High pressure germination of Bacillus subtilis spores with W911NF-09-l-0286 alterations in levels and types of...A moderate high pressure (mHP) of 150 megaPascals (MPa) triggers germination of Bacillus subtilis spores via germinant receptors (GRs), while...germination by a very high pressure (vHP) of550 MPa is GR-independent. The mHP and vHP germination of Bacillus subtilis spores with different levels ofGRs

A method for the computation of turbulent polymeric liquids including hydrodynamic interactions and chain entanglements

Energy Technology Data Exchange (ETDEWEB)

Kivotides, Demosthenes, E-mail: demosthenes.kivotides@strath.ac.uk

2017-02-12

An asymptotically exact method for the direct computation of turbulent polymeric liquids that includes (a) fully resolved, creeping microflow fields due to hydrodynamic interactions between chains, (b) exact account of (subfilter) residual stresses, (c) polymer Brownian motion, and (d) direct calculation of chain entanglements, is formulated. Although developed in the context of polymeric fluids, the method is equally applicable to turbulent colloidal dispersions and aerosols. - Highlights: • An asymptotically exact method for the computation of polymer and colloidal fluids is developed. • The method is valid for all flow inertia and all polymer volume fractions. • The method models entanglements and hydrodynamic interactions between polymer chains.

The Watts-Strogatz network model developed by including degree distribution: theory and computer simulation

Energy Technology Data Exchange (ETDEWEB)

Chen, Y W [Surface Physics Laboratory and Department of Physics, Fudan University, Shanghai 200433 (China); Zhang, L F [Surface Physics Laboratory and Department of Physics, Fudan University, Shanghai 200433 (China); Huang, J P [Surface Physics Laboratory and Department of Physics, Fudan University, Shanghai 200433 (China)

2007-07-20

By using theoretical analysis and computer simulations, we develop the Watts-Strogatz network model by including degree distribution, in an attempt to improve the comparison between characteristic path lengths and clustering coefficients predicted by the original Watts-Strogatz network model and those of the real networks with the small-world property. Good agreement between the predictions of the theoretical analysis and those of the computer simulations has been shown. It is found that the developed Watts-Strogatz network model can fit the real small-world networks more satisfactorily. Some other interesting results are also reported by adjusting the parameters in a model degree-distribution function. The developed Watts-Strogatz network model is expected to help in the future analysis of various social problems as well as financial markets with the small-world property.

The Watts-Strogatz network model developed by including degree distribution: theory and computer simulation

International Nuclear Information System (INIS)

Chen, Y W; Zhang, L F; Huang, J P

2007-01-01

By using theoretical analysis and computer simulations, we develop the Watts-Strogatz network model by including degree distribution, in an attempt to improve the comparison between characteristic path lengths and clustering coefficients predicted by the original Watts-Strogatz network model and those of the real networks with the small-world property. Good agreement between the predictions of the theoretical analysis and those of the computer simulations has been shown. It is found that the developed Watts-Strogatz network model can fit the real small-world networks more satisfactorily. Some other interesting results are also reported by adjusting the parameters in a model degree-distribution function. The developed Watts-Strogatz network model is expected to help in the future analysis of various social problems as well as financial markets with the small-world property

ICECON: a computer program used to calculate containment back pressure for LOCA analysis (including ice condenser plants)

International Nuclear Information System (INIS)

1976-07-01

The ICECON computer code provides a method for conservatively calculating the long term back pressure transient in the containment resulting from a hypothetical Loss-of-Coolant Accident (LOCA) for PWR plants including ice condenser containment systems. The ICECON computer code was developed from the CONTEMPT/LT-022 code. A brief discussion of the salient features of a typical ice condenser containment is presented. Details of the ice condenser models are explained. The corrections and improvements made to CONTEMPT/LT-022 are included. The organization of the code, including the calculational procedure, is outlined. The user's manual, to be used in conjunction with the CONTEMPT/LT-022 user's manual, a sample problem, a time-step study (solution convergence) and a comparison of ICECON results with the results of the NSSS vendor are presented. In general, containment pressure calculated with the ICECON code agree with those calculated by the NSSS vendor using the same mass and energy release rates to the containment

Explicitly-correlated ring-coupled-cluster-doubles theory: Including exchange for computations on closed-shell systems

Energy Technology Data Exchange (ETDEWEB)

Hehn, Anna-Sophia; Holzer, Christof; Klopper, Wim, E-mail: klopper@kit.edu

2016-11-10

Highlights: • Ring-coupled-cluster-doubles approach now implemented with exchange terms. • Ring-coupled-cluster-doubles approach now implemented with F12 functions. • Szabo–Ostlund scheme (SO2) implemented for use in SAPT. • Fast convergence to the limit of a complete basis. • Implementation in the TURBOMOLE program system. - Abstract: Random-phase-approximation (RPA) methods have proven to be powerful tools in electronic-structure theory, being non-empirical, computationally efficient and broadly applicable to a variety of molecular systems including small-gap systems, transition-metal compounds and dispersion-dominated complexes. Applications are however hindered due to the slow basis-set convergence of the electron-correlation energy with the one-electron basis. As a remedy, we present approximate explicitly-correlated RPA approaches based on the ring-coupled-cluster-doubles formulation including exchange contributions. Test calculations demonstrate that the basis-set convergence of correlation energies is drastically accelerated through the explicitly-correlated approach, reaching 99% of the basis-set limit with triple-zeta basis sets. When implemented in close analogy to early work by Szabo and Ostlund [36], the new explicitly-correlated ring-coupled-cluster-doubles approach including exchange has the perspective to become a valuable tool in the framework of symmetry-adapted perturbation theory (SAPT) for the computation of dispersion energies of molecular complexes of weakly interacting closed-shell systems.

A computer software system for the generation of global ocean tides including self-gravitation and crustal loading effects

Science.gov (United States)

Estes, R. H.

1977-01-01

A computer software system is described which computes global numerical solutions of the integro-differential Laplace tidal equations, including dissipation terms and ocean loading and self-gravitation effects, for arbitrary diurnal and semidiurnal tidal constituents. The integration algorithm features a successive approximation scheme for the integro-differential system, with time stepping forward differences in the time variable and central differences in spatial variables. Solutions for M2, S2, N2, K2, K1, O1, P1 tidal constituents neglecting the effects of ocean loading and self-gravitation and a converged M2, solution including ocean loading and self-gravitation effects are presented in the form of cotidal and corange maps.

Fumaric acid production using renewable resources from biodiesel and cane sugar production processes.

Science.gov (United States)

Papadaki, Aikaterini; Papapostolou, Harris; Alexandri, Maria; Kopsahelis, Nikolaos; Papanikolaou, Seraphim; de Castro, Aline Machado; Freire, Denise M G; Koutinas, Apostolis A

2018-04-13

The microbial production of fumaric acid by Rhizopus arrhizus NRRL 2582 has been evaluated using soybean cake from biodiesel production processes and very high polarity (VHP) sugar from sugarcane mills. Soybean cake was converted into a nutrient-rich hydrolysate via a two-stage bioprocess involving crude enzyme production via solid state fermentations (SSF) of either Aspergillus oryzae or R. arrhizus cultivated on soybean cake followed by enzymatic hydrolysis of soybean cake. The soybean cake hydrolysate produced using crude enzymes derived via SSF of R. arrhizus was supplemented with VHP sugar and evaluated using different initial free amino nitrogen (FAN) concentrations (100, 200, and 400 mg/L) in fed-batch cultures for fumaric acid production. The highest fumaric acid concentration (27.3 g/L) and yield (0.7 g/g of total consumed sugars) were achieved when the initial FAN concentration was 200 mg/L. The combination of VHP sugar with soybean cake hydrolysate derived from crude enzymes produced by SSF of A. oryzae at 200 mg/L initial FAN concentration led to the production of 40 g/L fumaric acid with a yield of 0.86 g/g of total consumed sugars. The utilization of sugarcane molasses led to low fumaric acid production by R. arrhizus, probably due to the presence of various minerals and phenolic compounds. The promising results achieved through the valorization of VHP sugar and soybean cake suggest that a focused study on molasses pretreatment could lead to enhanced fumaric acid production.

PTA-1 computer program for treating pressure transients in hydraulic networks including the effect of pipe plasticity

International Nuclear Information System (INIS)

Youngdahl, C.K.; Kot, C.A.

1977-01-01

Pressure pulses in the intermediate sodium system of a liquid-metal-cooled fast breeder reactor, such as may originate from a sodium/water reaction in a steam generator, are propagated through the complex sodium piping network to system components such as the pump and intermediate heat exchanger. To assess the effects of such pulses on continued reliable operation of these components and to contribute to system designs which result in the mitigation of these effects, Pressure Transient Analysis (PTA) computer codes are being developed for accurately computing the transmission of pressure pulses through a complicated fluid transport system, consisting of piping, fittings and junctions, and components. PTA-1 provides an extension of the well-accepted and verified fluid hammer formulation for computing hydraulic transients in elastic or rigid piping systems to include plastic deformation effects. The accuracy of the modeling of pipe plasticity effects on transient propagation has been validated using results from two sets of Stanford Research Institute experiments. Validation of PTA-1 using the latter set of experiments is described briefly. The comparisons of PTA-1 computations with experiments show that (1) elastic-plastic deformation of LMFBR-type piping can have a significant qualitative and quantitative effect on pressure pulse propagation, even in simple systems; (2) classical fluid-hammer theory gives erroneous results when applied to situations where piping deforms plastically; and (3) the computational model incorporated in PTA-1 for predicting plastic deformation and its effect on transient propagation is accurate

Simulated hatchery system to assess bacteriophage efficacy against Vibrio harveyi.

Science.gov (United States)

Raghu Patil, J; Desai, Srividya Narayanamurthy; Roy, Panchali; Durgaiah, Murali; Saravanan, R Sanjeev; Vipra, Aradhana

2014-12-02

Vibriosis caused by luminous Vibrio harveyi commonly contributes to poor survival in shrimp hatcheries and aquaculture ponds. Lytic bacteriophages pathogenic for V. harveyi are currently being investigated as an alternative to antibiotics to prevent vibriosis. Here, 8 bacteriophages were isolated from oysters and clams using V. harveyi strains as baiting hosts. Among these bacteriophages, 1 strain (VHP6b) identified as broadly pathogenic for 27 V. harveyi strains examined was further characterized by electron microscopy and genome sequence analysis. Phage VHP6b possessed a tail and morphology consistent with it being a member of the family Siphoviridae, and its genome and proteome were most closely related to the Vibrio phages SSP02 and MAR10. An integrase gene essential for lysogeny was not evident. The ability of bacteriophage VHP6b to protect shrimp postlarvae against vibriosis caused by V. harveyi strain VH6 was demonstrated in a model system designed to simulate typical hatchery conditions. Bacteriophage treatment improved survival of postlarvae by 40 to 60% under these conditions, so therapies based on this or other bacteriophages may be useful in shrimp hatcheries.

CT imaging before transcatheter aortic valve implantation (TAVI) using variable helical pitch scanning and its diagnostic performance for coronary artery disease

Energy Technology Data Exchange (ETDEWEB)

Matsumoto, Shunsuke; Yamada, Yoshitake; Hashimoto, Masahiro; Okamura, Teppei; Jinzaki, Masahiro [Keio University School of Medicine, Department of Diagnostic Radiology, Shinanomachi, Shinjuku-ku, Tokyo (Japan); Yamada, Minoru [Keio University School of Medicine, Research Park, Tokyo (Japan); Yashima, Fumiaki; Hayashida, Kentaro; Fukuda, Keiichi [Keio University School of Medicine, Department of Cardiology, Tokyo (Japan)

2017-05-15

To evaluate the effectiveness of CT before TAVI using variable helical pitch (VHP) scanning and its diagnostic performance for coronary artery disease (CAD). Sixty patients (84.4 ± 4.6 years) scheduled for TAVI underwent CT using VHP scanning with the contrast material (CM) volume calculated as scanning time x weight [kg] x 0.06 mL. Retrospective electrocardiography (ECG)-gated scanning was utilized to examine the thorax, and non-ECG-gated scanning of the abdomen immediately followed. We analyzed CT attenuation values of the coronary arteries, aorta, iliac and femoral arteries. The coronary CT angiography images were evaluated for the presence of stenosis (≥50 %); invasive coronary angiography served as a reference standard. The average attenuations of all of the arteries were greater than 400 HU. We could evaluate the peripheral access vessels and dimensions of the ascending aorta, aortic root, and aortic annulus in all patients. The average volume of CM was 38.7 ± 8.5 mL. On per-patient and vessel analysis, CT showed 91.7 % and 89.5 % sensitivity, and 91.3 % and 97.4 % negative predictive value (NPV). CT using VHP scanning with an average CM volume of 38.7 mL is useful before TAVI and had a high sensitivity and NPV in excluding obstructive CAD. (orig.)

Determination of boiling point of petrochemicals by gas chromatography-mass spectrometry and multivariate regression analysis of structural activity relationship.

Science.gov (United States)

Fakayode, Sayo O; Mitchell, Breanna S; Pollard, David A

2014-08-01

Accurate understanding of analyte boiling points (BP) is of critical importance in gas chromatographic (GC) separation and crude oil refinery operation in petrochemical industries. This study reported the first combined use of GC separation and partial-least-square (PLS1) multivariate regression analysis of petrochemical structural activity relationship (SAR) for accurate BP determination of two commercially available (D3710 and MA VHP) calibration gas mix samples. The results of the BP determination using PLS1 multivariate regression were further compared with the results of traditional simulated distillation method of BP determination. The developed PLS1 regression was able to correctly predict analytes BP in D3710 and MA VHP calibration gas mix samples, with a root-mean-square-%-relative-error (RMS%RE) of 6.4%, and 10.8% respectively. In contrast, the overall RMS%RE of 32.9% and 40.4%, respectively obtained for BP determination in D3710 and MA VHP using a traditional simulated distillation method were approximately four times larger than the corresponding RMS%RE of BP prediction using MRA, demonstrating the better predictive ability of MRA. The reported method is rapid, robust, and promising, and can be potentially used routinely for fast analysis, pattern recognition, and analyte BP determination in petrochemical industries. Copyright © 2014 Elsevier B.V. All rights reserved.

A study of prostate delineation referenced against a gold standard created from the visible human data

International Nuclear Information System (INIS)

Gao Zhanrong; Wilkins, David; Eapen, Libni; Morash, Christopher; Wassef, Youssef; Gerig, Lee

2007-01-01

Purpose: To measure inter- and intra-observer variation and systematic error in CT based prostate delineation, where individual delineations are referenced against a gold standard produced from photographic anatomical images from the Visible Human Project (VHP). Materials and methods: The CT and anatomical images of the VHP male form the basic data set for this study. The gold standard was established based on 1 mm thick anatomical photographic images. These were registered against the 3 mm thick CT images that were used for target delineation. A total of 120 organ delineations were performed by six radiation oncologists. Results: The physician delineated prostate volume was on average 30% larger than the 'true' prostate volume, but on average included only 84% of the gold standard volume. Our study found a systematic delineation error such that posterior portions of the prostate were always missed while anteriorly some normal tissue was always defined as target. Conclusions: Our data suggest that radiation oncologists are more concerned with the unintentional inclusion of rectal tissue than they are in missing prostate volume. In contrast, they are likely to overextend the anterior boundary of the prostate to encompass normal tissue such as the bladder

PTAC: a computer program for pressure-transient analysis, including the effects of cavitation. [LMFBR

Energy Technology Data Exchange (ETDEWEB)

Kot, C A; Youngdahl, C K

1978-09-01

PTAC was developed to predict pressure transients in nuclear-power-plant piping systems in which the possibility of cavitation must be considered. The program performs linear or nonlinear fluid-hammer calculations, using a fixed-grid method-of-characteristics solution procedure. In addition to pipe friction and elasticity, the program can treat a variety of flow components, pipe junctions, and boundary conditions, including arbitrary pressure sources and a sodium/water reaction. Essential features of transient cavitation are modeled by a modified column-separation technique. Comparisons of calculated results with available experimental data, for a simple piping arrangement, show good agreement and provide validation of the computational cavitation model. Calculations for a variety of piping networks, containing either liquid sodium or water, demonstrate the versatility of PTAC and clearly show that neglecting cavitation leads to erroneous predictions of pressure-time histories.

CTmod—A toolkit for Monte Carlo simulation of projections including scatter in computed tomography

Czech Academy of Sciences Publication Activity Database

Malušek, Alexandr; Sandborg, M.; Alm Carlsson, G.

2008-01-01

Roč. 90, č. 2 (2008), s. 167-178 ISSN 0169-2607 Institutional research plan: CEZ:AV0Z10480505 Keywords : Monte Carlo * computed tomography * cone beam * scatter Subject RIV: JC - Computer Hardware ; Software Impact factor: 1.220, year: 2008 http://dx.doi.org/10.1016/j.cmpb.2007.12.005

Including Internet insurance as part of a hospital computer network security plan.

Science.gov (United States)

Riccardi, Ken

2002-01-01

Cyber attacks on a hospital's computer network is a new crime to be reckoned with. Should your hospital consider internet insurance? The author explains this new phenomenon and presents a risk assessment for determining network vulnerabilities.

Field Evaluation of Whole Airliner Decontamination Technologies - Wide-Body Aircraft With Dual-Use Application for Railcars

National Research Council Canada - National Science Library

Gale, William F; Gale, Hyacinth S; Watson, Jean

2008-01-01

... vaporized hydrogen peroxide (VHP )* is discussed. The report is submitted in the context of a decontamination technology selection exercise, laboratory work conducted on the efficacy of thermal decontamination, and as a follow-on to a...

Pulmonary nodule characterization, including computer analysis and quantitative features.

Science.gov (United States)

Bartholmai, Brian J; Koo, Chi Wan; Johnson, Geoffrey B; White, Darin B; Raghunath, Sushravya M; Rajagopalan, Srinivasan; Moynagh, Michael R; Lindell, Rebecca M; Hartman, Thomas E

2015-03-01

Pulmonary nodules are commonly detected in computed tomography (CT) chest screening of a high-risk population. The specific visual or quantitative features on CT or other modalities can be used to characterize the likelihood that a nodule is benign or malignant. Visual features on CT such as size, attenuation, location, morphology, edge characteristics, and other distinctive "signs" can be highly suggestive of a specific diagnosis and, in general, be used to determine the probability that a specific nodule is benign or malignant. Change in size, attenuation, and morphology on serial follow-up CT, or features on other modalities such as nuclear medicine studies or MRI, can also contribute to the characterization of lung nodules. Imaging analytics can objectively and reproducibly quantify nodule features on CT, nuclear medicine, and magnetic resonance imaging. Some quantitative techniques show great promise in helping to differentiate benign from malignant lesions or to stratify the risk of aggressive versus indolent neoplasm. In this article, we (1) summarize the visual characteristics, descriptors, and signs that may be helpful in management of nodules identified on screening CT, (2) discuss current quantitative and multimodality techniques that aid in the differentiation of nodules, and (3) highlight the power, pitfalls, and limitations of these various techniques.

Polymorphous computing fabric

Science.gov (United States)

Wolinski, Christophe Czeslaw [Los Alamos, NM; Gokhale, Maya B [Los Alamos, NM; McCabe, Kevin Peter [Los Alamos, NM

2011-01-18

Fabric-based computing systems and methods are disclosed. A fabric-based computing system can include a polymorphous computing fabric that can be customized on a per application basis and a host processor in communication with said polymorphous computing fabric. The polymorphous computing fabric includes a cellular architecture that can be highly parameterized to enable a customized synthesis of fabric instances for a variety of enhanced application performances thereof. A global memory concept can also be included that provides the host processor random access to all variables and instructions associated with the polymorphous computing fabric.

Riemannian computing in computer vision

CERN Document Server

Srivastava, Anuj

2016-01-01

This book presents a comprehensive treatise on Riemannian geometric computations and related statistical inferences in several computer vision problems. This edited volume includes chapter contributions from leading figures in the field of computer vision who are applying Riemannian geometric approaches in problems such as face recognition, activity recognition, object detection, biomedical image analysis, and structure-from-motion. Some of the mathematical entities that necessitate a geometric analysis include rotation matrices (e.g. in modeling camera motion), stick figures (e.g. for activity recognition), subspace comparisons (e.g. in face recognition), symmetric positive-definite matrices (e.g. in diffusion tensor imaging), and function-spaces (e.g. in studying shapes of closed contours).   ·         Illustrates Riemannian computing theory on applications in computer vision, machine learning, and robotics ·         Emphasis on algorithmic advances that will allow re-application in other...

Multiscale approach including microfibril scale to assess elastic constants of cortical bone based on neural network computation and homogenization method.

Science.gov (United States)

Barkaoui, Abdelwahed; Chamekh, Abdessalem; Merzouki, Tarek; Hambli, Ridha; Mkaddem, Ali

2014-03-01

The complexity and heterogeneity of bone tissue require a multiscale modeling to understand its mechanical behavior and its remodeling mechanisms. In this paper, a novel multiscale hierarchical approach including microfibril scale based on hybrid neural network (NN) computation and homogenization equations was developed to link nanoscopic and macroscopic scales to estimate the elastic properties of human cortical bone. The multiscale model is divided into three main phases: (i) in step 0, the elastic constants of collagen-water and mineral-water composites are calculated by averaging the upper and lower Hill bounds; (ii) in step 1, the elastic properties of the collagen microfibril are computed using a trained NN simulation. Finite element calculation is performed at nanoscopic levels to provide a database to train an in-house NN program; and (iii) in steps 2-10 from fibril to continuum cortical bone tissue, homogenization equations are used to perform the computation at the higher scales. The NN outputs (elastic properties of the microfibril) are used as inputs for the homogenization computation to determine the properties of mineralized collagen fibril. The mechanical and geometrical properties of bone constituents (mineral, collagen, and cross-links) as well as the porosity were taken in consideration. This paper aims to predict analytically the effective elastic constants of cortical bone by modeling its elastic response at these different scales, ranging from the nanostructural to mesostructural levels. Our findings of the lowest scale's output were well integrated with the other higher levels and serve as inputs for the next higher scale modeling. Good agreement was obtained between our predicted results and literature data. Copyright © 2013 John Wiley & Sons, Ltd.

Dicty_cDB: VHP481 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available g significant alignments: (bits) Value AY698035_1( AY698035 |pid:none) Desmognath...us marmoratus isolate 69... 40 0.060 AY612344_1( AY612344 |pid:none) Desmognathus marmoratus voucher KH... 4...0 0.079 DQ018662_1( DQ018662 |pid:none) Plethodon dunni isolate 75356 NADH... 38 0.30 AY612348_1( AY612348 |pid:none) Desmog...nathus quadramaculatus vouch... 36 1.1 AY698038_1( AY698038 |pid:none) Desmog...nathus marmoratus isolate T0... 36 1.1 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus i

Dicty_cDB: VHP154 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available PGYGMVVSKSQYPVAEMVKTLIQK*ki*i*rs*lvqmipsivhqlkiqiqlslvcqllkf gkqnivsl*nvh*qmlvmp...IVGAIVGSSGA ILSYIMCKAMNRNLMSVILGGVGTSSMGKGEAMKITGTHTEINVDQASEMITNSKNILIV PGYGMVVSKSQYPVAEMVKTLIQK*ki*i*rs*lvqmips

Dicty_cDB: VHP304 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgn ilgpvakecsdlwpkvatnag...yrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsa gvgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgn ilgp

Dicty_cDB: VHP706 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...3 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13

Dicty_cDB: VHP888 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ng fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1...( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHP355 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available *kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir* gvcnnspakwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnss...dktsnih**ipqkvlvh*dsrtvamevgir* gvcnnspakwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadl dgsskyskeftlkae

Performing an allreduce operation on a plurality of compute nodes of a parallel computer

Science.gov (United States)

Faraj, Ahmad [Rochester, MN

2012-04-17

Methods, apparatus, and products are disclosed for performing an allreduce operation on a plurality of compute nodes of a parallel computer. Each compute node includes at least two processing cores. Each processing core has contribution data for the allreduce operation. Performing an allreduce operation on a plurality of compute nodes of a parallel computer includes: establishing one or more logical rings among the compute nodes, each logical ring including at least one processing core from each compute node; performing, for each logical ring, a global allreduce operation using the contribution data for the processing cores included in that logical ring, yielding a global allreduce result for each processing core included in that logical ring; and performing, for each compute node, a local allreduce operation using the global allreduce results for each processing core on that compute node.

Theoretical Kinetic Study of the Formic Acid Catalyzed Criegee Intermediate Isomerization: Multistructural Anharmonicity and Atmospheric Implications

KAUST Repository

Monge Palacios, Manuel

2018-01-29

We performed a theoretical study on the double hydrogen shift isomerization reaction of a six carbon atom Criegee intermediate (C6-CI), catalyzed by formic acid (HCOOH), to produce vinylhydroperoxide (VHP), C6-CI+HCOOH→VHP+HCOOH. This Criegee intermediate can serve as a surrogate for larger CIs derived from important volatile organic compounds like monoterpenes, whose reactivity is not well understood and are difficult to handle computationally. The reactant HCOOH exerts a pronounced catalytic effect on the studied reaction by lowering the barrier height, but the kinetic enhancement is hindered by the multistructural anharmonicity. First, the rigid ring-structure adopted by the saddle point to facilitate simultaneous transfer of two atoms does not allow formation of as many conformers as those formed by the reactant C6-CI. And second, the flexible carbon chain of C6-CI facilitates the formation of stabilizing intramolecular C–H···O hydrogen bonds; this stabilizing effect is less pronounced in the saddle point structure due to its tightness and steric effects. Thus, the contribution of the reactant C6-CI conformers to the multistructural partition function is larger than that of the saddle point conformers. The resulting low multistructural anharmonicity factor partially cancels out the catalytic effect of the carboxylic acid, yielding in a moderately large rate coefficient, k(298 K) = 4.9·10-13 cm3 molecule-1 s-1. We show that carboxylic acids may promote the conversion of stabilized Criegee intermediates into vinylhydroperoxides in the atmosphere, which generates OH radicals and leads to secondary organic aerosol, thereby affecting the oxidative capacity of the atmosphere and ultimately the climate.

A survey of computational physics introductory computational science

CERN Document Server

Landau, Rubin H; Bordeianu, Cristian C

2008-01-01

Computational physics is a rapidly growing subfield of computational science, in large part because computers can solve previously intractable problems or simulate natural processes that do not have analytic solutions. The next step beyond Landau's First Course in Scientific Computing and a follow-up to Landau and Páez's Computational Physics, this text presents a broad survey of key topics in computational physics for advanced undergraduates and beginning graduate students, including new discussions of visualization tools, wavelet analysis, molecular dynamics, and computational fluid dynamics

Optical Computing

OpenAIRE

Woods, Damien; Naughton, Thomas J.

2008-01-01

We consider optical computers that encode data using images and compute by transforming such images. We give an overview of a number of such optical computing architectures, including descriptions of the type of hardware commonly used in optical computing, as well as some of the computational efficiencies of optical devices. We go on to discuss optical computing from the point of view of computational complexity theory, with the aim of putting some old, and some very recent, re...

High performance computation of landscape genomic models including local indicators of spatial association.

Science.gov (United States)

Stucki, S; Orozco-terWengel, P; Forester, B R; Duruz, S; Colli, L; Masembe, C; Negrini, R; Landguth, E; Jones, M R; Bruford, M W; Taberlet, P; Joost, S

2017-09-01

With the increasing availability of both molecular and topo-climatic data, the main challenges facing landscape genomics - that is the combination of landscape ecology with population genomics - include processing large numbers of models and distinguishing between selection and demographic processes (e.g. population structure). Several methods address the latter, either by estimating a null model of population history or by simultaneously inferring environmental and demographic effects. Here we present samβada, an approach designed to study signatures of local adaptation, with special emphasis on high performance computing of large-scale genetic and environmental data sets. samβada identifies candidate loci using genotype-environment associations while also incorporating multivariate analyses to assess the effect of many environmental predictor variables. This enables the inclusion of explanatory variables representing population structure into the models to lower the occurrences of spurious genotype-environment associations. In addition, samβada calculates local indicators of spatial association for candidate loci to provide information on whether similar genotypes tend to cluster in space, which constitutes a useful indication of the possible kinship between individuals. To test the usefulness of this approach, we carried out a simulation study and analysed a data set from Ugandan cattle to detect signatures of local adaptation with samβada, bayenv, lfmm and an F ST outlier method (FDIST approach in arlequin) and compare their results. samβada - an open source software for Windows, Linux and Mac OS X available at http://lasig.epfl.ch/sambada - outperforms other approaches and better suits whole-genome sequence data processing. © 2016 The Authors. Molecular Ecology Resources Published by John Wiley & Sons Ltd.

Comparative Evaluation of Quantitative Test Methods for Gases on a Hard Surface

Science.gov (United States)

2017-02-01

5 for QCT and 2 and 4.5 for TSM. The standard deviation (SD; 0.5–2.5 log) was high for the medium- and low-CD treatments. For VHP, a value of >6 LR...REPORT b. ABSTRACT c. THIS PAGE 19b. TELEPHONE NUMBER (include area code) U U U UU 26 (410) 436-7545 Standard Form 298 (Rev. 8-98) Prescribed by...5.0 × 106 and 5.0 × 107 spores/coupon. The coupons were dried in a biosafety cabinet (BSC) in an open petri dish for a minimum of 1 h and then placed

Computer hardware fault administration

Science.gov (United States)

Archer, Charles J.; Megerian, Mark G.; Ratterman, Joseph D.; Smith, Brian E.

2010-09-14

Computer hardware fault administration carried out in a parallel computer, where the parallel computer includes a plurality of compute nodes. The compute nodes are coupled for data communications by at least two independent data communications networks, where each data communications network includes data communications links connected to the compute nodes. Typical embodiments carry out hardware fault administration by identifying a location of a defective link in the first data communications network of the parallel computer and routing communications data around the defective link through the second data communications network of the parallel computer.

Computational Pathology

Science.gov (United States)

Louis, David N.; Feldman, Michael; Carter, Alexis B.; Dighe, Anand S.; Pfeifer, John D.; Bry, Lynn; Almeida, Jonas S.; Saltz, Joel; Braun, Jonathan; Tomaszewski, John E.; Gilbertson, John R.; Sinard, John H.; Gerber, Georg K.; Galli, Stephen J.; Golden, Jeffrey A.; Becich, Michael J.

2016-01-01

Context We define the scope and needs within the new discipline of computational pathology, a discipline critical to the future of both the practice of pathology and, more broadly, medical practice in general. Objective To define the scope and needs of computational pathology. Data Sources A meeting was convened in Boston, Massachusetts, in July 2014 prior to the annual Association of Pathology Chairs meeting, and it was attended by a variety of pathologists, including individuals highly invested in pathology informatics as well as chairs of pathology departments. Conclusions The meeting made recommendations to promote computational pathology, including clearly defining the field and articulating its value propositions; asserting that the value propositions for health care systems must include means to incorporate robust computational approaches to implement data-driven methods that aid in guiding individual and population health care; leveraging computational pathology as a center for data interpretation in modern health care systems; stating that realizing the value proposition will require working with institutional administrations, other departments, and pathology colleagues; declaring that a robust pipeline should be fostered that trains and develops future computational pathologists, for those with both pathology and non-pathology backgrounds; and deciding that computational pathology should serve as a hub for data-related research in health care systems. The dissemination of these recommendations to pathology and bioinformatics departments should help facilitate the development of computational pathology. PMID:26098131

29 CFR 779.253 - What is included in computing the total annual inflow volume.

Science.gov (United States)

2010-07-01

... FAIR LABOR STANDARDS ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May... taxes and other charges which the enterprise must pay for such goods. Generally, all charges will be... computing the total annual inflow volume. The goods which the establishment purchases or receives for resale...

VARIATION IN BIOFUEL POTENTIAL OF TWELVE CALOPYLLUM INOPHYLLUM POPULATIONS IN INDONESIA

Directory of Open Access Journals (Sweden)

Budi Leksono

2016-05-01

Full Text Available The global energy crisis has raises demand for biofuel prices. It has driven the world to enhance environmentally-friendly renewable-energy (biofuel production. Oil from the seeds of Calophyllum inophyllum (nyamplung which can be harvested up to 50 years, is one of  such potential biofuel source. Methods for biofuel production from nyamplung seeds have been developed at an industrial scale by cooperative in Cilacap (Java and Energy Self-Sufficient Villages (Desa Mandiri Energi in Banyuwangi, Purworejo, Kebumen, Ujung Kulon (Java and Selayar (South Sulawesi. However, there is only a limited-information available on biofuel potential, in term of  productivity and quality, from nyamplung populations. This paper reports the variations in biofuel potential among 12 populations in Indonesia (6 from Java, 6 outside Java. The oil was extracted using a combination of  vertical hot press (VHP and screw press expeller (SPE methods, followed by degumming to make refined oil, and esterification-transesterification to turn it into biodiesel. The result show great variation of  biofuel content among the population. Oil production percentage varies from 37-48.5% (VHP and 50-58% (SPE crude oil, 36-48% (VHP and 40-53% (SPE refined oil, and 1733% (SPE for biodiesel. Seed resin content is responsible for most of the variation after degumming. DNA analysis shows genetic variation among populations ranges from intermediate within Java to high ouside Java and is intermediate within populations. Information about biofuel content and potential of  populations and genetic variation between and within population are important factors for establishment of  geneticallyimproved seed-sources for biofuel production from nyamplung.

Effects of visual information regarding allocentric processing in haptic parallelity matching.

Science.gov (United States)

Van Mier, Hanneke I

2013-10-01

Research has revealed that haptic perception of parallelity deviates from physical reality. Large and systematic deviations have been found in haptic parallelity matching most likely due to the influence of the hand-centered egocentric reference frame. Providing information that increases the influence of allocentric processing has been shown to improve performance on haptic matching. In this study allocentric processing was stimulated by providing informative vision in haptic matching tasks that were performed using hand- and arm-centered reference frames. Twenty blindfolded participants (ten men, ten women) explored the orientation of a reference bar with the non-dominant hand and subsequently matched (task HP) or mirrored (task HM) its orientation on a test bar with the dominant hand. Visual information was provided by means of informative vision with participants having full view of the test bar, while the reference bar was blocked from their view (task VHP). To decrease the egocentric bias of the hands, participants also performed a visual haptic parallelity drawing task (task VHPD) using an arm-centered reference frame, by drawing the orientation of the reference bar. In all tasks, the distance between and orientation of the bars were manipulated. A significant effect of task was found; performance improved from task HP, to VHP to VHPD, and HM. Significant effects of distance were found in the first three tasks, whereas orientation and gender effects were only significant in tasks HP and VHP. The results showed that stimulating allocentric processing by means of informative vision and reducing the egocentric bias by using an arm-centered reference frame led to most accurate performance on parallelity matching. © 2013 Elsevier B.V. All rights reserved.

Computational Intelligence, Cyber Security and Computational Models

CERN Document Server

Anitha, R; Lekshmi, R; Kumar, M; Bonato, Anthony; Graña, Manuel

2014-01-01

This book contains cutting-edge research material presented by researchers, engineers, developers, and practitioners from academia and industry at the International Conference on Computational Intelligence, Cyber Security and Computational Models (ICC3) organized by PSG College of Technology, Coimbatore, India during December 19–21, 2013. The materials in the book include theory and applications for design, analysis, and modeling of computational intelligence and security. The book will be useful material for students, researchers, professionals, and academicians. It will help in understanding current research trends and findings and future scope of research in computational intelligence, cyber security, and computational models.

Center for computer security: Computer Security Group conference. Summary

Energy Technology Data Exchange (ETDEWEB)

None

1982-06-01

Topics covered include: computer security management; detection and prevention of computer misuse; certification and accreditation; protection of computer security, perspective from a program office; risk analysis; secure accreditation systems; data base security; implementing R and D; key notarization system; DOD computer security center; the Sandia experience; inspector general's report; and backup and contingency planning. (GHT)

Use of computational fluid dynamics codes for safety analysis of nuclear reactor systems, including containment. Summary report of a technical meeting

International Nuclear Information System (INIS)

2003-11-01

Safety analysis is an important tool for justifying the safety of nuclear power plants. Typically, this type of analysis is performed by means of system computer codes with one dimensional approximation for modelling real plant systems. However, in the nuclear area there are issues for which traditional treatment using one dimensional system codes is considered inadequate for modelling local flow and heat transfer phenomena. There is therefore increasing interest in the application of three dimensional computational fluid dynamics (CFD) codes as a supplement to or in combination with system codes. There are a number of both commercial (general purpose) CFD codes as well as special codes for nuclear safety applications available. With further progress in safety analysis techniques, the increasing use of CFD codes for nuclear applications is expected. At present, the main objective with respect to CFD codes is generally to improve confidence in the available analysis tools and to achieve a more reliable approach to safety relevant issues. An exchange of views and experience can facilitate and speed up progress in the implementation of this objective. Both the International Atomic Energy Agency (IAEA) and the Nuclear Energy Agency of the Organisation for Economic Co-operation and Development (OECD/NEA) believed that it would be advantageous to provide a forum for such an exchange. Therefore, within the framework of the Working Group on the Analysis and Management of Accidents of the NEA's Committee on the Safety of Nuclear Installations, the IAEA and the NEA agreed to jointly organize the Technical Meeting on the Use of Computational Fluid Dynamics Codes for Safety Analysis of Reactor Systems, including Containment. The meeting was held in Pisa, Italy, from 11 to 14 November 2002. The publication constitutes the report of the Technical Meeting. It includes short summaries of the presentations that were made and of the discussions as well as conclusions and

Unconventional Quantum Computing Devices

OpenAIRE

Lloyd, Seth

2000-01-01

This paper investigates a variety of unconventional quantum computation devices, including fermionic quantum computers and computers that exploit nonlinear quantum mechanics. It is shown that unconventional quantum computing devices can in principle compute some quantities more rapidly than `conventional' quantum computers.

Computational vision

CERN Document Server

Wechsler, Harry

1990-01-01

The book is suitable for advanced courses in computer vision and image processing. In addition to providing an overall view of computational vision, it contains extensive material on topics that are not usually covered in computer vision texts (including parallel distributed processing and neural networks) and considers many real applications.

Contribution to the algorithmic and efficient programming of new parallel architectures including accelerators for neutron physics and shielding computations

International Nuclear Information System (INIS)

Dubois, J.

2011-01-01

In science, simulation is a key process for research or validation. Modern computer technology allows faster numerical experiments, which are cheaper than real models. In the field of neutron simulation, the calculation of eigenvalues is one of the key challenges. The complexity of these problems is such that a lot of computing power may be necessary. The work of this thesis is first the evaluation of new computing hardware such as graphics card or massively multi-core chips, and their application to eigenvalue problems for neutron simulation. Then, in order to address the massive parallelism of supercomputers national, we also study the use of asynchronous hybrid methods for solving eigenvalue problems with this very high level of parallelism. Then we experiment the work of this research on several national supercomputers such as the Titane hybrid machine of the Computing Center, Research and Technology (CCRT), the Curie machine of the Very Large Computing Centre (TGCC), currently being installed, and the Hopper machine at the Lawrence Berkeley National Laboratory (LBNL). We also do our experiments on local workstations to illustrate the interest of this research in an everyday use with local computing resources. (author) [fr

Computational Physics Program of the National MFE Computer Center

International Nuclear Information System (INIS)

Mirin, A.A.

1984-12-01

The principal objective of the computational physics group is to develop advanced numerical models for the investigation of plasma phenomena and the simulation of present and future magnetic confinement devices. A summary of the groups activities is presented, including computational studies in MHD equilibria and stability, plasma transport, Fokker-Planck, and efficient numerical and programming algorithms. References are included

A formalization of computational trust

NARCIS (Netherlands)

Güven - Ozcelebi, C.; Holenderski, M.J.; Ozcelebi, T.; Lukkien, J.J.

2018-01-01

Computational trust aims to quantify trust and is studied by many disciplines including computer science, social sciences and business science. We propose a formal computational trust model, including its parameters and operations on these parameters, as well as a step by step guide to compute trust

Computed tomography for radiographers

International Nuclear Information System (INIS)

Brooker, M.

1986-01-01

Computed tomography is regarded by many as a complicated union of sophisticated x-ray equipment and computer technology. This book overcomes these complexities. The rigid technicalities of the machinery and the clinical aspects of computed tomography are discussed including the preparation of patients, both physically and mentally, for scanning. Furthermore, the author also explains how to set up and run a computed tomography department, including advice on how the room should be designed

Green Computing

Directory of Open Access Journals (Sweden)

K. Shalini

2013-01-01

Full Text Available Green computing is all about using computers in a smarter and eco-friendly way. It is the environmentally responsible use of computers and related resources which includes the implementation of energy-efficient central processing units, servers and peripherals as well as reduced resource consumption and proper disposal of electronic waste .Computers certainly make up a large part of many people lives and traditionally are extremely damaging to the environment. Manufacturers of computer and its parts have been espousing the green cause to help protect environment from computers and electronic waste in any way.Research continues into key areas such as making the use of computers as energy-efficient as Possible, and designing algorithms and systems for efficiency-related computer technologies.

Computability theory

CERN Document Server

Weber, Rebecca

2012-01-01

What can we compute--even with unlimited resources? Is everything within reach? Or are computations necessarily drastically limited, not just in practice, but theoretically? These questions are at the heart of computability theory. The goal of this book is to give the reader a firm grounding in the fundamentals of computability theory and an overview of currently active areas of research, such as reverse mathematics and algorithmic randomness. Turing machines and partial recursive functions are explored in detail, and vital tools and concepts including coding, uniformity, and diagonalization are described explicitly. From there the material continues with universal machines, the halting problem, parametrization and the recursion theorem, and thence to computability for sets, enumerability, and Turing reduction and degrees. A few more advanced topics round out the book before the chapter on areas of research. The text is designed to be self-contained, with an entire chapter of preliminary material including re...

In vitro characterization of high purity factor IX concentrates for the treatment of hemophilia B.

Science.gov (United States)

Limentani, S A; Gowell, K P; Deitcher, S R

1995-04-01

This study employed sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis and immunoblotting to assess the purity of seven high purity factor IX concentrates: Aimafix (Aima), AlphaNine-SD (Alpha Therapeutic), Factor IX VHP (Biotransfusion), Immunine (Immuno), Mononine (Armour Pharmaceutical), Nanotiv (Kabi Pharmacia), and 9MC (Blood Products Laboratory). The mean specific activity of these products ranged from 68 U factor IX/mg (Aimafix) to 246 U factor IX/mg (Mononine). SDS-PAGE analysis showed that the highest purity product, Mononine, had a single contaminating band under non-reducing conditions. Two additional bands were detected when this product was analyzed under reducing conditions. All other products had multiple contaminating bands that were more apparent under reducing than non-reducing conditions. The immunoblot for factor IX showed a dominant factor IX band for all products. In addition, visible light chain of factor IX was detected for AlphaNine-SD, Factor IX VHP, Immunine, Mononine, Nanotiv, and 9MC, suggesting that the factor IX in these products had undergone partial activation to factor IXa. Another contaminating band was visible at 49,500 for all of the products except 9MC. In addition to this band, high molecular weight contaminants were apparent for some products, most notably AlphaNine-SD. The identity of these bands is unknown. Immunoblotting failed to demonstrate factor VII as a contaminant of any of the high purity products, although factor VIIa could be detected in some lots of Immunine, Nanotiv, and 9MC by a clot-based assay. Factor X contaminated Aimafix, AlphaNine-SD, Factor IX VHP, Immunine, Nanotiv, and 9MC, but activation products of factor X were not detected.(ABSTRACT TRUNCATED AT 250 WORDS)

Neoclassical transport including collisional nonlinearity.

Science.gov (United States)

Candy, J; Belli, E A

2011-06-10

In the standard δf theory of neoclassical transport, the zeroth-order (Maxwellian) solution is obtained analytically via the solution of a nonlinear equation. The first-order correction δf is subsequently computed as the solution of a linear, inhomogeneous equation that includes the linearized Fokker-Planck collision operator. This equation admits analytic solutions only in extreme asymptotic limits (banana, plateau, Pfirsch-Schlüter), and so must be solved numerically for realistic plasma parameters. Recently, numerical codes have appeared which attempt to compute the total distribution f more accurately than in the standard ordering by retaining some nonlinear terms related to finite-orbit width, while simultaneously reusing some form of the linearized collision operator. In this work we show that higher-order corrections to the distribution function may be unphysical if collisional nonlinearities are ignored.

A Compute Environment of ABC95 Array Computer Based on Multi-FPGA Chip

Institute of Scientific and Technical Information of China (English)

无

2000-01-01

ABC95 array computer is a multi-function network's computer based on FPGA technology, The multi-function network supports processors conflict-free access data from memory and supports processors access data from processors based on enhanced MESH network.ABC95 instruction's system includes control instructions, scalar instructions, vectors instructions.Mostly net-work instructions are introduced.A programming environment of ABC95 array computer assemble language is designed.A programming environment of ABC95 array computer for VC++ is advanced.It includes load function of ABC95 array computer program and data, store function, run function and so on.Specially, The data type of ABC95 array computer conflict-free access is defined.The results show that these technologies can develop programmer of ABC95 array computer effectively.

Computer sciences

Science.gov (United States)

Smith, Paul H.

1988-01-01

The Computer Science Program provides advanced concepts, techniques, system architectures, algorithms, and software for both space and aeronautics information sciences and computer systems. The overall goal is to provide the technical foundation within NASA for the advancement of computing technology in aerospace applications. The research program is improving the state of knowledge of fundamental aerospace computing principles and advancing computing technology in space applications such as software engineering and information extraction from data collected by scientific instruments in space. The program includes the development of special algorithms and techniques to exploit the computing power provided by high performance parallel processors and special purpose architectures. Research is being conducted in the fundamentals of data base logic and improvement techniques for producing reliable computing systems.

Computer Education and Computer Use by Preschool Educators

Science.gov (United States)

Towns, Bernadette

2010-01-01

Researchers have found that teachers seldom use computers in the preschool classroom. However, little research has examined why preschool teachers elect not to use computers. This case study focused on identifying whether community colleges that prepare teachers for early childhood education include in their curriculum how teachers can effectively…

Analog and hybrid computing

CERN Document Server

Hyndman, D E

2013-01-01

Analog and Hybrid Computing focuses on the operations of analog and hybrid computers. The book first outlines the history of computing devices that influenced the creation of analog and digital computers. The types of problems to be solved on computers, computing systems, and digital computers are discussed. The text looks at the theory and operation of electronic analog computers, including linear and non-linear computing units and use of analog computers as operational amplifiers. The monograph examines the preparation of problems to be deciphered on computers. Flow diagrams, methods of ampl

Program MASTERCALC: an interactive computer program for radioanalytical computations. Description and operating instructions

International Nuclear Information System (INIS)

Goode, W.

1980-10-01

MASTERCALC is a computer program written to support radioanalytical computations in the Los Alamos Scientific Laboratory (LASL) Environmental Surveillance Group. Included in the program are routines for gross alpha and beta, 3 H, gross gamma, 90 Sr and alpha spectroscopic determinations. A description of MASTERCALC is presented and its source listing is included. Operating instructions and example computing sessions are given for each type of analysis

COMPUTATIONAL SCIENCE CENTER

Energy Technology Data Exchange (ETDEWEB)

DAVENPORT,J.

2004-11-01

The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security.

Recent trends in grid computing

International Nuclear Information System (INIS)

Miura, Kenichi

2004-01-01

Grid computing is a technology which allows uniform and transparent access to geographically dispersed computational resources, such as computers, databases, experimental and observational equipment etc. via high-speed, high-bandwidth networking. The commonly used analogy is that of electrical power grid, whereby the household electricity is made available from outlets on the wall, and little thought need to be given to where the electricity is generated and how it is transmitted. The usage of grid also includes distributed parallel computing, high through-put computing, data intensive computing (data grid) and collaborative computing. This paper reviews the historical background, software structure, current status and on-going grid projects, including applications of grid technology to nuclear fusion research. (author)

Computers and data processing

CERN Document Server

Deitel, Harvey M

1985-01-01

Computers and Data Processing provides information pertinent to the advances in the computer field. This book covers a variety of topics, including the computer hardware, computer programs or software, and computer applications systems.Organized into five parts encompassing 19 chapters, this book begins with an overview of some of the fundamental computing concepts. This text then explores the evolution of modern computing systems from the earliest mechanical calculating devices to microchips. Other chapters consider how computers present their results and explain the storage and retrieval of

McMaster University: College and University Computing Environment.

Science.gov (United States)

CAUSE/EFFECT, 1988

1988-01-01

The computing and information services (CIS) organization includes administrative computing, academic computing, and networking and has three divisions: computing services, development services, and information services. Other computing activities include Health Sciences, Humanities Computing Center, and Department of Computer Science and Systems.…

Development of a High Resolution 3D Infant Stomach Model for Surgical Planning

Science.gov (United States)

Chaudry, Qaiser; Raza, S. Hussain; Lee, Jeonggyu; Xu, Yan; Wulkan, Mark; Wang, May D.

Medical surgical procedures have not changed much during the past century due to the lack of accurate low-cost workbench for testing any new improvement. The increasingly cheaper and powerful computer technologies have made computer-based surgery planning and training feasible. In our work, we have developed an accurate 3D stomach model, which aims to improve the surgical procedure that treats the infant pediatric and neonatal gastro-esophageal reflux disease (GERD). We generate the 3-D infant stomach model based on in vivo computer tomography (CT) scans of an infant. CT is a widely used clinical imaging modality that is cheap, but with low spatial resolution. To improve the model accuracy, we use the high resolution Visible Human Project (VHP) in model building. Next, we add soft muscle material properties to make the 3D model deformable. Then we use virtual reality techniques such as haptic devices to make the 3D stomach model deform upon touching force. This accurate 3D stomach model provides a workbench for testing new GERD treatment surgical procedures. It has the potential to reduce or eliminate the extensive cost associated with animal testing when improving any surgical procedure, and ultimately, to reduce the risk associated with infant GERD surgery.

Organic Computing

CERN Document Server

Würtz, Rolf P

2008-01-01

Organic Computing is a research field emerging around the conviction that problems of organization in complex systems in computer science, telecommunications, neurobiology, molecular biology, ethology, and possibly even sociology can be tackled scientifically in a unified way. From the computer science point of view, the apparent ease in which living systems solve computationally difficult problems makes it inevitable to adopt strategies observed in nature for creating information processing machinery. In this book, the major ideas behind Organic Computing are delineated, together with a sparse sample of computational projects undertaken in this new field. Biological metaphors include evolution, neural networks, gene-regulatory networks, networks of brain modules, hormone system, insect swarms, and ant colonies. Applications are as diverse as system design, optimization, artificial growth, task allocation, clustering, routing, face recognition, and sign language understanding.

Chronology and References of Volcanic Eruptions and Selected Unrest in the United States, 1980-2008

Science.gov (United States)

Diefenbach, Angela K.; Guffanti, Marianne; Ewert, John W.

2009-01-01

The United States ranks as one of the top countries in the world in the number of young, active volcanoes within its borders. The United States, including the Commonwealth of the Northern Mariana Islands, is home to approximately 170 geologically active (age activity, unrest, that do not culminate in eruptions. Monitoring volcanic activity in the United States is the responsibility of the U.S. Geological Survey (USGS) Volcano Hazards Program (VHP) and is accomplished with academic, Federal, and State partners. The VHP supports five Volcano Observatories - the Alaska Volcano Observatory (AVO), Cascades Volcano Observatory (CVO), Yellowstone Volcano Observatory (YVO), Long Valley Observatory (LVO), and Hawaiian Volcano Observatory (HVO). With the exception of HVO, which was established in 1912, the U.S. Volcano Observatories have been established in the past 27 years in response to specific volcanic eruptions or sustained levels of unrest. As understanding of volcanic activity and hazards has grown over the years, so have the extent and types of monitoring networks and techniques available to detect early signs of anomalous volcanic behavior. This increased capability is providing us with a more accurate gauge of volcanic activity in the United States. The purpose of this report is to (1) document the range of volcanic activity that U.S. Volcano Observatories have dealt with, beginning with the 1980 eruption of Mount St. Helens, (2) describe some overall characteristics of the activity, and (3) serve as a quick reference to pertinent published literature on the eruptions and unrest documented in this report.

Natural Computing in Computational Finance Volume 4

CERN Document Server

O’Neill, Michael; Maringer, Dietmar

2012-01-01

This book follows on from Natural Computing in Computational Finance  Volumes I, II and III.   As in the previous volumes of this series, the  book consists of a series of  chapters each of  which was selected following a rigorous, peer-reviewed, selection process.  The chapters illustrate the application of a range of cutting-edge natural  computing and agent-based methodologies in computational finance and economics.  The applications explored include  option model calibration, financial trend reversal detection, enhanced indexation, algorithmic trading,  corporate payout determination and agent-based modeling of liquidity costs, and trade strategy adaptation.  While describing cutting edge applications, the chapters are  written so that they are accessible to a wide audience. Hence, they should be of interest  to academics, students and practitioners in the fields of computational finance and  economics.  

12 CFR 1102.27 - Computing time.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Computing time. 1102.27 Section 1102.27 Banks... for Proceedings § 1102.27 Computing time. (a) General rule. In computing any period of time prescribed... time begins to run is not included. The last day so computed is included, unless it is a Saturday...

12 CFR 622.21 - Computing time.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Computing time. 622.21 Section 622.21 Banks and... Formal Hearings § 622.21 Computing time. (a) General rule. In computing any period of time prescribed or... run is not to be included. The last day so computed shall be included, unless it is a Saturday, Sunday...

COMPUTATIONAL SCIENCE CENTER

Energy Technology Data Exchange (ETDEWEB)

DAVENPORT, J.

2005-11-01

The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include, for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security. To achieve our goals we have established a close alliance with applied mathematicians and computer scientists at Stony Brook and Columbia Universities.

78 FR 34669 - Certain Electronic Devices, Including Wireless Communication Devices, Portable Music and Data...

Science.gov (United States)

2013-06-10

..., Including Wireless Communication Devices, Portable Music and Data Processing Devices, and Tablet Computers... importing wireless communication devices, portable music and data processing devices, and tablet computers... certain electronic devices, including wireless communication devices, portable music and data processing...

Early Childhood Teacher Candidates\\' Attitudes towards Computer and Computer Assisted Instruction

OpenAIRE

Oğuz, Evrim; Ellez, A. Murat; Akamca, Güzin Özyılmaz; Kesercioğlu, Teoman İ.; Girgin, Günseli

2011-01-01

The aim of this research is to evaluate preschool candidates’ attitudes towards computers andattitudes towards use of computer assisted instruction. The sample of this study includes 481 early childhoodeducation students who attended Dokuz Eylül University’s department of Early Childhood Education. Data werecollected by using “Scale of Computer Assisted Instruction Attitudes” developed by the Arslan (2006),“Computer Attitudes Scale” developed by Çelik & Bindak (2005) and “General Info...

Areal rainfall estimation using moving cars - computer experiments including hydrological modeling

Science.gov (United States)

Rabiei, Ehsan; Haberlandt, Uwe; Sester, Monika; Fitzner, Daniel; Wallner, Markus

2016-09-01

The need for high temporal and spatial resolution precipitation data for hydrological analyses has been discussed in several studies. Although rain gauges provide valuable information, a very dense rain gauge network is costly. As a result, several new ideas have emerged to help estimating areal rainfall with higher temporal and spatial resolution. Rabiei et al. (2013) observed that moving cars, called RainCars (RCs), can potentially be a new source of data for measuring rain rate. The optical sensors used in that study are designed for operating the windscreen wipers and showed promising results for rainfall measurement purposes. Their measurement accuracy has been quantified in laboratory experiments. Considering explicitly those errors, the main objective of this study is to investigate the benefit of using RCs for estimating areal rainfall. For that, computer experiments are carried out, where radar rainfall is considered as the reference and the other sources of data, i.e., RCs and rain gauges, are extracted from radar data. Comparing the quality of areal rainfall estimation by RCs with rain gauges and reference data helps to investigate the benefit of the RCs. The value of this additional source of data is not only assessed for areal rainfall estimation performance but also for use in hydrological modeling. Considering measurement errors derived from laboratory experiments, the result shows that the RCs provide useful additional information for areal rainfall estimation as well as for hydrological modeling. Moreover, by testing larger uncertainties for RCs, they observed to be useful up to a certain level for areal rainfall estimation and discharge simulation.

A Computer Security Course in the Undergraduate Computer Science Curriculum.

Science.gov (United States)

Spillman, Richard

1992-01-01

Discusses the importance of computer security and considers criminal, national security, and personal privacy threats posed by security breakdown. Several examples are given, including incidents involving computer viruses. Objectives, content, instructional strategies, resources, and a sample examination for an experimental undergraduate computer…

Algorithmically specialized parallel computers

CERN Document Server

Snyder, Lawrence; Gannon, Dennis B

1985-01-01

Algorithmically Specialized Parallel Computers focuses on the concept and characteristics of an algorithmically specialized computer.This book discusses the algorithmically specialized computers, algorithmic specialization using VLSI, and innovative architectures. The architectures and algorithms for digital signal, speech, and image processing and specialized architectures for numerical computations are also elaborated. Other topics include the model for analyzing generalized inter-processor, pipelined architecture for search tree maintenance, and specialized computer organization for raster

Seventh Medical Image Computing and Computer Assisted Intervention Conference (MICCAI 2012)

CERN Document Server

Miller, Karol; Nielsen, Poul; Computational Biomechanics for Medicine : Models, Algorithms and Implementation

2013-01-01

One of the greatest challenges for mechanical engineers is to extend the success of computational mechanics to fields outside traditional engineering, in particular to biology, biomedical sciences, and medicine. This book is an opportunity for computational biomechanics specialists to present and exchange opinions on the opportunities of applying their techniques to computer-integrated medicine. Computational Biomechanics for Medicine: Models, Algorithms and Implementation collects the papers from the Seventh Computational Biomechanics for Medicine Workshop held in Nice in conjunction with the Medical Image Computing and Computer Assisted Intervention conference. The topics covered include: medical image analysis, image-guided surgery, surgical simulation, surgical intervention planning, disease prognosis and diagnostics, injury mechanism analysis, implant and prostheses design, and medical robotics.

Intelligent distributed computing

CERN Document Server

Thampi, Sabu

2015-01-01

This book contains a selection of refereed and revised papers of the Intelligent Distributed Computing Track originally presented at the third International Symposium on Intelligent Informatics (ISI-2014), September 24-27, 2014, Delhi, India.  The papers selected for this Track cover several Distributed Computing and related topics including Peer-to-Peer Networks, Cloud Computing, Mobile Clouds, Wireless Sensor Networks, and their applications.

LTRACK: Beam-transport calculation including wakefield effects

International Nuclear Information System (INIS)

Chan, K.C.D.; Cooper, R.K.

1988-01-01

LTRACK is a first-order beam-transport code that includes wakefield effects up to quadrupole modes. This paper will introduce the readers to this computer code by describing the history, the method of calculations, and a brief summary of the input/output information. Future plans for the code will also be described

Why Don't All Professors Use Computers?

Science.gov (United States)

Drew, David Eli

1989-01-01

Discusses the adoption of computer technology at universities and examines reasons why some professors don't use computers. Topics discussed include computer applications, including artificial intelligence, social science research, statistical analysis, and cooperative research; appropriateness of the technology for the task; the Computer Aptitude…

Approximation and Computation

CERN Document Server

Gautschi, Walter; Rassias, Themistocles M

2011-01-01

Approximation theory and numerical analysis are central to the creation of accurate computer simulations and mathematical models. Research in these areas can influence the computational techniques used in a variety of mathematical and computational sciences. This collection of contributed chapters, dedicated to renowned mathematician Gradimir V. Milovanovia, represent the recent work of experts in the fields of approximation theory and numerical analysis. These invited contributions describe new trends in these important areas of research including theoretic developments, new computational alg

Personal Computers.

Science.gov (United States)

Toong, Hoo-min D.; Gupta, Amar

1982-01-01

Describes the hardware, software, applications, and current proliferation of personal computers (microcomputers). Includes discussions of microprocessors, memory, output (including printers), application programs, the microcomputer industry, and major microcomputer manufacturers (Apple, Radio Shack, Commodore, and IBM). (JN)

Controlling data transfers from an origin compute node to a target compute node

Science.gov (United States)

Archer, Charles J [Rochester, MN; Blocksome, Michael A [Rochester, MN; Ratterman, Joseph D [Rochester, MN; Smith, Brian E [Rochester, MN

2011-06-21

Methods, apparatus, and products are disclosed for controlling data transfers from an origin compute node to a target compute node that include: receiving, by an application messaging module on the target compute node, an indication of a data transfer from an origin compute node to the target compute node; and administering, by the application messaging module on the target compute node, the data transfer using one or more messaging primitives of a system messaging module in dependence upon the indication.

75 FR 4583 - In the Matter of: Certain Electronic Devices, Including Mobile Phones, Portable Music Players...

Science.gov (United States)

2010-01-28

..., Including Mobile Phones, Portable Music Players, and Computers; Notice of Investigation AGENCY: U.S... music players, and computers, by reason of infringement of certain claims of U.S. Patent Nos. 6,714,091... importation of certain electronic devices, including mobile phones, portable music players, or computers that...

Quantum wavepacket ab initio molecular dynamics: an approach for computing dynamically averaged vibrational spectra including critical nuclear quantum effects.

Science.gov (United States)

Sumner, Isaiah; Iyengar, Srinivasan S

2007-10-18

We have introduced a computational methodology to study vibrational spectroscopy in clusters inclusive of critical nuclear quantum effects. This approach is based on the recently developed quantum wavepacket ab initio molecular dynamics method that combines quantum wavepacket dynamics with ab initio molecular dynamics. The computational efficiency of the dynamical procedure is drastically improved (by several orders of magnitude) through the utilization of wavelet-based techniques combined with the previously introduced time-dependent deterministic sampling procedure measure to achieve stable, picosecond length, quantum-classical dynamics of electrons and nuclei in clusters. The dynamical information is employed to construct a novel cumulative flux/velocity correlation function, where the wavepacket flux from the quantized particle is combined with classical nuclear velocities to obtain the vibrational density of states. The approach is demonstrated by computing the vibrational density of states of [Cl-H-Cl]-, inclusive of critical quantum nuclear effects, and our results are in good agreement with experiment. A general hierarchical procedure is also provided, based on electronic structure harmonic frequencies, classical ab initio molecular dynamics, computation of nuclear quantum-mechanical eigenstates, and employing quantum wavepacket ab initio dynamics to understand vibrational spectroscopy in hydrogen-bonded clusters that display large degrees of anharmonicities.

Internode data communications in a parallel computer

Science.gov (United States)

Archer, Charles J.; Blocksome, Michael A.; Miller, Douglas R.; Parker, Jeffrey J.; Ratterman, Joseph D.; Smith, Brian E.

2013-09-03

Internode data communications in a parallel computer that includes compute nodes that each include main memory and a messaging unit, the messaging unit including computer memory and coupling compute nodes for data communications, in which, for each compute node at compute node boot time: a messaging unit allocates, in the messaging unit's computer memory, a predefined number of message buffers, each message buffer associated with a process to be initialized on the compute node; receives, prior to initialization of a particular process on the compute node, a data communications message intended for the particular process; and stores the data communications message in the message buffer associated with the particular process. Upon initialization of the particular process, the process establishes a messaging buffer in main memory of the compute node and copies the data communications message from the message buffer of the messaging unit into the message buffer of main memory.

Pacing a data transfer operation between compute nodes on a parallel computer

Science.gov (United States)

Blocksome, Michael A [Rochester, MN

2011-09-13

Methods, systems, and products are disclosed for pacing a data transfer between compute nodes on a parallel computer that include: transferring, by an origin compute node, a chunk of an application message to a target compute node; sending, by the origin compute node, a pacing request to a target direct memory access (`DMA`) engine on the target compute node using a remote get DMA operation; determining, by the origin compute node, whether a pacing response to the pacing request has been received from the target DMA engine; and transferring, by the origin compute node, a next chunk of the application message if the pacing response to the pacing request has been received from the target DMA engine.

Computers in Nuclear Physics Division

International Nuclear Information System (INIS)

Kowalczyk, M.; Tarasiuk, J.; Srebrny, J.

1997-01-01

Improving of the computer equipment in Nuclear Physics Division is described. It include: new computer equipment and hardware upgrading, software developing, new programs for computer booting and modernization of data acquisition systems

International Conference on Computer, Communication and Computational Sciences

CERN Document Server

Mishra, Krishn; Tiwari, Shailesh; Singh, Vivek

2017-01-01

Exchange of information and innovative ideas are necessary to accelerate the development of technology. With advent of technology, intelligent and soft computing techniques came into existence with a wide scope of implementation in engineering sciences. Keeping this ideology in preference, this book includes the insights that reflect the ‘Advances in Computer and Computational Sciences’ from upcoming researchers and leading academicians across the globe. It contains high-quality peer-reviewed papers of ‘International Conference on Computer, Communication and Computational Sciences (ICCCCS 2016), held during 12-13 August, 2016 in Ajmer, India. These papers are arranged in the form of chapters. The content of the book is divided into two volumes that cover variety of topics such as intelligent hardware and software design, advanced communications, power and energy optimization, intelligent techniques used in internet of things, intelligent image processing, advanced software engineering, evolutionary and ...

From Computational Thinking to Computational Empowerment: A 21st Century PD Agenda

DEFF Research Database (Denmark)

Iversen, Ole Sejer; Smith, Rachel Charlotte; Dindler, Christian

2018-01-01

We propose computational empowerment as an approach, and a Participatory Design response, to challenges related to digitalization of society and the emerging need for digital literacy in K12 education. Our approach extends the current focus on computational thinking to include contextual, human-c...... technology in education. We argue that PD has the potential to drive a computational empowerment agenda in education, by connecting political PD with contemporary visions for addressing a future digitalized labor market and society.......We propose computational empowerment as an approach, and a Participatory Design response, to challenges related to digitalization of society and the emerging need for digital literacy in K12 education. Our approach extends the current focus on computational thinking to include contextual, human......-centred and societal challenges and impacts involved in students’ creative and critical engagement with digital technology. Our research is based on the FabLab@School project, in which a PD approach to computational empowerment provided opportunities as well as further challenges for the complex agenda of digital...

ORCODE.77: a computer routine to control a nuclear physics experiment by a PDP-15 + CAMAC system, written in assembler language and including many new routines of general interest

International Nuclear Information System (INIS)

Dickens, J.K.; McConnell, J.W.

1977-01-01

ORCODE.77 is a versatile data-handling computer routine written in MACRO (assembler) language for a PDP-15 computer with EAE (extended arithmetic capability) connected to a CAMAC interface. The Interrupt feature of the computer is utilized. Although the code is oriented for a specific experimental problem, there are many routines of general interest, including a CAMAC Scaler handler, an executive routine to interpret and act upon three-character teletype commands, concise routines to type out double-precision integers (both octal and decimal) and floating-point numbers and to read in integers and floating-point numbers, a routine to convert to and from PDP-15 FORTRAN-IV floating-point format, a routine to handle clock interrupts, and our own DECTAPE handling routine. Routines having specific applications which are applicable to other very similar applications include a display routine using CAMAC instructions, control of external mechanical equipment using CAMAC instructions, storage of data from an Analog-to-digital Converter, analysis of stored data into time-dependent pulse-height spectra, and a routine to read the contents of a Nuclear Data 5050 Analyzer and to prepare DECTAPE output of these data for subsequent analysis by a code written in PDP-15-compiled FORTRAN-IV

Computer interfacing

CERN Document Server

Dixey, Graham

1994-01-01

This book explains how computers interact with the world around them and therefore how to make them a useful tool. Topics covered include descriptions of all the components that make up a computer, principles of data exchange, interaction with peripherals, serial communication, input devices, recording methods, computer-controlled motors, and printers.In an informative and straightforward manner, Graham Dixey describes how to turn what might seem an incomprehensible 'black box' PC into a powerful and enjoyable tool that can help you in all areas of your work and leisure. With plenty of handy

Optical computing.

Science.gov (United States)

Stroke, G. W.

1972-01-01

Applications of the optical computer include an approach for increasing the sharpness of images obtained from the most powerful electron microscopes and fingerprint/credit card identification. The information-handling capability of the various optical computing processes is very great. Modern synthetic-aperture radars scan upward of 100,000 resolvable elements per second. Fields which have assumed major importance on the basis of optical computing principles are optical image deblurring, coherent side-looking synthetic-aperture radar, and correlative pattern recognition. Some examples of the most dramatic image deblurring results are shown.

Identifying logical planes formed of compute nodes of a subcommunicator in a parallel computer

Science.gov (United States)

Davis, Kristan D.; Faraj, Daniel A.

2016-03-01

In a parallel computer, a plurality of logical planes formed of compute nodes of a subcommunicator may be identified by: for each compute node of the subcommunicator and for a number of dimensions beginning with a first dimension: establishing, by a plane building node, in a positive direction of the first dimension, all logical planes that include the plane building node and compute nodes of the subcommunicator in a positive direction of a second dimension, where the second dimension is orthogonal to the first dimension; and establishing, by the plane building node, in a negative direction of the first dimension, all logical planes that include the plane building node and compute nodes of the subcommunicator in the positive direction of the second dimension.

Computer Science Research at Langley

Science.gov (United States)

Voigt, S. J. (Editor)

1982-01-01

A workshop was held at Langley Research Center, November 2-5, 1981, to highlight ongoing computer science research at Langley and to identify additional areas of research based upon the computer user requirements. A panel discussion was held in each of nine application areas, and these are summarized in the proceedings. Slides presented by the invited speakers are also included. A survey of scientific, business, data reduction, and microprocessor computer users helped identify areas of focus for the workshop. Several areas of computer science which are of most concern to the Langley computer users were identified during the workshop discussions. These include graphics, distributed processing, programmer support systems and tools, database management, and numerical methods.

Resource allocation in grid computing

NARCIS (Netherlands)

Koole, Ger; Righter, Rhonda

2007-01-01

Grid computing, in which a network of computers is integrated to create a very fast virtual computer, is becoming ever more prevalent. Examples include the TeraGrid and Planet-lab.org, as well as applications on the existing Internet that take advantage of unused computing and storage capacity of

8th International Workshop on Natural Computing

CERN Document Server

Hagiya, Masami

2016-01-01

This book highlights recent advances in natural computing, including biology and its theory, bio-inspired computing, computational aesthetics, computational models and theories, computing with natural media, philosophy of natural computing, and educational technology. It presents extended versions of the best papers selected from the “8th International Workshop on Natural Computing” (IWNC8), a symposium held in Hiroshima, Japan, in 2014. The target audience is not limited to researchers working in natural computing but also includes those active in biological engineering, fine/media art design, aesthetics, and philosophy.

Research on cloud computing solutions

OpenAIRE

Liudvikas Kaklauskas; Vaida Zdanytė

2015-01-01

Cloud computing can be defined as a new style of computing in which dynamically scala-ble and often virtualized resources are provided as a services over the Internet. Advantages of the cloud computing technology include cost savings, high availability, and easy scalability. Voas and Zhang adapted six phases of computing paradigms, from dummy termi-nals/mainframes, to PCs, networking computing, to grid and cloud computing. There are four types of cloud computing: public cloud, private cloud, ...

Computer control applied to accelerators

CERN Document Server

Crowley-Milling, Michael C

1974-01-01

The differences that exist between control systems for accelerators and other types of control systems are outlined. It is further indicated that earlier accelerators had manual control systems to which computers were added, but that it is essential for the new, large accelerators to include computers in the control systems right from the beginning. Details of the computer control designed for the Super Proton Synchrotron are presented. The method of choosing the computers is described, as well as the reasons for CERN having to design the message transfer system. The items discussed include: CAMAC interface systems, a new multiplex system, operator-to-computer interaction (such as touch screen, computer-controlled knob, and non- linear track-ball), and high-level control languages. Brief mention is made of the contributions of other high-energy research laboratories as well as of some other computer control applications at CERN. (0 refs).

COMPUTER GAMES AND EDUCATION

OpenAIRE

Sukhov, Anton

2018-01-01

This paper devoted to the research of educational resources and possibilities of modern computer games. The “internal” educational aspects of computer games include educational mechanism (a separate or integrated “tutorial”) and representation of a real or even fantastic educational process within virtual worlds. The “external” dimension represents educational opportunities of computer games for personal and professional development in different genres of computer games (various transport, so...

HCI in Mobile and Ubiquitous Computing

OpenAIRE

椎尾, 一郎; 安村, 通晃; 福本, 雅明; 伊賀, 聡一郎; 増井, 俊之

2003-01-01

This paper provides some perspectives to human computer interaction in mobile and ubiquitous computing. The review covers overview of ubiquitous computing, mobile computing and wearable computing. It also summarizes HCI topics on these field, including real-world oriented interface, multi-modal interface, context awareness and in-visible computers. Finally we discuss killer applications for coming ubiquitous computing era.

Distributed computing system with dual independent communications paths between computers and employing split tokens

Science.gov (United States)

Rasmussen, Robert D. (Inventor); Manning, Robert M. (Inventor); Lewis, Blair F. (Inventor); Bolotin, Gary S. (Inventor); Ward, Richard S. (Inventor)

1990-01-01

This is a distributed computing system providing flexible fault tolerance; ease of software design and concurrency specification; and dynamic balance of the loads. The system comprises a plurality of computers each having a first input/output interface and a second input/output interface for interfacing to communications networks each second input/output interface including a bypass for bypassing the associated computer. A global communications network interconnects the first input/output interfaces for providing each computer the ability to broadcast messages simultaneously to the remainder of the computers. A meshwork communications network interconnects the second input/output interfaces providing each computer with the ability to establish a communications link with another of the computers bypassing the remainder of computers. Each computer is controlled by a resident copy of a common operating system. Communications between respective ones of computers is by means of split tokens each having a moving first portion which is sent from computer to computer and a resident second portion which is disposed in the memory of at least one of computer and wherein the location of the second portion is part of the first portion. The split tokens represent both functions to be executed by the computers and data to be employed in the execution of the functions. The first input/output interfaces each include logic for detecting a collision between messages and for terminating the broadcasting of a message whereby collisions between messages are detected and avoided.

AV Programs for Computer Know-How.

Science.gov (United States)

Mandell, Phyllis Levy

1985-01-01

Lists 44 audiovisual programs (most released between 1983 and 1984) grouped in seven categories: computers in society, introduction to computers, computer operations, languages and programing, computer graphics, robotics, computer careers. Excerpts from "School Library Journal" reviews, price, and intended grade level are included. Names…

Discrete computational structures

CERN Document Server

Korfhage, Robert R

1974-01-01

Discrete Computational Structures describes discrete mathematical concepts that are important to computing, covering necessary mathematical fundamentals, computer representation of sets, graph theory, storage minimization, and bandwidth. The book also explains conceptual framework (Gorn trees, searching, subroutines) and directed graphs (flowcharts, critical paths, information network). The text discusses algebra particularly as it applies to concentrates on semigroups, groups, lattices, propositional calculus, including a new tabular method of Boolean function minimization. The text emphasize

Computing meaning v.4

CERN Document Server

Bunt, Harry; Pulman, Stephen

2013-01-01

This book is a collection of papers by leading researchers in computational semantics. It presents a state-of-the-art overview of recent and current research in computational semantics, including descriptions of new methods for constructing and improving resources for semantic computation, such as WordNet, VerbNet, and semantically annotated corpora. It also presents new statistical methods in semantic computation, such as the application of distributional semantics in the compositional calculation of sentence meanings. Computing the meaning of sentences, texts, and spoken or texted dialogue i

COMPUTING

CERN Multimedia

P. McBride

The Computing Project is preparing for a busy year where the primary emphasis of the project moves towards steady operations. Following the very successful completion of Computing Software and Analysis challenge, CSA06, last fall, we have reorganized and established four groups in computing area: Commissioning, User Support, Facility/Infrastructure Operations and Data Operations. These groups work closely together with groups from the Offline Project in planning for data processing and operations. Monte Carlo production has continued since CSA06, with about 30M events produced each month to be used for HLT studies and physics validation. Monte Carlo production will continue throughout the year in the preparation of large samples for physics and detector studies ramping to 50 M events/month for CSA07. Commissioning of the full CMS computing system is a major goal for 2007. Site monitoring is an important commissioning component and work is ongoing to devise CMS specific tests to be included in Service Availa...

East-West paths to unconventional computing.

Science.gov (United States)

Adamatzky, Andrew; Akl, Selim; Burgin, Mark; Calude, Cristian S; Costa, José Félix; Dehshibi, Mohammad Mahdi; Gunji, Yukio-Pegio; Konkoli, Zoran; MacLennan, Bruce; Marchal, Bruno; Margenstern, Maurice; Martínez, Genaro J; Mayne, Richard; Morita, Kenichi; Schumann, Andrew; Sergeyev, Yaroslav D; Sirakoulis, Georgios Ch; Stepney, Susan; Svozil, Karl; Zenil, Hector

2017-12-01

Unconventional computing is about breaking boundaries in thinking, acting and computing. Typical topics of this non-typical field include, but are not limited to physics of computation, non-classical logics, new complexity measures, novel hardware, mechanical, chemical and quantum computing. Unconventional computing encourages a new style of thinking while practical applications are obtained from uncovering and exploiting principles and mechanisms of information processing in and functional properties of, physical, chemical and living systems; in particular, efficient algorithms are developed, (almost) optimal architectures are designed and working prototypes of future computing devices are manufactured. This article includes idiosyncratic accounts of 'unconventional computing' scientists reflecting on their personal experiences, what attracted them to the field, their inspirations and discoveries. Copyright © 2017 Elsevier Ltd. All rights reserved.

Knowledge-based computer security advisor

International Nuclear Information System (INIS)

Hunteman, W.J.; Squire, M.B.

1991-01-01

The rapid expansion of computer security information and technology has included little support to help the security officer identify the safeguards needed to comply with a policy and to secure a computing system. This paper reports that Los Alamos is developing a knowledge-based computer security system to provide expert knowledge to the security officer. This system includes a model for expressing the complex requirements in computer security policy statements. The model is part of an expert system that allows a security officer to describe a computer system and then determine compliance with the policy. The model contains a generic representation that contains network relationships among the policy concepts to support inferencing based on information represented in the generic policy description

The NASA computer science research program plan

Science.gov (United States)

1983-01-01

A taxonomy of computer science is included, one state of the art of each of the major computer science categories is summarized. A functional breakdown of NASA programs under Aeronautics R and D, space R and T, and institutional support is also included. These areas were assessed against the computer science categories. Concurrent processing, highly reliable computing, and information management are identified.

Occupational stress in human computer interaction.

Science.gov (United States)

Smith, M J; Conway, F T; Karsh, B T

1999-04-01

There have been a variety of research approaches that have examined the stress issues related to human computer interaction including laboratory studies, cross-sectional surveys, longitudinal case studies and intervention studies. A critical review of these studies indicates that there are important physiological, biochemical, somatic and psychological indicators of stress that are related to work activities where human computer interaction occurs. Many of the stressors of human computer interaction at work are similar to those stressors that have historically been observed in other automated jobs. These include high workload, high work pressure, diminished job control, inadequate employee training to use new technology, monotonous tasks, por supervisory relations, and fear for job security. New stressors have emerged that can be tied primarily to human computer interaction. These include technology breakdowns, technology slowdowns, and electronic performance monitoring. The effects of the stress of human computer interaction in the workplace are increased physiological arousal; somatic complaints, especially of the musculoskeletal system; mood disturbances, particularly anxiety, fear and anger; and diminished quality of working life, such as reduced job satisfaction. Interventions to reduce the stress of computer technology have included improved technology implementation approaches and increased employee participation in implementation. Recommendations for ways to reduce the stress of human computer interaction at work are presented. These include proper ergonomic conditions, increased organizational support, improved job content, proper workload to decrease work pressure, and enhanced opportunities for social support. A model approach to the design of human computer interaction at work that focuses on the system "balance" is proposed.

Computers and Information Flow.

Science.gov (United States)

Patrick, R. L.

This paper is designed to fill the need for an easily understood introduction to the computing and data processing field for the layman who has, or can expect to have, some contact with it. Information provided includes the unique terminology and jargon of the field, the various types of computers and the scope of computational capabilities, and…

Administrative Computing in Continuing Education.

Science.gov (United States)

Broxton, Harry

1982-01-01

Describes computer applications in the Division of Continuing Education at Brigham Young University. These include instructional applications (computer assisted instruction, computer science education, and student problem solving) and administrative applications (registration, payment records, grades, reports, test scoring, mailing, and others).…

Computational colour science using MATLAB

CERN Document Server

Westland, Stephen; Cheung, Vien

2012-01-01

Computational Colour Science Using MATLAB 2nd Edition offers a practical, problem-based approach to colour physics. The book focuses on the key issues encountered in modern colour engineering, including efficient representation of colour information, Fourier analysis of reflectance spectra and advanced colorimetric computation. Emphasis is placed on the practical applications rather than the techniques themselves, with material structured around key topics. These topics include colour calibration of visual displays, computer recipe prediction and models for colour-appearance prediction. Each t

Modern computer hardware and the role of central computing facilities in particle physics

International Nuclear Information System (INIS)

Zacharov, V.

1981-01-01

Important recent changes in the hardware technology of computer system components are reviewed, and the impact of these changes assessed on the present and future pattern of computing in particle physics. The place of central computing facilities is particularly examined, to answer the important question as to what, if anything, should be their future role. Parallelism in computing system components is considered to be an important property that can be exploited with advantage. The paper includes a short discussion of the position of communications and network technology in modern computer systems. (orig.)

Effects of Computer Course on Computer Self-Efficacy, Computer Attitudes and Achievements of Young Individuals in Siirt, Turkey

Science.gov (United States)

Çelik, Halil Coskun

2015-01-01

The purpose of this study is to investigate the effects of computer courses on young individuals' computer self-efficacy, attitudes and achievement. The study group of this research included 60 unemployed young individuals (18-25 ages) in total; 30 in the experimental group and 30 in the control group. An experimental research model with pretest…

A new computing principle

International Nuclear Information System (INIS)

Fatmi, H.A.; Resconi, G.

1988-01-01

In 1954 while reviewing the theory of communication and cybernetics the late Professor Dennis Gabor presented a new mathematical principle for the design of advanced computers. During our work on these computers it was found that the Gabor formulation can be further advanced to include more recent developments in Lie algebras and geometric probability, giving rise to a new computing principle

Computer Assisted Language Learning. Routledge Studies in Computer Assisted Language Learning

Science.gov (United States)

Pennington, Martha

2011-01-01

Computer-assisted language learning (CALL) is an approach to language teaching and learning in which computer technology is used as an aid to the presentation, reinforcement and assessment of material to be learned, usually including a substantial interactive element. This books provides an up-to date and comprehensive overview of…

Desktop grid computing

CERN Document Server

Cerin, Christophe

2012-01-01

Desktop Grid Computing presents common techniques used in numerous models, algorithms, and tools developed during the last decade to implement desktop grid computing. These techniques enable the solution of many important sub-problems for middleware design, including scheduling, data management, security, load balancing, result certification, and fault tolerance. The book's first part covers the initial ideas and basic concepts of desktop grid computing. The second part explores challenging current and future problems. Each chapter presents the sub-problems, discusses theoretical and practical

Computational movement analysis

CERN Document Server

Laube, Patrick

2014-01-01

This SpringerBrief discusses the characteristics of spatiotemporal movement data, including uncertainty and scale. It investigates three core aspects of Computational Movement Analysis: Conceptual modeling of movement and movement spaces, spatiotemporal analysis methods aiming at a better understanding of movement processes (with a focus on data mining for movement patterns), and using decentralized spatial computing methods in movement analysis. The author presents Computational Movement Analysis as an interdisciplinary umbrella for analyzing movement processes with methods from a range of fi

Computational neurogenetic modeling

CERN Document Server

Benuskova, Lubica

2010-01-01

Computational Neurogenetic Modeling is a student text, introducing the scope and problems of a new scientific discipline - Computational Neurogenetic Modeling (CNGM). CNGM is concerned with the study and development of dynamic neuronal models for modeling brain functions with respect to genes and dynamic interactions between genes. These include neural network models and their integration with gene network models. This new area brings together knowledge from various scientific disciplines, such as computer and information science, neuroscience and cognitive science, genetics and molecular biol

Community Cloud Computing

Science.gov (United States)

Marinos, Alexandros; Briscoe, Gerard

Cloud Computing is rising fast, with its data centres growing at an unprecedented rate. However, this has come with concerns over privacy, efficiency at the expense of resilience, and environmental sustainability, because of the dependence on Cloud vendors such as Google, Amazon and Microsoft. Our response is an alternative model for the Cloud conceptualisation, providing a paradigm for Clouds in the community, utilising networked personal computers for liberation from the centralised vendor model. Community Cloud Computing (C3) offers an alternative architecture, created by combing the Cloud with paradigms from Grid Computing, principles from Digital Ecosystems, and sustainability from Green Computing, while remaining true to the original vision of the Internet. It is more technically challenging than Cloud Computing, having to deal with distributed computing issues, including heterogeneous nodes, varying quality of service, and additional security constraints. However, these are not insurmountable challenges, and with the need to retain control over our digital lives and the potential environmental consequences, it is a challenge we must pursue.

Volunteered Cloud Computing for Disaster Management

Science.gov (United States)

Evans, J. D.; Hao, W.; Chettri, S. R.

2014-12-01

Disaster management relies increasingly on interpreting earth observations and running numerical models; which require significant computing capacity - usually on short notice and at irregular intervals. Peak computing demand during event detection, hazard assessment, or incident response may exceed agency budgets; however some of it can be met through volunteered computing, which distributes subtasks to participating computers via the Internet. This approach has enabled large projects in mathematics, basic science, and climate research to harness the slack computing capacity of thousands of desktop computers. This capacity is likely to diminish as desktops give way to battery-powered mobile devices (laptops, smartphones, tablets) in the consumer market; but as cloud computing becomes commonplace, it may offer significant slack capacity -- if its users are given an easy, trustworthy mechanism for participating. Such a "volunteered cloud computing" mechanism would also offer several advantages over traditional volunteered computing: tasks distributed within a cloud have fewer bandwidth limitations; granular billing mechanisms allow small slices of "interstitial" computing at no marginal cost; and virtual storage volumes allow in-depth, reversible machine reconfiguration. Volunteered cloud computing is especially suitable for "embarrassingly parallel" tasks, including ones requiring large data volumes: examples in disaster management include near-real-time image interpretation, pattern / trend detection, or large model ensembles. In the context of a major disaster, we estimate that cloud users (if suitably informed) might volunteer hundreds to thousands of CPU cores across a large provider such as Amazon Web Services. To explore this potential, we are building a volunteered cloud computing platform and targeting it to a disaster management context. Using a lightweight, fault-tolerant network protocol, this platform helps cloud users join parallel computing projects

Introduction to computer networking

CERN Document Server

Robertazzi, Thomas G

2017-01-01

This book gives a broad look at both fundamental networking technology and new areas that support it and use it. It is a concise introduction to the most prominent, recent technological topics in computer networking. Topics include network technology such as wired and wireless networks, enabling technologies such as data centers, software defined networking, cloud and grid computing and applications such as networks on chips, space networking and network security. The accessible writing style and non-mathematical treatment makes this a useful book for the student, network and communications engineer, computer scientist and IT professional. • Features a concise, accessible treatment of computer networking, focusing on new technological topics; • Provides non-mathematical introduction to networks in their most common forms today;< • Includes new developments in switching, optical networks, WiFi, Bluetooth, LTE, 5G, and quantum cryptography.

Scalable optical quantum computer

International Nuclear Information System (INIS)

Manykin, E A; Mel'nichenko, E V

2014-01-01

A way of designing a scalable optical quantum computer based on the photon echo effect is proposed. Individual rare earth ions Pr 3+ , regularly located in the lattice of the orthosilicate (Y 2 SiO 5 ) crystal, are suggested to be used as optical qubits. Operations with qubits are performed using coherent and incoherent laser pulses. The operation protocol includes both the method of measurement-based quantum computations and the technique of optical computations. Modern hybrid photon echo protocols, which provide a sufficient quantum efficiency when reading recorded states, are considered as most promising for quantum computations and communications. (quantum computer)

Alloy 690 in PWR type reactors; Aleaciones base niquel en condiciones de primario de los reactores tipo PWR

Energy Technology Data Exchange (ETDEWEB)

Gomez Briceno, D.; Serrano, M.

2005-07-01

Alloy 690, used as replacement of Alloy 600 for vessel head penetration (VHP) nozzles in PWR, coexists in the primary loop with other components of Alloy 600. Alloy 690 shows an excellent resistance to primary water stress corrosion cracking, while Alloy 600 is very susceptible to this degradation mechanisms. This article analyse comparatively the PWSCC behaviour of both Ni-based alloys and associated weld metals 52/152 and 82/182. (Author)

Computer loss experience and predictions

Science.gov (United States)

Parker, Donn B.

1996-03-01

The types of losses organizations must anticipate have become more difficult to predict because of the eclectic nature of computers and the data communications and the decrease in news media reporting of computer-related losses as they become commonplace. Total business crime is conjectured to be decreasing in frequency and increasing in loss per case as a result of increasing computer use. Computer crimes are probably increasing, however, as their share of the decreasing business crime rate grows. Ultimately all business crime will involve computers in some way, and we could see a decline of both together. The important information security measures in high-loss business crime generally concern controls over authorized people engaged in unauthorized activities. Such controls include authentication of users, analysis of detailed audit records, unannounced audits, segregation of development and production systems and duties, shielding the viewing of screens, and security awareness and motivation controls in high-value transaction areas. Computer crimes that involve highly publicized intriguing computer misuse methods, such as privacy violations, radio frequency emanations eavesdropping, and computer viruses, have been reported in waves that periodically have saturated the news media during the past 20 years. We must be able to anticipate such highly publicized crimes and reduce the impact and embarrassment they cause. On the basis of our most recent experience, I propose nine new types of computer crime to be aware of: computer larceny (theft and burglary of small computers), automated hacking (use of computer programs to intrude), electronic data interchange fraud (business transaction fraud), Trojan bomb extortion and sabotage (code security inserted into others' systems that can be triggered to cause damage), LANarchy (unknown equipment in use), desktop forgery (computerized forgery and counterfeiting of documents), information anarchy (indiscriminate use of

Broadcasting a message in a parallel computer

Science.gov (United States)

Berg, Jeremy E [Rochester, MN; Faraj, Ahmad A [Rochester, MN

2011-08-02

Methods, systems, and products are disclosed for broadcasting a message in a parallel computer. The parallel computer includes a plurality of compute nodes connected together using a data communications network. The data communications network optimized for point to point data communications and is characterized by at least two dimensions. The compute nodes are organized into at least one operational group of compute nodes for collective parallel operations of the parallel computer. One compute node of the operational group assigned to be a logical root. Broadcasting a message in a parallel computer includes: establishing a Hamiltonian path along all of the compute nodes in at least one plane of the data communications network and in the operational group; and broadcasting, by the logical root to the remaining compute nodes, the logical root's message along the established Hamiltonian path.

Demonstration of blind quantum computing.

Science.gov (United States)

Barz, Stefanie; Kashefi, Elham; Broadbent, Anne; Fitzsimons, Joseph F; Zeilinger, Anton; Walther, Philip

2012-01-20

Quantum computers, besides offering substantial computational speedups, are also expected to preserve the privacy of a computation. We present an experimental demonstration of blind quantum computing in which the input, computation, and output all remain unknown to the computer. We exploit the conceptual framework of measurement-based quantum computation that enables a client to delegate a computation to a quantum server. Various blind delegated computations, including one- and two-qubit gates and the Deutsch and Grover quantum algorithms, are demonstrated. The client only needs to be able to prepare and transmit individual photonic qubits. Our demonstration is crucial for unconditionally secure quantum cloud computing and might become a key ingredient for real-life applications, especially when considering the challenges of making powerful quantum computers widely available.

Computational Science at the Argonne Leadership Computing Facility

Science.gov (United States)

Romero, Nichols

2014-03-01

The goal of the Argonne Leadership Computing Facility (ALCF) is to extend the frontiers of science by solving problems that require innovative approaches and the largest-scale computing systems. ALCF's most powerful computer - Mira, an IBM Blue Gene/Q system - has nearly one million cores. How does one program such systems? What software tools are available? Which scientific and engineering applications are able to utilize such levels of parallelism? This talk will address these questions and describe a sampling of projects that are using ALCF systems in their research, including ones in nanoscience, materials science, and chemistry. Finally, the ways to gain access to ALCF resources will be presented. This research used resources of the Argonne Leadership Computing Facility at Argonne National Laboratory, which is supported by the Office of Science of the U.S. Department of Energy under contract DE-AC02-06CH11357.

New computing systems, future computing environment, and their implications on structural analysis and design

Science.gov (United States)

Noor, Ahmed K.; Housner, Jerrold M.

1993-01-01

Recent advances in computer technology that are likely to impact structural analysis and design of flight vehicles are reviewed. A brief summary is given of the advances in microelectronics, networking technologies, and in the user-interface hardware and software. The major features of new and projected computing systems, including high performance computers, parallel processing machines, and small systems, are described. Advances in programming environments, numerical algorithms, and computational strategies for new computing systems are reviewed. The impact of the advances in computer technology on structural analysis and the design of flight vehicles is described. A scenario for future computing paradigms is presented, and the near-term needs in the computational structures area are outlined.

Computer Security: Introduction to information and computer security (1/4)

CERN Multimedia

CERN. Geneva

2012-01-01

Sebastian Lopienski is CERN's Deputy Computer Security Officer. He works on security strategy and policies; offers internal consultancy and audit services; develops and maintains security tools for vulnerability assessment and intrusion detection; provides training and awareness raising; and does incident investigation and response. During his work at CERN since 2001, Sebastian has had various assignments, including designing and developing software to manage and support services hosted in the CERN Computer Centre; providing Central CVS Service for software projects at CERN; and development of applications for accelerator controls in Java. He graduated from the University of Warsaw (MSc in Computer Science) in 2002, and earned an MBA degree at the Enterprise Administration Institute in Aix-en-Provence and Haute Ecole de Gestion in Geneva in 2010. His professional interests include software and network security, distributed systems, and Web and mobile technologies. With the prevalence of modern information te...

Olfactory neuroblastoma: the long-term outcome and late toxicity of multimodal therapy including radiotherapy based on treatment planning using computed tomography

International Nuclear Information System (INIS)

Mori, Takashi; Onimaru, Rikiya; Onodera, Shunsuke; Tsuchiya, Kazuhiko; Yasuda, Koichi; Hatakeyama, Hiromitsu; Kobayashi, Hiroyuki; Terasaka, Shunsuke; Homma, Akihiro; Shirato, Hiroki

2015-01-01

Olfactory neuroblastoma (ONB) is a rare tumor originating from olfactory epithelium. Here we retrospectively analyzed the long-term treatment outcomes and toxicity of radiotherapy for ONB patients for whom computed tomography (CT) and three-dimensional treatment planning was conducted to reappraise the role of radiotherapy in the light of recent advanced technology and chemotherapy. Seventeen patients with ONB treated between July 1992 and June 2013 were included. Three patients were Kadish stage B and 14 were stage C. All patients were treated with radiotherapy with or without surgery or chemotherapy. The radiation dose was distributed from 50 Gy to 66 Gy except for one patient who received 40 Gy preoperatively. The median follow-up time was 95 months (range 8–173 months). The 5-year overall survival (OS) and relapse-free survival (RFS) rates were estimated at 88% and 74%, respectively. Five patients with stage C disease had recurrence with the median time to recurrence of 59 months (range 7–115 months). Late adverse events equal to or above Grade 2 in CTCAE v4.03 were observed in three patients. Multimodal therapy including radiotherapy with precise treatment planning based on CT simulation achieved an excellent local control rate with acceptable toxicity and reasonable overall survival for patients with ONB

BCS Glossary of Computing and ICT

CERN Document Server

Panel, BCS Education and Training Expert; Burkhardt, Diana; Cumming, Aline; Hunter, Alan; Hurvid, Frank; Jaworski, John; Ng, Thomas; Scheer, Marianne; Southall, John; Vella, Alfred

2008-01-01

A glossary of computing designed to support those taking computer courses or courses where computers are used, including GCSE, A-Level, ECDL and 14-19 Diplomas in Functional Skills, in schools and Further Education colleges. It helps the reader build up knowledge and understanding of computing.

Designing the next generation (fifth generation computers)

International Nuclear Information System (INIS)

Wallich, P.

1983-01-01

A description is given of the designs necessary to develop fifth generation computers. An analysis is offered of problems and developments in parallelism, VLSI, artificial intelligence, knowledge engineering and natural language processing. Software developments are outlined including logic programming, object-oriented programming and exploratory programming. Computer architecture is detailed including concurrent computer architecture

Software Engineering for Scientific Computer Simulations

Science.gov (United States)

Post, Douglass E.; Henderson, Dale B.; Kendall, Richard P.; Whitney, Earl M.

2004-11-01

Computer simulation is becoming a very powerful tool for analyzing and predicting the performance of fusion experiments. Simulation efforts are evolving from including only a few effects to many effects, from small teams with a few people to large teams, and from workstations and small processor count parallel computers to massively parallel platforms. Successfully making this transition requires attention to software engineering issues. We report on the conclusions drawn from a number of case studies of large scale scientific computing projects within DOE, academia and the DoD. The major lessons learned include attention to sound project management including setting reasonable and achievable requirements, building a good code team, enforcing customer focus, carrying out verification and validation and selecting the optimum computational mathematics approaches.

The Need for Computer Science

Science.gov (United States)

Margolis, Jane; Goode, Joanna; Bernier, David

2011-01-01

Broadening computer science learning to include more students is a crucial item on the United States' education agenda, these authors say. Although policymakers advocate more computer science expertise, computer science offerings in high schools are few--and actually shrinking. In addition, poorly resourced schools with a high percentage of…

Cloud computing basics for librarians.

Science.gov (United States)

Hoy, Matthew B

2012-01-01

"Cloud computing" is the name for the recent trend of moving software and computing resources to an online, shared-service model. This article briefly defines cloud computing, discusses different models, explores the advantages and disadvantages, and describes some of the ways cloud computing can be used in libraries. Examples of cloud services are included at the end of the article. Copyright © Taylor & Francis Group, LLC

Computing with impure numbers - Automatic consistency checking and units conversion using computer algebra

Science.gov (United States)

Stoutemyer, D. R.

1977-01-01

The computer algebra language MACSYMA enables the programmer to include symbolic physical units in computer calculations, and features automatic detection of dimensionally-inhomogeneous formulas and conversion of inconsistent units in a dimensionally homogeneous formula. Some examples illustrate these features.

Applications of Computer Algebra Conference

CERN Document Server

Martínez-Moro, Edgar

2017-01-01

The Applications of Computer Algebra (ACA) conference covers a wide range of topics from Coding Theory to Differential Algebra to Quantam Computing, focusing on the interactions of these and other areas with the discipline of Computer Algebra. This volume provides the latest developments in the field as well as its applications in various domains, including communications, modelling, and theoretical physics. The book will appeal to researchers and professors of computer algebra, applied mathematics, and computer science, as well as to engineers and computer scientists engaged in research and development.

Failure detection in high-performance clusters and computers using chaotic map computations

Science.gov (United States)

Rao, Nageswara S.

2015-09-01

A programmable media includes a processing unit capable of independent operation in a machine that is capable of executing 10.sup.18 floating point operations per second. The processing unit is in communication with a memory element and an interconnect that couples computing nodes. The programmable media includes a logical unit configured to execute arithmetic functions, comparative functions, and/or logical functions. The processing unit is configured to detect computing component failures, memory element failures and/or interconnect failures by executing programming threads that generate one or more chaotic map trajectories. The central processing unit or graphical processing unit is configured to detect a computing component failure, memory element failure and/or an interconnect failure through an automated comparison of signal trajectories generated by the chaotic maps.

Link failure detection in a parallel computer

Science.gov (United States)

Archer, Charles J.; Blocksome, Michael A.; Megerian, Mark G.; Smith, Brian E.

2010-11-09

Methods, apparatus, and products are disclosed for link failure detection in a parallel computer including compute nodes connected in a rectangular mesh network, each pair of adjacent compute nodes in the rectangular mesh network connected together using a pair of links, that includes: assigning each compute node to either a first group or a second group such that adjacent compute nodes in the rectangular mesh network are assigned to different groups; sending, by each of the compute nodes assigned to the first group, a first test message to each adjacent compute node assigned to the second group; determining, by each of the compute nodes assigned to the second group, whether the first test message was received from each adjacent compute node assigned to the first group; and notifying a user, by each of the compute nodes assigned to the second group, whether the first test message was received.

Experimental demonstration of deterministic one-way quantum computing on a NMR quantum computer

OpenAIRE

Ju, Chenyong; Zhu, Jing; Peng, Xinhua; Chong, Bo; Zhou, Xianyi; Du, Jiangfeng

2008-01-01

One-way quantum computing is an important and novel approach to quantum computation. By exploiting the existing particle-particle interactions, we report the first experimental realization of the complete process of deterministic one-way quantum Deutsch-Josza algorithm in NMR, including graph state preparation, single-qubit measurements and feed-forward corrections. The findings in our experiment may shed light on the future scalable one-way quantum computation.

The principles of computer hardware

CERN Document Server

Clements, Alan

2000-01-01

Principles of Computer Hardware, now in its third edition, provides a first course in computer architecture or computer organization for undergraduates. The book covers the core topics of such a course, including Boolean algebra and logic design; number bases and binary arithmetic; the CPU; assembly language; memory systems; and input/output methods and devices. It then goes on to cover the related topics of computer peripherals such as printers; the hardware aspects of the operating system; and data communications, and hence provides a broader overview of the subject. Its readable, tutorial-based approach makes it an accessible introduction to the subject. The book has extensive in-depth coverage of two microprocessors, one of which (the 68000) is widely used in education. All chapters in the new edition have been updated. Major updates include: powerful software simulations of digital systems to accompany the chapters on digital design; a tutorial-based introduction to assembly language, including many exam...

Scalable optical quantum computer

Energy Technology Data Exchange (ETDEWEB)

Manykin, E A; Mel' nichenko, E V [Institute for Superconductivity and Solid-State Physics, Russian Research Centre ' Kurchatov Institute' , Moscow (Russian Federation)

2014-12-31

A way of designing a scalable optical quantum computer based on the photon echo effect is proposed. Individual rare earth ions Pr{sup 3+}, regularly located in the lattice of the orthosilicate (Y{sub 2}SiO{sub 5}) crystal, are suggested to be used as optical qubits. Operations with qubits are performed using coherent and incoherent laser pulses. The operation protocol includes both the method of measurement-based quantum computations and the technique of optical computations. Modern hybrid photon echo protocols, which provide a sufficient quantum efficiency when reading recorded states, are considered as most promising for quantum computations and communications. (quantum computer)

COMPUTING: International symposium

International Nuclear Information System (INIS)

Anon.

1984-01-01

Recent Developments in Computing, Processor, and Software Research for High Energy Physics, a four-day international symposium, was held in Guanajuato, Mexico, from 8-11 May, with 112 attendees from nine countries. The symposium was the third in a series of meetings exploring activities in leading-edge computing technology in both processor and software research and their effects on high energy physics. Topics covered included fixed-target on- and off-line reconstruction processors; lattice gauge and general theoretical processors and computing; multiprocessor projects; electron-positron collider on- and offline reconstruction processors; state-of-the-art in university computer science and industry; software research; accelerator processors; and proton-antiproton collider on and off-line reconstruction processors

Computer Games and Art

Directory of Open Access Journals (Sweden)

Anton Sukhov

2015-10-01

Full Text Available This article devoted to the search of relevant sources (primary and secondary and characteristics of computer games that allow to include them in the field of art (such as the creation of artistic games, computer graphics, active interaction with other forms of art, signs of spiritual aesthetic act, own temporality of computer games, “aesthetic illusion”, interactivity. In general, modern computer games can be attributed to commercial art and popular culture (blockbuster games and to elite forms of contemporary media art (author’s games, visionary games.

76 FR 24051 - In the Matter of Certain Electronic Devices, Including Mobile Phones, Mobile Tablets, Portable...

Science.gov (United States)

2011-04-29

..., Including Mobile Phones, Mobile Tablets, Portable Music Players, and Computers, and Components Thereof... certain electronic devices, including mobile phones, mobile tablets, portable music players, and computers...''). The complaint further alleges that an industry in the United States exists or is in the process of...

Computer Virus Bibliography, 1988-1989.

Science.gov (United States)

Bologna, Jack, Comp.

This bibliography lists 14 books, 154 journal articles, 34 newspaper articles, and 3 research papers published during 1988-1989 on the subject of computer viruses, software protection and 'cures', virus hackers, and other related issues. Some of the sources listed include Computers and Security, Computer Security Digest, PC Week, Time, the New…

Essential Means for Urban Computing : Specification of Web-Based Computing Platforms for Urban Planning, a Hitchhiker’s Guide

NARCIS (Netherlands)

Nourian, P.; Martinez-Ortiz, Carlos; Arroyo Ohori, G.A.K.

2018-01-01

This article provides an overview of the specifications of web-based computing platforms for urban data analytics and computational urban planning practice. There are currently a variety of tools and platforms that can be used in urban computing practices, including scientific computing languages,

Computers as components principles of embedded computing system design

CERN Document Server

Wolf, Marilyn

2012-01-01

Computers as Components: Principles of Embedded Computing System Design, 3e, presents essential knowledge on embedded systems technology and techniques. Updated for today's embedded systems design methods, this edition features new examples including digital signal processing, multimedia, and cyber-physical systems. Author Marilyn Wolf covers the latest processors from Texas Instruments, ARM, and Microchip Technology plus software, operating systems, networks, consumer devices, and more. Like the previous editions, this textbook: Uses real processors to demonstrate both technology and tec

The role of dedicated data computing centers in the age of cloud computing

Science.gov (United States)

Caramarcu, Costin; Hollowell, Christopher; Strecker-Kellogg, William; Wong, Antonio; Zaytsev, Alexandr

2017-10-01

Brookhaven National Laboratory (BNL) anticipates significant growth in scientific programs with large computing and data storage needs in the near future and has recently reorganized support for scientific computing to meet these needs. A key component is the enhanced role of the RHIC-ATLAS Computing Facility (RACF) in support of high-throughput and high-performance computing (HTC and HPC) at BNL. This presentation discusses the evolving role of the RACF at BNL, in light of its growing portfolio of responsibilities and its increasing integration with cloud (academic and for-profit) computing activities. We also discuss BNL’s plan to build a new computing center to support the new responsibilities of the RACF and present a summary of the cost benefit analysis done, including the types of computing activities that benefit most from a local data center vs. cloud computing. This analysis is partly based on an updated cost comparison of Amazon EC2 computing services and the RACF, which was originally conducted in 2012.

77 FR 70464 - Certain Electronic Devices, Including Wireless Communication Devices, Portable Music and Data...

Science.gov (United States)

2012-11-26

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-794] Certain Electronic Devices, Including Wireless Communication Devices, Portable Music and Data Processing Devices, and Tablet Computers... wireless communication devices, portable music and data processing devices, and tablet computers, by reason...

Locating hardware faults in a parallel computer

Science.gov (United States)

Archer, Charles J.; Megerian, Mark G.; Ratterman, Joseph D.; Smith, Brian E.

2010-04-13

Locating hardware faults in a parallel computer, including defining within a tree network of the parallel computer two or more sets of non-overlapping test levels of compute nodes of the network that together include all the data communications links of the network, each non-overlapping test level comprising two or more adjacent tiers of the tree; defining test cells within each non-overlapping test level, each test cell comprising a subtree of the tree including a subtree root compute node and all descendant compute nodes of the subtree root compute node within a non-overlapping test level; performing, separately on each set of non-overlapping test levels, an uplink test on all test cells in a set of non-overlapping test levels; and performing, separately from the uplink tests and separately on each set of non-overlapping test levels, a downlink test on all test cells in a set of non-overlapping test levels.

Bibliography. Computer-Oriented Projects, 1987.

Science.gov (United States)

Smith, Richard L., Comp.

1988-01-01

Provides an annotated list of references on computer-oriented projects. Includes information on computers; hands-on versus simulations; games; instruction; students' attitudes and learning styles; artificial intelligence; tutoring; and application of spreadsheets. (RT)

Broadcasting collective operation contributions throughout a parallel computer

Science.gov (United States)

Faraj, Ahmad [Rochester, MN

2012-02-21

Methods, systems, and products are disclosed for broadcasting collective operation contributions throughout a parallel computer. The parallel computer includes a plurality of compute nodes connected together through a data communications network. Each compute node has a plurality of processors for use in collective parallel operations on the parallel computer. Broadcasting collective operation contributions throughout a parallel computer according to embodiments of the present invention includes: transmitting, by each processor on each compute node, that processor's collective operation contribution to the other processors on that compute node using intra-node communications; and transmitting on a designated network link, by each processor on each compute node according to a serial processor transmission sequence, that processor's collective operation contribution to the other processors on the other compute nodes using inter-node communications.

Power throttling of collections of computing elements

Science.gov (United States)

Bellofatto, Ralph E [Ridgefield, CT; Coteus, Paul W [Yorktown Heights, NY; Crumley, Paul G [Yorktown Heights, NY; Gara, Alan G [Mount Kidsco, NY; Giampapa, Mark E [Irvington, NY; Gooding,; Thomas, M [Rochester, MN; Haring, Rudolf A [Cortlandt Manor, NY; Megerian, Mark G [Rochester, MN; Ohmacht, Martin [Yorktown Heights, NY; Reed, Don D [Mantorville, MN; Swetz, Richard A [Mahopac, NY; Takken, Todd [Brewster, NY

2011-08-16

An apparatus and method for controlling power usage in a computer includes a plurality of computers communicating with a local control device, and a power source supplying power to the local control device and the computer. A plurality of sensors communicate with the computer for ascertaining power usage of the computer, and a system control device communicates with the computer for controlling power usage of the computer.

COMPUTATIONAL THINKING

Directory of Open Access Journals (Sweden)

Evgeniy K. Khenner

2016-01-01

Full Text Available Abstract. The aim of the research is to draw attention of the educational community to the phenomenon of computational thinking which actively discussed in the last decade in the foreign scientific and educational literature, to substantiate of its importance, practical utility and the right on affirmation in Russian education.Methods. The research is based on the analysis of foreign studies of the phenomenon of computational thinking and the ways of its formation in the process of education; on comparing the notion of «computational thinking» with related concepts used in the Russian scientific and pedagogical literature.Results. The concept «computational thinking» is analyzed from the point of view of intuitive understanding and scientific and applied aspects. It is shown as computational thinking has evolved in the process of development of computers hardware and software. The practice-oriented interpretation of computational thinking which dominant among educators is described along with some ways of its formation. It is shown that computational thinking is a metasubject result of general education as well as its tool. From the point of view of the author, purposeful development of computational thinking should be one of the tasks of the Russian education.Scientific novelty. The author gives a theoretical justification of the role of computational thinking schemes as metasubject results of learning. The dynamics of the development of this concept is described. This process is connected with the evolution of computer and information technologies as well as increase of number of the tasks for effective solutions of which computational thinking is required. Author substantiated the affirmation that including «computational thinking » in the set of pedagogical concepts which are used in the national education system fills an existing gap.Practical significance. New metasubject result of education associated with

77 FR 60720 - Certain Electronic Devices, Including Wireless Commmunication Devices, Portable Music and Data...

Science.gov (United States)

2012-10-04

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-794] Certain Electronic Devices, Including Wireless Commmunication Devices, Portable Music and Data Processing Devices, and Tablet Computers... communication devices, portable music and data processing devices, and tablet computers, imported by Apple Inc...

Computer games and prosocial behaviour.

Science.gov (United States)

Mengel, Friederike

2014-01-01

We relate different self-reported measures of computer use to individuals' propensity to cooperate in the Prisoner's dilemma. The average cooperation rate is positively related to the self-reported amount participants spend playing computer games. None of the other computer time use variables (including time spent on social media, browsing internet, working etc.) are significantly related to cooperation rates.

Computational System For Rapid CFD Analysis In Engineering

Science.gov (United States)

Barson, Steven L.; Ascoli, Edward P.; Decroix, Michelle E.; Sindir, Munir M.

1995-01-01

Computational system comprising modular hardware and software sub-systems developed to accelerate and facilitate use of techniques of computational fluid dynamics (CFD) in engineering environment. Addresses integration of all aspects of CFD analysis process, including definition of hardware surfaces, generation of computational grids, CFD flow solution, and postprocessing. Incorporates interfaces for integration of all hardware and software tools needed to perform complete CFD analysis. Includes tools for efficient definition of flow geometry, generation of computational grids, computation of flows on grids, and postprocessing of flow data. System accepts geometric input from any of three basic sources: computer-aided design (CAD), computer-aided engineering (CAE), or definition by user.

Computer Architecture A Quantitative Approach

CERN Document Server

Hennessy, John L

2011-01-01

The computing world today is in the middle of a revolution: mobile clients and cloud computing have emerged as the dominant paradigms driving programming and hardware innovation today. The Fifth Edition of Computer Architecture focuses on this dramatic shift, exploring the ways in which software and technology in the cloud are accessed by cell phones, tablets, laptops, and other mobile computing devices. Each chapter includes two real-world examples, one mobile and one datacenter, to illustrate this revolutionary change.Updated to cover the mobile computing revolutionEmphasizes the two most im

Computational aspects of algebraic curves

CERN Document Server

Shaska, Tanush

2005-01-01

The development of new computational techniques and better computing power has made it possible to attack some classical problems of algebraic geometry. The main goal of this book is to highlight such computational techniques related to algebraic curves. The area of research in algebraic curves is receiving more interest not only from the mathematics community, but also from engineers and computer scientists, because of the importance of algebraic curves in applications including cryptography, coding theory, error-correcting codes, digital imaging, computer vision, and many more.This book cove

Applications of symbolic algebraic computation

International Nuclear Information System (INIS)

Brown, W.S.; Hearn, A.C.

1979-01-01

This paper is a survey of applications of systems for symbomic algebraic computation. In most successful applications, calculations that can be taken to a given order by hand are then extended one or two more orders by computer. Furthermore, with a few notable exceptins, these applications also involve numerical computation in some way. Therefore the authors emphasize the interface between symbolic and numerical computation, including: 1. Computations with both symbolic and numerical phases. 2. Data involving both the unpredictible size and shape that typify symbolic computation and the (usually inexact) numerical values that characterize numerical computation. 3. Applications of one field to the other. It is concluded that the fields of symbolic and numerical computation can advance most fruitfully in harmony rather than in competition. (Auth.)

Computer Language For Optimization Of Design

Science.gov (United States)

Scotti, Stephen J.; Lucas, Stephen H.

1991-01-01

SOL is computer language geared to solution of design problems. Includes mathematical modeling and logical capabilities of computer language like FORTRAN; also includes additional power of nonlinear mathematical programming methods at language level. SOL compiler takes SOL-language statements and generates equivalent FORTRAN code and system calls. Provides syntactic and semantic checking for recovery from errors and provides detailed reports containing cross-references to show where each variable used. Implemented on VAX/VMS computer systems. Requires VAX FORTRAN compiler to produce executable program.

Essential numerical computer methods

CERN Document Server

Johnson, Michael L

2010-01-01

The use of computers and computational methods has become ubiquitous in biological and biomedical research. During the last 2 decades most basic algorithms have not changed, but what has is the huge increase in computer speed and ease of use, along with the corresponding orders of magnitude decrease in cost. A general perception exists that the only applications of computers and computer methods in biological and biomedical research are either basic statistical analysis or the searching of DNA sequence data bases. While these are important applications they only scratch the surface of the current and potential applications of computers and computer methods in biomedical research. The various chapters within this volume include a wide variety of applications that extend far beyond this limited perception. As part of the Reliable Lab Solutions series, Essential Numerical Computer Methods brings together chapters from volumes 210, 240, 321, 383, 384, 454, and 467 of Methods in Enzymology. These chapters provide ...

Cognitive engineering in mental health computing

NARCIS (Netherlands)

Brinkman, W.P.

2011-01-01

Computer applications in support of mental health care and rehabilitation are becoming more widely used. They include technologies such as virtual reality, electronic diaries, multimedia, brain computing and computer games. Research in this area is emerging, and focussing on a variety of issues,

The CMS Computing Model

International Nuclear Information System (INIS)

Bonacorsi, D.

2007-01-01

The CMS experiment at LHC has developed a baseline Computing Model addressing the needs of a computing system capable to operate in the first years of LHC running. It is focused on a data model with heavy streaming at the raw data level based on trigger, and on the achievement of the maximum flexibility in the use of distributed computing resources. The CMS distributed Computing Model includes a Tier-0 centre at CERN, a CMS Analysis Facility at CERN, several Tier-1 centres located at large regional computing centres, and many Tier-2 centres worldwide. The workflows have been identified, along with a baseline architecture for the data management infrastructure. This model is also being tested in Grid Service Challenges of increasing complexity, coordinated with the Worldwide LHC Computing Grid community

NASA's computer science research program

Science.gov (United States)

Larsen, R. L.

1983-01-01

Following a major assessment of NASA's computing technology needs, a new program of computer science research has been initiated by the Agency. The program includes work in concurrent processing, management of large scale scientific databases, software engineering, reliable computing, and artificial intelligence. The program is driven by applications requirements in computational fluid dynamics, image processing, sensor data management, real-time mission control and autonomous systems. It consists of university research, in-house NASA research, and NASA's Research Institute for Advanced Computer Science (RIACS) and Institute for Computer Applications in Science and Engineering (ICASE). The overall goal is to provide the technical foundation within NASA to exploit advancing computing technology in aerospace applications.

Computational chemistry

Science.gov (United States)

Arnold, J. O.

1987-01-01

With the advent of supercomputers, modern computational chemistry algorithms and codes, a powerful tool was created to help fill NASA's continuing need for information on the properties of matter in hostile or unusual environments. Computational resources provided under the National Aerodynamics Simulator (NAS) program were a cornerstone for recent advancements in this field. Properties of gases, materials, and their interactions can be determined from solutions of the governing equations. In the case of gases, for example, radiative transition probabilites per particle, bond-dissociation energies, and rates of simple chemical reactions can be determined computationally as reliably as from experiment. The data are proving to be quite valuable in providing inputs to real-gas flow simulation codes used to compute aerothermodynamic loads on NASA's aeroassist orbital transfer vehicles and a host of problems related to the National Aerospace Plane Program. Although more approximate, similar solutions can be obtained for ensembles of atoms simulating small particles of materials with and without the presence of gases. Computational chemistry has application in studying catalysis, properties of polymers, all of interest to various NASA missions, including those previously mentioned. In addition to discussing these applications of computational chemistry within NASA, the governing equations and the need for supercomputers for their solution is outlined.

Computational mathematics in China

CERN Document Server

Shi, Zhong-Ci

1994-01-01

This volume describes the most significant contributions made by Chinese mathematicians over the past decades in various areas of computational mathematics. Some of the results are quite important and complement Western developments in the field. The contributors to the volume range from noted senior mathematicians to promising young researchers. The topics include finite element methods, computational fluid mechanics, numerical solutions of differential equations, computational methods in dynamical systems, numerical algebra, approximation, and optimization. Containing a number of survey articles, the book provides an excellent way for Western readers to gain an understanding of the status and trends of computational mathematics in China.

Design of a modular digital computer system, DRL 4. [for meeting future requirements of spaceborne computers

Science.gov (United States)

1972-01-01

The design is reported of an advanced modular computer system designated the Automatically Reconfigurable Modular Multiprocessor System, which anticipates requirements for higher computing capacity and reliability for future spaceborne computers. Subjects discussed include: an overview of the architecture, mission analysis, synchronous and nonsynchronous scheduling control, reliability, and data transmission.

Quantum Computation--The Ultimate Frontier

OpenAIRE

Adami, Chris; Dowling, Jonathan P.

2002-01-01

The discovery of an algorithm for factoring which runs in polynomial time on a quantum computer has given rise to a concerted effort to understand the principles, advantages, and limitations of quantum computing. At the same time, many different quantum systems are being explored for their suitability to serve as a physical substrate for the quantum computer of the future. I discuss some of the theoretical foundations of quantum computer science, including algorithms and error correction, and...

Introduction to reversible computing

CERN Document Server

Perumalla, Kalyan S

2013-01-01

Few books comprehensively cover the software and programming aspects of reversible computing. Filling this gap, Introduction to Reversible Computing offers an expanded view of the field that includes the traditional energy-motivated hardware viewpoint as well as the emerging application-motivated software approach. Collecting scattered knowledge into one coherent account, the book provides a compendium of both classical and recently developed results on reversible computing. It explores up-and-coming theories, techniques, and tools for the application of rever

Computer science I essentials

CERN Document Server

Raus, Randall

2012-01-01

REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Computer Science I includes fundamental computer concepts, number representations, Boolean algebra, switching circuits, and computer architecture.

Computational chemistry research

Science.gov (United States)

Levin, Eugene

1987-01-01

Task 41 is composed of two parts: (1) analysis and design studies related to the Numerical Aerodynamic Simulation (NAS) Extended Operating Configuration (EOC) and (2) computational chemistry. During the first half of 1987, Dr. Levin served as a member of an advanced system planning team to establish the requirements, goals, and principal technical characteristics of the NAS EOC. A paper entitled 'Scaling of Data Communications for an Advanced Supercomputer Network' is included. The high temperature transport properties (such as viscosity, thermal conductivity, etc.) of the major constituents of air (oxygen and nitrogen) were correctly determined. The results of prior ab initio computer solutions of the Schroedinger equation were combined with the best available experimental data to obtain complete interaction potentials for both neutral and ion-atom collision partners. These potentials were then used in a computer program to evaluate the collision cross-sections from which the transport properties could be determined. A paper entitled 'High Temperature Transport Properties of Air' is included.

Planning Computer-Aided Distance Learning

Directory of Open Access Journals (Sweden)

Nadja Dobnik

1996-12-01

Full Text Available Didactics of autonomous learning changes under the influence of new technologies. Computer technology can cover all the functions that a teacher develops in personal contact with the learner. People organizing distance learning must realize all the possibilities offered by computers. Computers can take over and also combine the functions of many tools and systems, e. g. type­ writer, video, telephone. This the contents can be offered in form of classic media by means of text, speech, picture, etc. Computers take over data pro­cessing and function as study materials. Computer included in a computer network can also function as a medium for interactive communication.

Computing in Engineering Education: From There, to Here, to Where? Part 1: Computing.

Science.gov (United States)

Carnahan, Brice

1991-01-01

Presents the 1990 American Society for Engineering Education award lecture for the Chemical Engineering Division. Following a brief outline of what the computing world includes, the lecture traces computing technology from the early years to milestones, as well as current trends, in both hardware and software development. Highlights the…

Identifying failure in a tree network of a parallel computer

Science.gov (United States)

Archer, Charles J.; Pinnow, Kurt W.; Wallenfelt, Brian P.

2010-08-24

Methods, parallel computers, and products are provided for identifying failure in a tree network of a parallel computer. The parallel computer includes one or more processing sets including an I/O node and a plurality of compute nodes. For each processing set embodiments include selecting a set of test compute nodes, the test compute nodes being a subset of the compute nodes of the processing set; measuring the performance of the I/O node of the processing set; measuring the performance of the selected set of test compute nodes; calculating a current test value in dependence upon the measured performance of the I/O node of the processing set, the measured performance of the set of test compute nodes, and a predetermined value for I/O node performance; and comparing the current test value with a predetermined tree performance threshold. If the current test value is below the predetermined tree performance threshold, embodiments include selecting another set of test compute nodes. If the current test value is not below the predetermined tree performance threshold, embodiments include selecting from the test compute nodes one or more potential problem nodes and testing individually potential problem nodes and links to potential problem nodes.

Mobile computing device configured to compute irradiance, glint, and glare of the sun

Science.gov (United States)

Gupta, Vipin P; Ho, Clifford K; Khalsa, Siri Sahib

2014-03-11

Described herein are technologies pertaining to computing the solar irradiance distribution on a surface of a receiver in a concentrating solar power system or glint/glare emitted from a reflective entity. A mobile computing device includes at least one camera that captures images of the Sun and the entity of interest, wherein the images have pluralities of pixels having respective pluralities of intensity values. Based upon the intensity values of the pixels in the respective images, the solar irradiance distribution on the surface of the entity or glint/glare corresponding to the entity is computed by the mobile computing device.

CHEP95: Computing in high energy physics. Abstracts

International Nuclear Information System (INIS)

1995-01-01

These proceedings cover the technical papers on computation in High Energy Physics, including computer codes, computer devices, control systems, simulations, data acquisition systems. New approaches on computer architectures are also discussed

Computing architecture for autonomous microgrids

Science.gov (United States)

Goldsmith, Steven Y.

2015-09-29

A computing architecture that facilitates autonomously controlling operations of a microgrid is described herein. A microgrid network includes numerous computing devices that execute intelligent agents, each of which is assigned to a particular entity (load, source, storage device, or switch) in the microgrid. The intelligent agents can execute in accordance with predefined protocols to collectively perform computations that facilitate uninterrupted control of the .

Evaluation of computer-based ultrasonic inservice inspection systems

International Nuclear Information System (INIS)

Harris, R.V. Jr.; Angel, L.J.; Doctor, S.R.; Park, W.R.; Schuster, G.J.; Taylor, T.T.

1994-03-01

This report presents the principles, practices, terminology, and technology of computer-based ultrasonic testing for inservice inspection (UT/ISI) of nuclear power plants, with extensive use of drawings, diagrams, and LTT images. The presentation is technical but assumes limited specific knowledge of ultrasonics or computers. The report is divided into 9 sections covering conventional LTT, computer-based LTT, and evaluation methodology. Conventional LTT topics include coordinate axes, scanning, instrument operation, RF and video signals, and A-, B-, and C-scans. Computer-based topics include sampling, digitization, signal analysis, image presentation, SAFI, ultrasonic holography, transducer arrays, and data interpretation. An evaluation methodology for computer-based LTT/ISI systems is presented, including questions, detailed procedures, and test block designs. Brief evaluations of several computer-based LTT/ISI systems are given; supplementary volumes will provide detailed evaluations of selected systems

Semiotics, Information Science, Documents and Computers.

Science.gov (United States)

Warner, Julian

1990-01-01

Discusses the relationship and value of semiotics to the established domains of information science. Highlights include documentation; computer operations; the language of computing; automata theory; linguistics; speech and writing; and the written language as a unifying principle for the document and the computer. (93 references) (LRW)

Ordinateur et communication (Computer and Communication).

Science.gov (United States)

Mangenot, Francois

1994-01-01

Because use of computers in second-language classrooms may tend to decrease interpersonal interaction, and therefore communication, ways to promote interaction are offered. These include small group computer projects, and suggestions are made for use with various computer functions and features: tutorials, word processing, voice recording,…

Intranode data communications in a parallel computer

Science.gov (United States)

Archer, Charles J; Blocksome, Michael A; Miller, Douglas R; Ratterman, Joseph D; Smith, Brian E

2014-01-07

Intranode data communications in a parallel computer that includes compute nodes configured to execute processes, where the data communications include: allocating, upon initialization of a first process of a computer node, a region of shared memory; establishing, by the first process, a predefined number of message buffers, each message buffer associated with a process to be initialized on the compute node; sending, to a second process on the same compute node, a data communications message without determining whether the second process has been initialized, including storing the data communications message in the message buffer of the second process; and upon initialization of the second process: retrieving, by the second process, a pointer to the second process's message buffer; and retrieving, by the second process from the second process's message buffer in dependence upon the pointer, the data communications message sent by the first process.

Intranode data communications in a parallel computer

Science.gov (United States)

Archer, Charles J; Blocksome, Michael A; Miller, Douglas R; Ratterman, Joseph D; Smith, Brian E

2013-07-23

Intranode data communications in a parallel computer that includes compute nodes configured to execute processes, where the data communications include: allocating, upon initialization of a first process of a compute node, a region of shared memory; establishing, by the first process, a predefined number of message buffers, each message buffer associated with a process to be initialized on the compute node; sending, to a second process on the same compute node, a data communications message without determining whether the second process has been initialized, including storing the data communications message in the message buffer of the second process; and upon initialization of the second process: retrieving, by the second process, a pointer to the second process's message buffer; and retrieving, by the second process from the second process's message buffer in dependence upon the pointer, the data communications message sent by the first process.

Computer science II essentials

CERN Document Server

Raus, Randall

2012-01-01

REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Computer Science II includes organization of a computer, memory and input/output, coding, data structures, and program development. Also included is an overview of the most commonly

The Fermilab central computing facility architectural model

International Nuclear Information System (INIS)

Nicholls, J.

1989-01-01

The goal of the current Central Computing Upgrade at Fermilab is to create a computing environment that maximizes total productivity, particularly for high energy physics analysis. The Computing Department and the Next Computer Acquisition Committee decided upon a model which includes five components: an interactive front-end, a Large-Scale Scientific Computer (LSSC, a mainframe computing engine), a microprocessor farm system, a file server, and workstations. With the exception of the file server, all segments of this model are currently in production: a VAX/VMS cluster interactive front-end, an Amdahl VM Computing engine, ACP farms, and (primarily) VMS workstations. This paper will discuss the implementation of the Fermilab Central Computing Facility Architectural Model. Implications for Code Management in such a heterogeneous environment, including issues such as modularity and centrality, will be considered. Special emphasis will be placed on connectivity and communications between the front-end, LSSC, and workstations, as practiced at Fermilab. (orig.)

The Fermilab Central Computing Facility architectural model

International Nuclear Information System (INIS)

Nicholls, J.

1989-05-01

The goal of the current Central Computing Upgrade at Fermilab is to create a computing environment that maximizes total productivity, particularly for high energy physics analysis. The Computing Department and the Next Computer Acquisition Committee decided upon a model which includes five components: an interactive front end, a Large-Scale Scientific Computer (LSSC, a mainframe computing engine), a microprocessor farm system, a file server, and workstations. With the exception of the file server, all segments of this model are currently in production: a VAX/VMS Cluster interactive front end, an Amdahl VM computing engine, ACP farms, and (primarily) VMS workstations. This presentation will discuss the implementation of the Fermilab Central Computing Facility Architectural Model. Implications for Code Management in such a heterogeneous environment, including issues such as modularity and centrality, will be considered. Special emphasis will be placed on connectivity and communications between the front-end, LSSC, and workstations, as practiced at Fermilab. 2 figs

Accreditation of academic programmes in computing South Africa

CSIR Research Space (South Africa)

Gerber, A

2012-05-01

Full Text Available Over the past two decades, strong technical convergence has been observed between computing and engineering. Computing in this context includes Computer Engineering, Computer Science, Information Systems, Information Technology and Software...

Computational engineering

CERN Document Server

2014-01-01

The book presents state-of-the-art works in computational engineering. Focus is on mathematical modeling, numerical simulation, experimental validation and visualization in engineering sciences. In particular, the following topics are presented: constitutive models and their implementation into finite element codes, numerical models in nonlinear elasto-dynamics including seismic excitations, multiphase models in structural engineering and multiscale models of materials systems, sensitivity and reliability analysis of engineering structures, the application of scientific computing in urban water management and hydraulic engineering, and the application of genetic algorithms for the registration of laser scanner point clouds.

Elementary mathematical and computational tools for electrical and computer engineers using Matlab

CERN Document Server

Manassah, Jamal T

2013-01-01

Ideal for use as a short-course textbook and for self-study Elementary Mathematical and Computational Tools for Electrical and Computer Engineers Using MATLAB fills that gap. Accessible after just one semester of calculus, it introduces the many practical analytical and numerical tools that are essential to success both in future studies and in professional life. Sharply focused on the needs of the electrical and computer engineering communities, the text provides a wealth of relevant exercises and design problems. Changes in MATLAB's version 6.0 are included in a special addendum.

Current Trends in Cloud Computing A Survey of Cloud Computing Systems

OpenAIRE

Harjit Singh

2012-01-01

Cloud computing that has become an increasingly important trend, is a virtualization technology that uses the internet and central remote servers to offer the sharing of resources that include infrastructures, software, applications and business processes to the market environment to fulfill the elastic demand. In today’s competitive environment, the service vitality, elasticity, choices and flexibility offered by this scalable technology are too attractive that makes the cloud computing to i...

High-level language computer architecture

CERN Document Server

Chu, Yaohan

1975-01-01

High-Level Language Computer Architecture offers a tutorial on high-level language computer architecture, including von Neumann architecture and syntax-oriented architecture as well as direct and indirect execution architecture. Design concepts of Japanese-language data processing systems are discussed, along with the architecture of stack machines and the SYMBOL computer system. The conceptual design of a direct high-level language processor is also described.Comprised of seven chapters, this book first presents a classification of high-level language computer architecture according to the pr

Mathematical Model of Thyristor Inverter Including a Series-parallel Resonant Circuit

OpenAIRE

Miroslaw Luft; Elzbieta Szychta

2008-01-01

The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with theaid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.

Computer systems: What the future holds

Science.gov (United States)

Stone, H. S.

1976-01-01

Developement of computer architecture is discussed in terms of the proliferation of the microprocessor, the utility of the medium-scale computer, and the sheer computational power of the large-scale machine. Changes in new applications brought about because of ever lowering costs, smaller sizes, and faster switching times are included.

Comparison of DSMC and CFD Solutions of Fire II Including Radiative Heating

Science.gov (United States)

Liechty, Derek S.; Johnston, Christopher O.; Lewis, Mark J.

2011-01-01

The ability to compute rarefied, ionized hypersonic flows is becoming more important as missions such as Earth reentry, landing high mass payloads on Mars, and the exploration of the outer planets and their satellites are being considered. These flows may also contain significant radiative heating. To prepare for these missions, NASA is developing the capability to simulate rarefied, ionized flows and to then calculate the resulting radiative heating to the vehicle's surface. In this study, the DSMC codes DAC and DS2V are used to obtain charge-neutral ionization solutions. NASA s direct simulation Monte Carlo code DAC is currently being updated to include the ability to simulate charge-neutral ionized flows, take advantage of the recently introduced Quantum-Kinetic chemistry model, and to include electronic energy levels as an additional internal energy mode. The Fire II flight test is used in this study to assess these new capabilities. The 1634 second data point was chosen for comparisons to be made in order to include comparisons to computational fluid dynamics solutions. The Knudsen number at this point in time is such that the DSMC simulations are still tractable and the CFD computations are at the edge of what is considered valid. It is shown that there can be quite a bit of variability in the vibrational temperature inferred from DSMC solutions and that, from how radiative heating is computed, the electronic temperature is much better suited for radiative calculations. To include the radiative portion of heating, the flow-field solutions are post-processed by the non-equilibrium radiation code HARA. Acceptable agreement between CFD and DSMC flow field solutions is demonstrated and the progress of the updates to DAC, along with an appropriate radiative heating solution, are discussed. In addition, future plans to generate more high fidelity radiative heat transfer solutions are discussed.

Capability-based computer systems

CERN Document Server

Levy, Henry M

2014-01-01

Capability-Based Computer Systems focuses on computer programs and their capabilities. The text first elaborates capability- and object-based system concepts, including capability-based systems, object-based approach, and summary. The book then describes early descriptor architectures and explains the Burroughs B5000, Rice University Computer, and Basic Language Machine. The text also focuses on early capability architectures. Dennis and Van Horn's Supervisor; CAL-TSS System; MIT PDP-1 Timesharing System; and Chicago Magic Number Machine are discussed. The book then describes Plessey System 25

Digital computers in action

CERN Document Server

Booth, A D

1965-01-01

Digital Computers in Action is an introduction to the basics of digital computers as well as their programming and various applications in fields such as mathematics, science, engineering, economics, medicine, and law. Other topics include engineering automation, process control, special purpose games-playing devices, machine translation and mechanized linguistics, and information retrieval. This book consists of 14 chapters and begins by discussing the history of computers, from the idea of performing complex arithmetical calculations to the emergence of a modern view of the structure of a ge

Essential Means for Urban Computing: Specification of Web-Based Computing Platforms for Urban Planning, a Hitchhiker’s Guide

OpenAIRE

Pirouz Nourian; Carlos Martinez-Ortiz; Ken Arroyo Ohori

2018-01-01

This article provides an overview of the specifications of web-based computing platforms for urban data analytics and computational urban planning practice. There are currently a variety of tools and platforms that can be used in urban computing practices, including scientific computing languages, interactive web languages, data sharing platforms and still many desktop computing environments, e.g., GIS software applications. We have reviewed a list of technologies considering their potential ...

Combinatorial evaluation of systems including decomposition of a system representation into fundamental cycles

Science.gov (United States)

Oliveira, Joseph S [Richland, WA; Jones-Oliveira, Janet B [Richland, WA; Bailey, Colin G [Wellington, NZ; Gull, Dean W [Seattle, WA

2008-07-01

One embodiment of the present invention includes a computer operable to represent a physical system with a graphical data structure corresponding to a matroid. The graphical data structure corresponds to a number of vertices and a number of edges that each correspond to two of the vertices. The computer is further operable to define a closed pathway arrangement with the graphical data structure and identify each different one of a number of fundamental cycles by evaluating a different respective one of the edges with a spanning tree representation. The fundamental cycles each include three or more of the vertices.

Mathematical model of thyristor inverter including a series-parallel resonant circuit

OpenAIRE

Luft, M.; Szychta, E.

2008-01-01

The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with the aid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.

Guide to cloud computing for business and technology managers from distributed computing to cloudware applications

CERN Document Server

Kale, Vivek

2014-01-01

Guide to Cloud Computing for Business and Technology Managers: From Distributed Computing to Cloudware Applications unravels the mystery of cloud computing and explains how it can transform the operating contexts of business enterprises. It provides a clear understanding of what cloud computing really means, what it can do, and when it is practical to use. Addressing the primary management and operation concerns of cloudware, including performance, measurement, monitoring, and security, this pragmatic book:Introduces the enterprise applications integration (EAI) solutions that were a first ste

Advances in Computer Science and Engineering

CERN Document Server

Second International Conference on Advances in Computer Science and Engineering (CES 2012)

2012-01-01

This book includes the proceedings of the second International Conference on Advances in Computer Science and Engineering (CES 2012), which was held during January 13-14, 2012 in Sanya, China. The papers in these proceedings of CES 2012 focus on the researchers’ advanced works in their fields of Computer Science and Engineering mainly organized in four topics, (1) Software Engineering, (2) Intelligent Computing, (3) Computer Networks, and (4) Artificial Intelligence Software.

Parallel Computing Using Web Servers and "Servlets".

Science.gov (United States)

Lo, Alfred; Bloor, Chris; Choi, Y. K.

2000-01-01

Describes parallel computing and presents inexpensive ways to implement a virtual parallel computer with multiple Web servers. Highlights include performance measurement of parallel systems; models for using Java and intranet technology including single server, multiple clients and multiple servers, single client; and a comparison of CGI (common…

Computers in Schools: White Boys Only?

Science.gov (United States)

Hammett, Roberta F.

1997-01-01

Discusses the role of computers in today's world and the construction of computer use attitudes, such as gender gaps. Suggests how schools might close the gaps. Includes a brief explanation about how facility with computers is important for women in their efforts to gain equitable treatment in all aspects of their lives. (PA)

An introduction to digital computing

CERN Document Server

George, F H

2014-01-01

An Introduction to Digital Computing provides information pertinent to the fundamental aspects of digital computing. This book represents a major step towards the universal availability of programmed material.Organized into four chapters, this book begins with an overview of the fundamental workings of the computer, including the way it handles simple arithmetic problems. This text then provides a brief survey of the basic features of a typical computer that is divided into three sections, namely, the input and output system, the memory system for data storage, and a processing system. Other c

Computational thinking as an emerging competence domain

NARCIS (Netherlands)

Yadav, A.; Good, J.; Voogt, J.; Fisser, P.; Mulder, M.

2016-01-01

Computational thinking is a problem-solving skill set, which includes problem decomposition, algorithmic thinking, abstraction, and automation. Even though computational thinking draws upon concepts fundamental to computer science (CS), it has broad application to all disciplines. It has been

5 CFR 841.605 - Interest included in the unexpended balance.

Science.gov (United States)

2010-01-01

... balance. 841.605 Section 841.605 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL... Interest § 841.605 Interest included in the unexpended balance. (a) Interest on each Individual Retirement Record is computed separately. (b) For determining the amount of interest in the unexpended balance when...

Editorial for special section of grid computing journal on “Cloud Computing and Services Science‿

NARCIS (Netherlands)

van Sinderen, Marten J.; Ivanov, Ivan I.

This editorial briefly discusses characteristics, technology developments and challenges of cloud computing. It then introduces the papers included in the special issue on "Cloud Computing and Services Science" and positions the work reported in these papers with respect to the previously mentioned

Proposal for grid computing for nuclear applications

International Nuclear Information System (INIS)

Faridah Mohamad Idris; Wan Ahmad Tajuddin Wan Abdullah; Zainol Abidin Ibrahim; Zukhaimira Zolkapli

2013-01-01

Full-text: The use of computer clusters for computational sciences including computational physics is vital as it provides computing power to crunch big numbers at a faster rate. In compute intensive applications that requires high resolution such as Monte Carlo simulation, the use of computer clusters in a grid form that supplies computational power to any nodes within the grid that needs computing power, has now become a necessity. In this paper, we described how the clusters running on a specific application could use resources within the grid, to run the applications to speed up the computing process. (author)

Computers in nonassociative rings and algebras

CERN Document Server

Beck, Robert E

1977-01-01

Computers in Nonassociative Rings and Algebras provides information pertinent to the computational aspects of nonassociative rings and algebras. This book describes the algorithmic approaches for solving problems using a computer.Organized into 10 chapters, this book begins with an overview of the concept of a symmetrized power of a group representation. This text then presents data structures and other computational methods that may be useful in the field of computational algebra. Other chapters consider several mathematical ideas, including identity processing in nonassociative algebras, str

High energy physics and cloud computing

International Nuclear Information System (INIS)

Cheng Yaodong; Liu Baoxu; Sun Gongxing; Chen Gang

2011-01-01

High Energy Physics (HEP) has been a strong promoter of computing technology, for example WWW (World Wide Web) and the grid computing. In the new era of cloud computing, HEP has still a strong demand, and major international high energy physics laboratories have launched a number of projects to research on cloud computing technologies and applications. It describes the current developments in cloud computing and its applications in high energy physics. Some ongoing projects in the institutes of high energy physics, Chinese Academy of Sciences, including cloud storage, virtual computing clusters, and BESⅢ elastic cloud, are also described briefly in the paper. (authors)

High energy physics computing in Japan

International Nuclear Information System (INIS)

Watase, Yoshiyuki

1989-01-01

A brief overview of the computing provision for high energy physics in Japan is presented. Most of the computing power for high energy physics is concentrated in KEK. Here there are two large scale systems: one providing a general computing service including vector processing and the other dedicated to TRISTAN experiments. Each university group has a smaller sized mainframe or VAX system to facilitate both their local computing needs and the remote use of the KEK computers through a network. The large computer system for the TRISTAN experiments is described. An overview of a prospective future large facility is also given. (orig.)

Computing Education in Korea--Current Issues and Endeavors

Science.gov (United States)

Choi, Jeongwon; An, Sangjin; Lee, Youngjun

2015-01-01

Computer education has been provided for a long period of time in Korea. Starting as a vocational program, the content of computer education for students evolved to include content on computer literacy, Information Communication Technology (ICT) literacy, and brand-new computer science. While a new curriculum related to computer science was…

7th International Workshop on Natural Computing

CERN Document Server

Hagiya, Masami

2015-01-01

This book highlights recent advances in natural computing, including biology and its theory, bio-inspired computing, computational aesthetics, computational models and theories, computing with natural media, philosophy of natural computing and educational technology. It presents extended versions of the best papers selected from the symposium “7th International Workshop on Natural Computing” (IWNC7), held in Tokyo, Japan, in 2013. The target audience is not limited to researchers working in natural computing but also those active in biological engineering, fine/media art design, aesthetics and philosophy.

Checkpointing for a hybrid computing node

Science.gov (United States)

Cher, Chen-Yong

2016-03-08

According to an aspect, a method for checkpointing in a hybrid computing node includes executing a task in a processing accelerator of the hybrid computing node. A checkpoint is created in a local memory of the processing accelerator. The checkpoint includes state data to restart execution of the task in the processing accelerator upon a restart operation. Execution of the task is resumed in the processing accelerator after creating the checkpoint. The state data of the checkpoint are transferred from the processing accelerator to a main processor of the hybrid computing node while the processing accelerator is executing the task.

Quantum computing

International Nuclear Information System (INIS)

Steane, Andrew

1998-01-01

The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarize not just quantum computing, but the whole subject of quantum information theory. Information can be identified as the most general thing which must propagate from a cause to an effect. It therefore has a fundamentally important role in the science of physics. However, the mathematical treatment of information, especially information processing, is quite recent, dating from the mid-20th century. This has meant that the full significance of information as a basic concept in physics is only now being discovered. This is especially true in quantum mechanics. The theory of quantum information and computing puts this significance on a firm footing, and has led to some profound and exciting new insights into the natural world. Among these are the use of quantum states to permit the secure transmission of classical information (quantum cryptography), the use of quantum entanglement to permit reliable transmission of quantum states (teleportation), the possibility of preserving quantum coherence in the presence of irreversible noise processes (quantum error correction), and the use of controlled quantum evolution for efficient computation (quantum computation). The common theme of all these insights is the use of quantum entanglement as a computational resource. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, this review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the Einstein, Podolsky and Rosen (EPR) experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from

Quantum computing

Energy Technology Data Exchange (ETDEWEB)

Steane, Andrew [Department of Atomic and Laser Physics, University of Oxford, Clarendon Laboratory, Oxford (United Kingdom)

1998-02-01

The subject of quantum computing brings together ideas from classical information theory, computer science, and quantum physics. This review aims to summarize not just quantum computing, but the whole subject of quantum information theory. Information can be identified as the most general thing which must propagate from a cause to an effect. It therefore has a fundamentally important role in the science of physics. However, the mathematical treatment of information, especially information processing, is quite recent, dating from the mid-20th century. This has meant that the full significance of information as a basic concept in physics is only now being discovered. This is especially true in quantum mechanics. The theory of quantum information and computing puts this significance on a firm footing, and has led to some profound and exciting new insights into the natural world. Among these are the use of quantum states to permit the secure transmission of classical information (quantum cryptography), the use of quantum entanglement to permit reliable transmission of quantum states (teleportation), the possibility of preserving quantum coherence in the presence of irreversible noise processes (quantum error correction), and the use of controlled quantum evolution for efficient computation (quantum computation). The common theme of all these insights is the use of quantum entanglement as a computational resource. It turns out that information theory and quantum mechanics fit together very well. In order to explain their relationship, this review begins with an introduction to classical information theory and computer science, including Shannon's theorem, error correcting codes, Turing machines and computational complexity. The principles of quantum mechanics are then outlined, and the Einstein, Podolsky and Rosen (EPR) experiment described. The EPR-Bell correlations, and quantum entanglement in general, form the essential new ingredient which distinguishes quantum from

Progress report of Physics Division including Applied Mathematics and Computing Section. 1st October 1970 - 31st March 1971

International Nuclear Information System (INIS)

2004-01-01

The initial MOATA safety assessment was based on data and calculations available before the advent of multigroup diffusion theory codes in two dimensions. That assessment is being revised and extended to gain approval for 100 kW operation. The more detailed representation obtained in the new calculations has resulted in a much better understanding of the physics of this reactor. The properties of the reactor are determined to a large extent by neutron leakage from the rather thin core tanks. In particular the effect of leakage on the coupling between the core tanks and on reactivity coefficients has been clarified and quantified. In neutron data studies, the theoretical fission product library was revised, checked against any experimental values and distributed to interested overseas centres. Some further nubar work was done vith much better neutron energy resolution, and confirmed our earlier measurements. A promising formulation of R matrix theory of nuclear interaction is expected to lead to simpler multilevel resonance parameter description. With large amounts of digital data being collected, dissplayed and used by theoreticians and experimentalists, more attention -was given to visual interactive computer displays. This interest is generating constructive proposals for use of the dataway now being installed between the Division and the IBM 360/50 computer. The study of gamma rays following the capture of keV neutrons continues to reveal new and interesting features of the physical processes involved. A detailed international compilation of the gamma rays emitted and their intensities is in progress. The work on nickel-68, amongst others, has enabled a partial capture cross section to be generated from the gamma ray parameters obtained by experiment. Much work still remains to be done, possibly at other establishments with more extensive facilities. The electrical and mechanical components of our new zero power split table machine for reactor physics assemblies

COMPUTING

CERN Multimedia

P. McBride

It has been a very active year for the computing project with strong contributions from members of the global community. The project has focused on site preparation and Monte Carlo production. The operations group has begun processing data from P5 as part of the global data commissioning. Improvements in transfer rates and site availability have been seen as computing sites across the globe prepare for large scale production and analysis as part of CSA07. Preparations for the upcoming Computing Software and Analysis Challenge CSA07 are progressing. Ian Fisk and Neil Geddes have been appointed as coordinators for the challenge. CSA07 will include production tests of the Tier-0 production system, reprocessing at the Tier-1 sites and Monte Carlo production at the Tier-2 sites. At the same time there will be a large analysis exercise at the Tier-2 centres. Pre-production simulation of the Monte Carlo events for the challenge is beginning. Scale tests of the Tier-0 will begin in mid-July and the challenge it...

Monitoring system including an electronic sensor platform and an interrogation transceiver

Science.gov (United States)

Kinzel, Robert L.; Sheets, Larry R.

2003-09-23

A wireless monitoring system suitable for a wide range of remote data collection applications. The system includes at least one Electronic Sensor Platform (ESP), an Interrogator Transceiver (IT) and a general purpose host computer. The ESP functions as a remote data collector from a number of digital and analog sensors located therein. The host computer provides for data logging, testing, demonstration, installation checkout, and troubleshooting of the system. The IT transmits signals from one or more ESP's to the host computer to the ESP's. The IT host computer may be powered by a common power supply, and each ESP is individually powered by a battery. This monitoring system has an extremely low power consumption which allows remote operation of the ESP for long periods; provides authenticated message traffic over a wireless network; utilizes state-of-health and tamper sensors to ensure that the ESP is secure and undamaged; has robust housing of the ESP suitable for use in radiation environments; and is low in cost. With one base station (host computer and interrogator transceiver), multiple ESP's may be controlled at a single monitoring site.

Computer security

CERN Document Server

Gollmann, Dieter

2011-01-01

A completely up-to-date resource on computer security Assuming no previous experience in the field of computer security, this must-have book walks you through the many essential aspects of this vast topic, from the newest advances in software and technology to the most recent information on Web applications security. This new edition includes sections on Windows NT, CORBA, and Java and discusses cross-site scripting and JavaScript hacking as well as SQL injection. Serving as a helpful introduction, this self-study guide is a wonderful starting point for examining the variety of competing sec

Mathematical Model of Thyristor Inverter Including a Series-parallel Resonant Circuit

Directory of Open Access Journals (Sweden)

Miroslaw Luft

2008-01-01

Full Text Available The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with theaid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.

VNAP2: a computer program for computation of two-dimensional, time-dependent, compressible, turbulent flow

Energy Technology Data Exchange (ETDEWEB)

Cline, M.C.

1981-08-01

VNAP2 is a computer program for calculating turbulent (as well as laminar and inviscid), steady, and unsteady flow. VNAP2 solves the two-dimensional, time-dependent, compressible Navier-Stokes equations. The turbulence is modeled with either an algebraic mixing-length model, a one-equation model, or the Jones-Launder two-equation model. The geometry may be a single- or a dual-flowing stream. The interior grid points are computed using the unsplit MacCormack scheme. Two options to speed up the calculations for high Reynolds number flows are included. The boundary grid points are computed using a reference-plane-characteristic scheme with the viscous terms treated as source functions. An explicit artificial viscosity is included for shock computations. The fluid is assumed to be a perfect gas. The flow boundaries may be arbitrary curved solid walls, inflow/outflow boundaries, or free-jet envelopes. Typical problems that can be solved concern nozzles, inlets, jet-powered afterbodies, airfoils, and free-jet expansions. The accuracy and efficiency of the program are shown by calculations of several inviscid and turbulent flows. The program and its use are described completely, and six sample cases and a code listing are included.

Collectively loading an application in a parallel computer

Science.gov (United States)

Aho, Michael E.; Attinella, John E.; Gooding, Thomas M.; Miller, Samuel J.; Mundy, Michael B.

2016-01-05

Collectively loading an application in a parallel computer, the parallel computer comprising a plurality of compute nodes, including: identifying, by a parallel computer control system, a subset of compute nodes in the parallel computer to execute a job; selecting, by the parallel computer control system, one of the subset of compute nodes in the parallel computer as a job leader compute node; retrieving, by the job leader compute node from computer memory, an application for executing the job; and broadcasting, by the job leader to the subset of compute nodes in the parallel computer, the application for executing the job.

Visualizing a silicon quantum computer

International Nuclear Information System (INIS)

Sanders, Barry C; Hollenberg, Lloyd C L; Edmundson, Darran; Edmundson, Andrew

2008-01-01

Quantum computation is a fast-growing, multi-disciplinary research field. The purpose of a quantum computer is to execute quantum algorithms that efficiently solve computational problems intractable within the existing paradigm of 'classical' computing built on bits and Boolean gates. While collaboration between computer scientists, physicists, chemists, engineers, mathematicians and others is essential to the project's success, traditional disciplinary boundaries can hinder progress and make communicating the aims of quantum computing and future technologies difficult. We have developed a four minute animation as a tool for representing, understanding and communicating a silicon-based solid-state quantum computer to a variety of audiences, either as a stand-alone animation to be used by expert presenters or embedded into a longer movie as short animated sequences. The paper includes a generally applicable recipe for successful scientific animation production.

Visualizing a silicon quantum computer

Science.gov (United States)

Sanders, Barry C.; Hollenberg, Lloyd C. L.; Edmundson, Darran; Edmundson, Andrew

2008-12-01

Quantum computation is a fast-growing, multi-disciplinary research field. The purpose of a quantum computer is to execute quantum algorithms that efficiently solve computational problems intractable within the existing paradigm of 'classical' computing built on bits and Boolean gates. While collaboration between computer scientists, physicists, chemists, engineers, mathematicians and others is essential to the project's success, traditional disciplinary boundaries can hinder progress and make communicating the aims of quantum computing and future technologies difficult. We have developed a four minute animation as a tool for representing, understanding and communicating a silicon-based solid-state quantum computer to a variety of audiences, either as a stand-alone animation to be used by expert presenters or embedded into a longer movie as short animated sequences. The paper includes a generally applicable recipe for successful scientific animation production.

Visualizing a silicon quantum computer

Energy Technology Data Exchange (ETDEWEB)

Sanders, Barry C [Institute for Quantum Information Science, University of Calgary, Calgary, Alberta T2N 1N4 (Canada); Hollenberg, Lloyd C L [ARC Centre of Excellence for Quantum Computer Technology, School of Physics, University of Melbourne, Victoria 3010 (Australia); Edmundson, Darran; Edmundson, Andrew [EDM Studio Inc., Level 2, 850 16 Avenue SW, Calgary, Alberta T2R 0S9 (Canada)], E-mail: bsanders@qis.ucalgary.ca, E-mail: lloydch@unimelb.edu.au, E-mail: darran@edmstudio.com

2008-12-15

Quantum computation is a fast-growing, multi-disciplinary research field. The purpose of a quantum computer is to execute quantum algorithms that efficiently solve computational problems intractable within the existing paradigm of 'classical' computing built on bits and Boolean gates. While collaboration between computer scientists, physicists, chemists, engineers, mathematicians and others is essential to the project's success, traditional disciplinary boundaries can hinder progress and make communicating the aims of quantum computing and future technologies difficult. We have developed a four minute animation as a tool for representing, understanding and communicating a silicon-based solid-state quantum computer to a variety of audiences, either as a stand-alone animation to be used by expert presenters or embedded into a longer movie as short animated sequences. The paper includes a generally applicable recipe for successful scientific animation production.

Computational intelligence in medical informatics

CERN Document Server

Gunjan, Vinit

2015-01-01

This Brief highlights Informatics and related techniques to Computer Science Professionals, Engineers, Medical Doctors, Bioinformatics researchers and other interdisciplinary researchers. Chapters include the Bioinformatics of Diabetes and several computational algorithms and statistical analysis approach to effectively study the disorders and possible causes along with medical applications.

Cloud Computing Security: A Survey

OpenAIRE

Khalil, Issa; Khreishah, Abdallah; Azeem, Muhammad

2014-01-01

Cloud computing is an emerging technology paradigm that migrates current technological and computing concepts into utility-like solutions similar to electricity and water systems. Clouds bring out a wide range of benefits including configurable computing resources, economic savings, and service flexibility. However, security and privacy concerns are shown to be the primary obstacles to a wide adoption of clouds. The new concepts that clouds introduce, such as multi-tenancy, resource sharing a...

An introduction to computer viruses

Energy Technology Data Exchange (ETDEWEB)

Brown, D.R.

1992-03-01

This report on computer viruses is based upon a thesis written for the Master of Science degree in Computer Science from the University of Tennessee in December 1989 by David R. Brown. This thesis is entitled An Analysis of Computer Virus Construction, Proliferation, and Control and is available through the University of Tennessee Library. This paper contains an overview of the computer virus arena that can help the reader to evaluate the threat that computer viruses pose. The extent of this threat can only be determined by evaluating many different factors. These factors include the relative ease with which a computer virus can be written, the motivation involved in writing a computer virus, the damage and overhead incurred by infected systems, and the legal implications of computer viruses, among others. Based upon the research, the development of a computer virus seems to require more persistence than technical expertise. This is a frightening proclamation to the computing community. The education of computer professionals to the dangers that viruses pose to the welfare of the computing industry as a whole is stressed as a means of inhibiting the current proliferation of computer virus programs. Recommendations are made to assist computer users in preventing infection by computer viruses. These recommendations support solid general computer security practices as a means of combating computer viruses.

'Micro-8' micro-computer system

International Nuclear Information System (INIS)

Yagi, Hideyuki; Nakahara, Yoshinori; Yamada, Takayuki; Takeuchi, Norio; Koyama, Kinji

1978-08-01

The micro-computer Micro-8 system has been developed to organize a data exchange network between various instruments and a computer group including a large computer system. Used for packet exchangers and terminal controllers, the system consists of ten kinds of standard boards including a CPU board with INTEL-8080 one-chip-processor. CPU architecture, BUS architecture, interrupt control, and standard-boards function are explained in circuit block diagrams. Operations of the basic I/O device, digital I/O board and communication adapter are described with definitions of the interrupt ramp status, I/O command, I/O mask, data register, etc. In the appendixes are circuit drawings, INTEL-8080 micro-processor specifications, BUS connections, I/O address mappings, jumper connections of address selection, and interface connections. (author)

Lecture 7: Worldwide LHC Computing Grid Overview

CERN Multimedia

CERN. Geneva

2013-01-01

This presentation will introduce in an informal, but technically correct way the challenges that are linked to the needs of massively distributed computing architectures in the context of the LHC offline computing. The topics include technological and organizational aspects touching many aspects of LHC computing, from data access, to maintenance of large databases and huge collections of files, to the organization of computing farms and monitoring. Fabrizio Furano holds a Ph.D in Computer Science and has worked in the field of Computing for High Energy Physics for many years. Some of his preferred topics include application architectures, system design and project management, with focus on performance and scalability of data access. Fabrizio has experience in a wide variety of environments, from private companies to academic research in particular in object oriented methodologies, mainly using C++. He has also teaching experience at university level in Software Engineering and C++ Programming.

COMPUTATIONAL SCIENCE CENTER

International Nuclear Information System (INIS)

DAVENPORT, J.

2006-01-01

Computational Science is an integral component of Brookhaven's multi science mission, and is a reflection of the increased role of computation across all of science. Brookhaven currently has major efforts in data storage and analysis for the Relativistic Heavy Ion Collider (RHIC) and the ATLAS detector at CERN, and in quantum chromodynamics. The Laboratory is host for the QCDOC machines (quantum chromodynamics on a chip), 10 teraflop/s computers which boast 12,288 processors each. There are two here, one for the Riken/BNL Research Center and the other supported by DOE for the US Lattice Gauge Community and other scientific users. A 100 teraflop/s supercomputer will be installed at Brookhaven in the coming year, managed jointly by Brookhaven and Stony Brook, and funded by a grant from New York State. This machine will be used for computational science across Brookhaven's entire research program, and also by researchers at Stony Brook and across New York State. With Stony Brook, Brookhaven has formed the New York Center for Computational Science (NYCCS) as a focal point for interdisciplinary computational science, which is closely linked to Brookhaven's Computational Science Center (CSC). The CSC has established a strong program in computational science, with an emphasis on nanoscale electronic structure and molecular dynamics, accelerator design, computational fluid dynamics, medical imaging, parallel computing and numerical algorithms. We have been an active participant in DOES SciDAC program (Scientific Discovery through Advanced Computing). We are also planning a major expansion in computational biology in keeping with Laboratory initiatives. Additional laboratory initiatives with a dependence on a high level of computation include the development of hydrodynamics models for the interpretation of RHIC data, computational models for the atmospheric transport of aerosols, and models for combustion and for energy utilization. The CSC was formed to bring together

Control by personal computer and Interface 1

International Nuclear Information System (INIS)

Kim, Eung Mug; Park, Sun Ho

1989-03-01

This book consists of three chapters. The first chapter deals with basic knowledge of micro computer control which are computer system, micro computer system, control of the micro computer and control system for calculator. The second chapter describes Interface about basic knowledge such as 8255 parallel interface, 6821 parallel interface, parallel interface of personal computer, reading BCD code in parallel interface, IEEE-488 interface, RS-232C interface and transmit data in personal computer and a measuring instrument. The third chapter includes control experiment by micro computer, experiment by eight bit computer and control experiment by machine code and BASIC.

Computer proficiency questionnaire: assessing low and high computer proficient seniors.

Science.gov (United States)

Boot, Walter R; Charness, Neil; Czaja, Sara J; Sharit, Joseph; Rogers, Wendy A; Fisk, Arthur D; Mitzner, Tracy; Lee, Chin Chin; Nair, Sankaran

2015-06-01

Computers and the Internet have the potential to enrich the lives of seniors and aid in the performance of important tasks required for independent living. A prerequisite for reaping these benefits is having the skills needed to use these systems, which is highly dependent on proper training. One prerequisite for efficient and effective training is being able to gauge current levels of proficiency. We developed a new measure (the Computer Proficiency Questionnaire, or CPQ) to measure computer proficiency in the domains of computer basics, printing, communication, Internet, calendaring software, and multimedia use. Our aim was to develop a measure appropriate for individuals with a wide range of proficiencies from noncomputer users to extremely skilled users. To assess the reliability and validity of the CPQ, a diverse sample of older adults, including 276 older adults with no or minimal computer experience, was recruited and asked to complete the CPQ. The CPQ demonstrated excellent reliability (Cronbach's α = .98), with subscale reliabilities ranging from .86 to .97. Age, computer use, and general technology use all predicted CPQ scores. Factor analysis revealed three main factors of proficiency related to Internet and e-mail use; communication and calendaring; and computer basics. Based on our findings, we also developed a short-form CPQ (CPQ-12) with similar properties but 21 fewer questions. The CPQ and CPQ-12 are useful tools to gauge computer proficiency for training and research purposes, even among low computer proficient older adults. © The Author 2013. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Data structures, computer graphics, and pattern recognition

CERN Document Server

Klinger, A; Kunii, T L

1977-01-01

Data Structures, Computer Graphics, and Pattern Recognition focuses on the computer graphics and pattern recognition applications of data structures methodology.This book presents design related principles and research aspects of the computer graphics, system design, data management, and pattern recognition tasks. The topics include the data structure design, concise structuring of geometric data for computer aided design, and data structures for pattern recognition algorithms. The survey of data structures for computer graphics systems, application of relational data structures in computer gr

Transportation Research & Analysis Computing Center

Data.gov (United States)

Federal Laboratory Consortium — The technical objectives of the TRACC project included the establishment of a high performance computing center for use by USDOT research teams, including those from...

A Look at Computer-Assisted Testing Operations. The Illinois Series on Educational Application of Computers, No. 12e.

Science.gov (United States)

Muiznieks, Viktors; Dennis, J. Richard

In computer assisted test construction (CATC) systems, the computer is used to perform the mechanical aspects of testing while the teacher retains control over question content. Advantages of CATC systems include question banks, decreased importance of test item security, computer analysis and response to student test answers, item analysis…

Second International Conference on Advanced Computing, Networking and Informatics

CERN Document Server

Mohapatra, Durga; Konar, Amit; Chakraborty, Aruna

2014-01-01

Advanced Computing, Networking and Informatics are three distinct and mutually exclusive disciplines of knowledge with no apparent sharing/overlap among them. However, their convergence is observed in many real world applications, including cyber-security, internet banking, healthcare, sensor networks, cognitive radio, pervasive computing amidst many others. This two-volume proceedings explore the combined use of Advanced Computing and Informatics in the next generation wireless networks and security, signal and image processing, ontology and human-computer interfaces (HCI). The two volumes together include 148 scholarly papers, which have been accepted for presentation from over 640 submissions in the second International Conference on Advanced Computing, Networking and Informatics, 2014, held in Kolkata, India during June 24-26, 2014. The first volume includes innovative computing techniques and relevant research results in informatics with selective applications in pattern recognition, signal/image process...

4th World Conference on Soft Computing

CERN Document Server

Abbasov, Ali; Yager, Ronald; Shahbazova, Shahnaz; Reformat, Marek

2016-01-01

This book reports on advanced theories and cutting-edge applications in the field of soft computing. The individual chapters, written by leading researchers, are based on contributions presented during the 4th World Conference on Soft Computing, held May 25-27, 2014, in Berkeley. The book covers a wealth of key topics in soft computing, focusing on both fundamental aspects and applications. The former include fuzzy mathematics, type-2 fuzzy sets, evolutionary-based optimization, aggregation and neural networks, while the latter include soft computing in data analysis, image processing, decision-making, classification, series prediction, economics, control, and modeling. By providing readers with a timely, authoritative view on the field, and by discussing thought-provoking developments and challenges, the book will foster new research directions in the diverse areas of soft computing. .

Engineering and Computing Portal to Solve Environmental Problems

Science.gov (United States)

Gudov, A. M.; Zavozkin, S. Y.; Sotnikov, I. Y.

2018-01-01

This paper describes architecture and services of the Engineering and Computing Portal, which is considered to be a complex solution that provides access to high-performance computing resources, enables to carry out computational experiments, teach parallel technologies and solve computing tasks, including technogenic safety ones.

Computational anatomy based on whole body imaging basic principles of computer-assisted diagnosis and therapy

CERN Document Server

Masutani, Yoshitaka

2017-01-01

This book deals with computational anatomy, an emerging discipline recognized in medical science as a derivative of conventional anatomy. It is also a completely new research area on the boundaries of several sciences and technologies, such as medical imaging, computer vision, and applied mathematics. Computational Anatomy Based on Whole Body Imaging highlights the underlying principles, basic theories, and fundamental techniques in computational anatomy, which are derived from conventional anatomy, medical imaging, computer vision, and applied mathematics, in addition to various examples of applications in clinical data. The book will cover topics on the basics and applications of the new discipline. Drawing from areas in multidisciplinary fields, it provides comprehensive, integrated coverage of innovative approaches to computational anatomy. As well,Computational Anatomy Based on Whole Body Imaging serves as a valuable resource for researchers including graduate students in the field and a connection with ...

47 CFR 32.2124 - General purpose computers.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false General purpose computers. 32.2124 Section 32... General purpose computers. (a) This account shall include the original cost of computers and peripheral... financial, statistical, or other business analytical reports; preparation of payroll, customer bills, and...

Computer applications in radiation protection

International Nuclear Information System (INIS)

Cole, P.R.; Moores, B.M.

1995-01-01

Computer applications in general and diagnostic radiology in particular are becoming more widespread. Their application to the field of radiation protection in medical imaging, including quality control initiatives, is similarly becoming more widespread. Advances in computer technology have enabled departments of diagnostic radiology to have access to powerful yet affordable personal computers. The application of databases, expert systems and computer-based learning is under way. The executive information systems for the management of dose and QA data that are under way at IRS are discussed. An important consideration in developing these pragmatic software tools has been the range of computer literacy within the end user group. Using interfaces have been specifically designed to reflect the requirements of many end users who will have little or no computer knowledge. (Author)

Heterogeneous compute in computer vision: OpenCL in OpenCV

Science.gov (United States)

Gasparakis, Harris

2014-02-01

We explore the relevance of Heterogeneous System Architecture (HSA) in Computer Vision, both as a long term vision, and as a near term emerging reality via the recently ratified OpenCL 2.0 Khronos standard. After a brief review of OpenCL 1.2 and 2.0, including HSA features such as Shared Virtual Memory (SVM) and platform atomics, we identify what genres of Computer Vision workloads stand to benefit by leveraging those features, and we suggest a new mental framework that replaces GPU compute with hybrid HSA APU compute. As a case in point, we discuss, in some detail, popular object recognition algorithms (part-based models), emphasizing the interplay and concurrent collaboration between the GPU and CPU. We conclude by describing how OpenCL has been incorporated in OpenCV, a popular open source computer vision library, emphasizing recent work on the Transparent API, to appear in OpenCV 3.0, which unifies the native CPU and OpenCL execution paths under a single API, allowing the same code to execute either on CPU or on a OpenCL enabled device, without even recompiling.

Factors Influencing Organization Adoption Decision On Cloud Computing

OpenAIRE

Ailar Rahimli

2013-01-01

Cloud computing is a developing field, using by organization that require to computing resource to provide the organizational computing needs. The goal of this research is evaluate the factors that influence on organization decision to adopt the cloud computing in Malaysia. Factors that relate to cloud computing adoption that include : need for cloud computing, cost effectiveness, security effectiveness of cloud computing and reliability. This paper evaluated the factors that influence on ado...

Distributed Problem Solving: Adaptive Networks with a Computer Intermediary Resource. Intelligent Executive Computer Communication

Science.gov (United States)

1991-06-01

Proceedings of The National Conference on Artificial Intelligence , pages 181-184, The American Association for Aritificial Intelligence , Pittsburgh...Intermediary Resource: Intelligent Executive Computer Communication John Lyman and Carla J. Conaway University of California at Los Angeles for Contracting...Include Security Classification) Interim Report: Distributed Problem Solving: Adaptive Networks With a Computer Intermediary Resource: Intelligent

Advances in soft computing, intelligent robotics and control

CERN Document Server

Fullér, Robert

2014-01-01

Soft computing, intelligent robotics and control are in the core interest of contemporary engineering. Essential characteristics of soft computing methods are the ability to handle vague information, to apply human-like reasoning, their learning capability, and ease of application. Soft computing techniques are widely applied in the control of dynamic systems, including mobile robots. The present volume is a collection of 20 chapters written by respectable experts of the fields, addressing various theoretical and practical aspects in soft computing, intelligent robotics and control. The first part of the book concerns with issues of intelligent robotics, including robust xed point transformation design, experimental verification of the input-output feedback linearization of differentially driven mobile robot and applying kinematic synthesis to micro electro-mechanical systems design. The second part of the book is devoted to fundamental aspects of soft computing. This includes practical aspects of fuzzy rule ...

Introduction to electronic analogue computers

CERN Document Server

Wass, C A A

1965-01-01

Introduction to Electronic Analogue Computers, Second Revised Edition is based on the ideas and experience of a group of workers at the Royal Aircraft Establishment, Farnborough, Hants. This edition is almost entirely the work of Mr. K. C. Garner, of the College of Aeronautics, Cranfield. As various advances have been made in the technology involving electronic analogue computers, this book presents discussions on the said progress, including some acquaintance with the capabilities of electronic circuits and equipment. This text also provides a mathematical background including simple differen

Nonlinear equilibrium in Tokamaks including convective terms and viscosity

International Nuclear Information System (INIS)

Martin, P.; Castro, E.; Puerta, J.

2003-01-01

MHD equilibrium in tokamaks becomes very complex, when the non-linear convective term and viscosity are included in the momentum equation. In order to simplify the analysis, each new term has been separated in type gradient terms and vorticity depending terms. For the special case in which the vorticity vanishes, an extended Grad-Shafranov type equation can be obtained. However now the magnetic surface is not isobars or current surfaces as in the usual Grad-Shafranov treatment. The non-linear convective terms introduces gradient of Bernoulli type kinetic terms . Montgomery and other authors have shown the importance of the viscosity terms in tokamaks [1,2], here the treatment is carried out for the equilibrium condition, including generalized tokamaks coordinates recently described [3], which simplify the equilibrium analysis. Calculation of the new isobar surfaces is difficult and some computation have been carried out elsewhere for some particular cases [3]. Here, our analysis is extended discussing how the toroidal current density, plasma pressure and toroidal field are modified across the midplane because of the new terms (convective and viscous). New calculations and computations are also presented. (Author)

Medical image computing and computer-assisted intervention - MICCAI 2005. Proceedings; Pt. 1

International Nuclear Information System (INIS)

Duncan, J.S.; Gerig, G.

2005-01-01

The two-volume set LNCS 3749 and LNCS 3750 constitutes the refereed proceedings of the 8th International Conference on Medical Image Computing and Computer-Assisted Intervention, MICCAI 2005, held in Palm Springs, CA, USA, in October 2005. Based on rigorous peer reviews the program committee selected 237 carefully revised full papers from 632 submissions for presentation in two volumes. The first volume includes all the contributions related to image analysis and validation, vascular image segmentation, image registration, diffusion tensor image analysis, image segmentation and analysis, clinical applications - validation, imaging systems - visualization, computer assisted diagnosis, cellular and molecular image analysis, physically-based modeling, robotics and intervention, medical image computing for clinical applications, and biological imaging - simulation and modeling. The second volume collects the papers related to robotics, image-guided surgery and interventions, image registration, medical image computing, structural and functional brain analysis, model-based image analysis, image-guided intervention: simulation, modeling and display, and image segmentation and analysis. (orig.)

Medical image computing and computer science intervention. MICCAI 2005. Pt. 2. Proceedings

International Nuclear Information System (INIS)

Duncan, J.S.; Yale Univ., New Haven, CT; Gerig, G.

2005-01-01

The two-volume set LNCS 3749 and LNCS 3750 constitutes the refereed proceedings of the 8th International Conference on Medical Image Computing and Computer-Assisted Intervention, MICCAI 2005, held in Palm Springs, CA, USA, in October 2005. Based on rigorous peer reviews the program committee selected 237 carefully revised full papers from 632 submissions for presentation in two volumes. The first volume includes all the contributions related to image analysis and validation, vascular image segmentation, image registration, diffusion tensor image analysis, image segmentation and analysis, clinical applications - validation, imaging systems - visualization, computer assisted diagnosis, cellular and molecular image analysis, physically-based modeling, robotics and intervention, medical image computing for clinical applications, and biological imaging - simulation and modeling. The second volume collects the papers related to robotics, image-guided surgery and interventions, image registration, medical image computing, structural and functional brain analysis, model-based image analysis, image-guided intervention: simulation, modeling and display, and image segmentation and analysis. (orig.)

Medical image computing and computer-assisted intervention - MICCAI 2005. Proceedings; Pt. 1

Energy Technology Data Exchange (ETDEWEB)

Duncan, J.S. [Yale Univ., New Haven, CT (United States). Dept. of Biomedical Engineering and Diagnostic Radiology; Gerig, G. (eds.) [North Carolina Univ., Chapel Hill (United States). Dept. of Computer Science

2005-07-01

The two-volume set LNCS 3749 and LNCS 3750 constitutes the refereed proceedings of the 8th International Conference on Medical Image Computing and Computer-Assisted Intervention, MICCAI 2005, held in Palm Springs, CA, USA, in October 2005. Based on rigorous peer reviews the program committee selected 237 carefully revised full papers from 632 submissions for presentation in two volumes. The first volume includes all the contributions related to image analysis and validation, vascular image segmentation, image registration, diffusion tensor image analysis, image segmentation and analysis, clinical applications - validation, imaging systems - visualization, computer assisted diagnosis, cellular and molecular image analysis, physically-based modeling, robotics and intervention, medical image computing for clinical applications, and biological imaging - simulation and modeling. The second volume collects the papers related to robotics, image-guided surgery and interventions, image registration, medical image computing, structural and functional brain analysis, model-based image analysis, image-guided intervention: simulation, modeling and display, and image segmentation and analysis. (orig.)

Medical image computing and computer science intervention. MICCAI 2005. Pt. 2. Proceedings

Energy Technology Data Exchange (ETDEWEB)

Duncan, J.S. [Yale Univ., New Haven, CT (United States). Dept. of Biomedical Engineering]|[Yale Univ., New Haven, CT (United States). Dept. of Diagnostic Radiology; Gerig, G. (eds.) [North Carolina Univ., Chapel Hill, NC (United States). Dept. of Computer Science

2005-07-01

The two-volume set LNCS 3749 and LNCS 3750 constitutes the refereed proceedings of the 8th International Conference on Medical Image Computing and Computer-Assisted Intervention, MICCAI 2005, held in Palm Springs, CA, USA, in October 2005. Based on rigorous peer reviews the program committee selected 237 carefully revised full papers from 632 submissions for presentation in two volumes. The first volume includes all the contributions related to image analysis and validation, vascular image segmentation, image registration, diffusion tensor image analysis, image segmentation and analysis, clinical applications - validation, imaging systems - visualization, computer assisted diagnosis, cellular and molecular image analysis, physically-based modeling, robotics and intervention, medical image computing for clinical applications, and biological imaging - simulation and modeling. The second volume collects the papers related to robotics, image-guided surgery and interventions, image registration, medical image computing, structural and functional brain analysis, model-based image analysis, image-guided intervention: simulation, modeling and display, and image segmentation and analysis. (orig.)

Workshop on Computational Optimization

CERN Document Server

2016-01-01

This volume is a comprehensive collection of extended contributions from the Workshop on Computational Optimization 2014, held at Warsaw, Poland, September 7-10, 2014. The book presents recent advances in computational optimization. The volume includes important real problems like parameter settings for controlling processes in bioreactor and other processes, resource constrained project scheduling, infection distribution, molecule distance geometry, quantum computing, real-time management and optimal control, bin packing, medical image processing, localization the abrupt atmospheric contamination source and so on. It shows how to develop algorithms for them based on new metaheuristic methods like evolutionary computation, ant colony optimization, constrain programming and others. This research demonstrates how some real-world problems arising in engineering, economics, medicine and other domains can be formulated as optimization tasks.

GPU computing and applications

CERN Document Server

See, Simon

2015-01-01

This book presents a collection of state of the art research on GPU Computing and Application. The major part of this book is selected from the work presented at the 2013 Symposium on GPU Computing and Applications held in Nanyang Technological University, Singapore (Oct 9, 2013). Three major domains of GPU application are covered in the book including (1) Engineering design and simulation; (2) Biomedical Sciences; and (3) Interactive & Digital Media. The book also addresses the fundamental issues in GPU computing with a focus on big data processing. Researchers and developers in GPU Computing and Applications will benefit from this book. Training professionals and educators can also benefit from this book to learn the possible application of GPU technology in various areas.

High-performance computing using FPGAs

CERN Document Server

Benkrid, Khaled

2013-01-01

This book is concerned with the emerging field of High Performance Reconfigurable Computing (HPRC), which aims to harness the high performance and relative low power of reconfigurable hardware–in the form Field Programmable Gate Arrays (FPGAs)–in High Performance Computing (HPC) applications. It presents the latest developments in this field from applications, architecture, and tools and methodologies points of view. We hope that this work will form a reference for existing researchers in the field, and entice new researchers and developers to join the HPRC community.  The book includes:  Thirteen application chapters which present the most important application areas tackled by high performance reconfigurable computers, namely: financial computing, bioinformatics and computational biology, data search and processing, stencil computation e.g. computational fluid dynamics and seismic modeling, cryptanalysis, astronomical N-body simulation, and circuit simulation.     Seven architecture chapters which...

78 FR 16865 - Certain Electronic Devices, Including Wireless Communication Devices, Portable Music and Data...

Science.gov (United States)

2013-03-19

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-794] Certain Electronic Devices, Including Wireless Communication Devices, Portable Music and Data Processing Devices, and Tablet Computers... certain electronic devices, including wireless communication devices, portable music and data processing...

MOS modeling hierarchy including radiation effects

International Nuclear Information System (INIS)

Alexander, D.R.; Turfler, R.M.

1975-01-01

A hierarchy of modeling procedures has been developed for MOS transistors, circuit blocks, and integrated circuits which include the effects of total dose radiation and photocurrent response. The models were developed for use with the SCEPTRE circuit analysis program, but the techniques are suitable for other modern computer aided analysis programs. The modeling hierarchy permits the designer or analyst to select the level of modeling complexity consistent with circuit size, parametric information, and accuracy requirements. Improvements have been made in the implementation of important second order effects in the transistor MOS model, in the definition of MOS building block models, and in the development of composite terminal models for MOS integrated circuits

Computer facilities for ISABELLE data handling

International Nuclear Information System (INIS)

Kramer, M.A.; Love, W.A.; Miller, R.J.; Zeller, M.

1977-01-01

The analysis of data produced by ISABELLE experiments will need a large system of computers. An official group of prospective users and operators of that system should begin planning now. Included in the array will be a substantial computer system at each ISABELLE intersection in use. These systems must include enough computer power to keep experimenters aware of the health of the experiment. This will require at least one very fast sophisticated processor in the system, the size depending on the experiment. Other features of the intersection systems must be a good, high speed graphic display, ability to record data on magnetic tape at 500 to 1000 KB, and a high speed link to a central computer. The operating system software must support multiple interactive users. A substantially larger capacity computer system, shared by the six intersection region experiments, must be available with good turnaround for experimenters while ISABELLE is running. A computer support group will be required to maintain the computer system and to provide and maintain software common to all experiments. Special superfast computing hardware or special function processors constructed with microprocessor circuitry may be necessary both in the data gathering and data processing work. Thus both the local and central processors should be chosen with the possibility of interfacing such devices in mind

Programming Unconventional Computers: Dynamics, Development, Self-Reference

Directory of Open Access Journals (Sweden)

Susan Stepney

2012-10-01

Full Text Available Classical computing has well-established formalisms for specifying, refining, composing, proving, and otherwise reasoning about computations. These formalisms have matured over the past 70 years or so. Unconventional Computing includes the use of novel kinds of substrates–from black holes and quantum effects, through to chemicals, biomolecules, even slime moulds–to perform computations that do not conform to the classical model. Although many of these unconventional substrates can be coerced into performing classical computation, this is not how they “naturally” compute. Our ability to exploit unconventional computing is partly hampered by a lack of corresponding programming formalisms: we need models for building, composing, and reasoning about programs that execute in these substrates. What might, say, a slime mould programming language look like? Here I outline some of the issues and properties of these unconventional substrates that need to be addressed to find “natural” approaches to programming them. Important concepts include embodied real values, processes and dynamical systems, generative systems and their meta-dynamics, and embodied self-reference.

Quantum computing from the ground up

CERN Document Server

Perry, Riley Tipton

2012-01-01

Quantum computing - the application of quantum mechanics to information - represents a fundamental break from classical information and promises to dramatically increase a computer's power. Many difficult problems, such as the factorization of large numbers, have so far resisted attack by classical computers yet are easily solved with quantum computers. If they become feasible, quantum computers will end standard practices such as RSA encryption. Most of the books or papers on quantum computing require (or assume) prior knowledge of certain areas such as linear algebra or quantum mechanics. The majority of the currently-available literature is hard to understand for the average computer enthusiast or interested layman. This text attempts to teach quantum computing from the ground up in an easily readable way, providing a comprehensive tutorial that includes all the necessary mathematics, computer science and physics.

Controlling Laboratory Processes From A Personal Computer

Science.gov (United States)

Will, H.; Mackin, M. A.

1991-01-01

Computer program provides natural-language process control from IBM PC or compatible computer. Sets up process-control system that either runs without operator or run by workers who have limited programming skills. Includes three smaller programs. Two of them, written in FORTRAN 77, record data and control research processes. Third program, written in Pascal, generates FORTRAN subroutines used by other two programs to identify user commands with device-driving routines written by user. Also includes set of input data allowing user to define user commands to be executed by computer. Requires personal computer operating under MS-DOS with suitable hardware interfaces to all controlled devices. Also requires FORTRAN 77 compiler and device drivers written by user.

ATLAS distributed computing: experience and evolution

International Nuclear Information System (INIS)

Nairz, A

2014-01-01

The ATLAS experiment has just concluded its first running period which commenced in 2010. After two years of remarkable performance from the LHC and ATLAS, the experiment has accumulated more than 25 fb −1 of data. The total volume of beam and simulated data products exceeds 100 PB distributed across more than 150 computing centres around the world, managed by the experiment's distributed data management system. These sites have provided up to 150,000 computing cores to ATLAS's global production and analysis processing system, enabling a rich physics programme including the discovery of the Higgs-like boson in 2012. The wealth of accumulated experience in global data-intensive computing at this massive scale, and the considerably more challenging requirements of LHC computing from 2015 when the LHC resumes operation, are driving a comprehensive design and development cycle to prepare a revised computing model together with data processing and management systems able to meet the demands of higher trigger rates, energies and event complexities. An essential requirement will be the efficient utilisation of current and future processor technologies as well as a broad range of computing platforms, including supercomputing and cloud resources. We will report on experience gained thus far and our progress in preparing ATLAS computing for the future

40 CFR 194.23 - Models and computer codes.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Models and computer codes. 194.23... General Requirements § 194.23 Models and computer codes. (a) Any compliance application shall include: (1... obtain stable solutions; (iv) Computer models accurately implement the numerical models; i.e., computer...

29 CFR 541.401 - Computer manufacture and repair.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Computer manufacture and repair. 541.401 Section 541.401... SALES EMPLOYEES Computer Employees § 541.401 Computer manufacture and repair. The exemption for employees in computer occupations does not include employees engaged in the manufacture or repair of...

Parallelism in matrix computations

CERN Document Server

Gallopoulos, Efstratios; Sameh, Ahmed H

2016-01-01

This book is primarily intended as a research monograph that could also be used in graduate courses for the design of parallel algorithms in matrix computations. It assumes general but not extensive knowledge of numerical linear algebra, parallel architectures, and parallel programming paradigms. The book consists of four parts: (I) Basics; (II) Dense and Special Matrix Computations; (III) Sparse Matrix Computations; and (IV) Matrix functions and characteristics. Part I deals with parallel programming paradigms and fundamental kernels, including reordering schemes for sparse matrices. Part II is devoted to dense matrix computations such as parallel algorithms for solving linear systems, linear least squares, the symmetric algebraic eigenvalue problem, and the singular-value decomposition. It also deals with the development of parallel algorithms for special linear systems such as banded ,Vandermonde ,Toeplitz ,and block Toeplitz systems. Part III addresses sparse matrix computations: (a) the development of pa...

Processing Optimization of Typed Resources with Synchronized Storage and Computation Adaptation in Fog Computing

Directory of Open Access Journals (Sweden)

Zhengyang Song

2018-01-01

Full Text Available Wide application of the Internet of Things (IoT system has been increasingly demanding more hardware facilities for processing various resources including data, information, and knowledge. With the rapid growth of generated resource quantity, it is difficult to adapt to this situation by using traditional cloud computing models. Fog computing enables storage and computing services to perform at the edge of the network to extend cloud computing. However, there are some problems such as restricted computation, limited storage, and expensive network bandwidth in Fog computing applications. It is a challenge to balance the distribution of network resources. We propose a processing optimization mechanism of typed resources with synchronized storage and computation adaptation in Fog computing. In this mechanism, we process typed resources in a wireless-network-based three-tier architecture consisting of Data Graph, Information Graph, and Knowledge Graph. The proposed mechanism aims to minimize processing cost over network, computation, and storage while maximizing the performance of processing in a business value driven manner. Simulation results show that the proposed approach improves the ratio of performance over user investment. Meanwhile, conversions between resource types deliver support for dynamically allocating network resources.

Mastering cloud computing foundations and applications programming

CERN Document Server

Buyya, Rajkumar; Selvi, SThamarai

2013-01-01

Mastering Cloud Computing is designed for undergraduate students learning to develop cloud computing applications. Tomorrow's applications won't live on a single computer but will be deployed from and reside on a virtual server, accessible anywhere, any time. Tomorrow's application developers need to understand the requirements of building apps for these virtual systems, including concurrent programming, high-performance computing, and data-intensive systems. The book introduces the principles of distributed and parallel computing underlying cloud architectures and specifical

Heterogeneous computing with OpenCL

CERN Document Server

2013-01-01

Heterogeneous Computing with OpenCL teaches OpenCL and parallel programming for complex systems that may include a variety of device architectures: multi-core CPUs, GPUs, and fully-integrated Accelerated Processing Units (APUs) such as AMD Fusion technology. Designed to work on multiple platforms and with wide industry support, OpenCL will help you more effectively program for a heterogeneous future. Written by leaders in the parallel computing and OpenCL communities, this book will give you hands-on OpenCL experience to address a range of fundamental parallel algorithms. The authors explore memory spaces, optimization techniques, graphics interoperability, extensions, and debugging and profiling. Intended to support a parallel programming course, Heterogeneous Computing with OpenCL includes detailed examples throughout, plus additional online exercises and other supporting materials.

Summary Report of Working Group 2: Computation

International Nuclear Information System (INIS)

Stoltz, P. H.; Tsung, R. S.

2009-01-01

The working group on computation addressed three physics areas: (i) plasma-based accelerators (laser-driven and beam-driven), (ii) high gradient structure-based accelerators, and (iii) electron beam sources and transport [1]. Highlights of the talks in these areas included new models of breakdown on the microscopic scale, new three-dimensional multipacting calculations with both finite difference and finite element codes, and detailed comparisons of new electron gun models with standard models such as PARMELA. The group also addressed two areas of advances in computation: (i) new algorithms, including simulation in a Lorentz-boosted frame that can reduce computation time orders of magnitude, and (ii) new hardware architectures, like graphics processing units and Cell processors that promise dramatic increases in computing power. Highlights of the talks in these areas included results from the first large-scale parallel finite element particle-in-cell code (PIC), many order-of-magnitude speedup of, and details of porting the VPIC code to the Roadrunner supercomputer. The working group featured two plenary talks, one by Brian Albright of Los Alamos National Laboratory on the performance of the VPIC code on the Roadrunner supercomputer, and one by David Bruhwiler of Tech-X Corporation on recent advances in computation for advanced accelerators. Highlights of the talk by Albright included the first one trillion particle simulations, a sustained performance of 0.3 petaflops, and an eight times speedup of science calculations, including back-scatter in laser-plasma interaction. Highlights of the talk by Bruhwiler included simulations of 10 GeV accelerator laser wakefield stages including external injection, new developments in electromagnetic simulations of electron guns using finite difference and finite element approaches.

Sixth Computational Biomechanics for Medicine Workshop

CERN Document Server

Nielsen, Poul MF; Miller, Karol; Computational Biomechanics for Medicine : Deformation and Flow

2012-01-01

One of the greatest challenges for mechanical engineers is to extend the success of computational mechanics to fields outside traditional engineering, in particular to biology, biomedical sciences, and medicine. This book is an opportunity for computational biomechanics specialists to present and exchange opinions on the opportunities of applying their techniques to computer-integrated medicine. Computational Biomechanics for Medicine: Deformation and Flow collects the papers from the Sixth Computational Biomechanics for Medicine Workshop held in Toronto in conjunction with the Medical Image Computing and Computer Assisted Intervention conference. The topics covered include: medical image analysis, image-guided surgery, surgical simulation, surgical intervention planning, disease prognosis and diagnostics, injury mechanism analysis, implant and prostheses design, and medical robotics.

From Greeks to Today: Cipher Trees and Computer Cryptography.

Science.gov (United States)

Grady, M. Tim; Brumbaugh, Doug

1988-01-01

Explores the use of computers for teaching mathematical models of transposition ciphers. Illustrates the ideas, includes activities and extensions, provides a mathematical model and includes computer programs to implement these topics. (MVL)

Advanced in Computer Science and its Applications

CERN Document Server

Yen, Neil; Park, James; CSA 2013

2014-01-01

The theme of CSA is focused on the various aspects of computer science and its applications for advances in computer science and its applications and provides an opportunity for academic and industry professionals to discuss the latest issues and progress in the area of computer science and its applications. Therefore this book will be include the various theories and practical applications in computer science and its applications.

Computer-controlled attenuator.

Science.gov (United States)

Mitov, D; Grozev, Z

1991-01-01

Various possibilities for applying electronic computer-controlled attenuators for the automation of physiological experiments are considered. A detailed description is given of the design of a 4-channel computer-controlled attenuator, in two of the channels of which the output signal can change by a linear step, in the other two channels--by a logarithmic step. This, together with the existence of additional programmable timers, allows to automate a wide range of studies in different spheres of physiology and psychophysics, including vision and hearing.

Mesenteric panniculitis: computed tomography aspects

International Nuclear Information System (INIS)

Moreira, Luiza Beatriz Melo; Alves, Jose Ricardo Duarte; Marchiori, Edson; Pinheiro, Ricardo Andrade; Melo, Alessandro Severo Alves de; Noro, Fabio

2001-01-01

Mesenteric panniculitis is an inflammatory process that represents the second stage of a rare progressive disease involving the adipose tissue of the mesentery. Imaging methods used in the diagnosis of mesenteric panniculitis include barium studies, ultrasonography, computed tomography and magnetic resonance imaging. Computed tomography is important for both, diagnosis and evaluation of the extension of the disease and treatment monitoring. Computed tomography findings may vary according to the stage of the disease and the amount of inflammatory material or fibrosis. There is also good correlation between the computed tomography and anatomical pathology findings. The authors studied 10 patients with mesenteric panniculitis submitted to computed tomography. Magnetic resonance imaging was also performed in one patient. In all patients, computed tomography revealed a heterogeneous mass in the mesentery with density of fat, interspersed with areas of soft tissue density and dilated vessels. (author)

GPU Computing Gems Emerald Edition

CERN Document Server

Hwu, Wen-mei W

2011-01-01

".the perfect companion to Programming Massively Parallel Processors by Hwu & Kirk." -Nicolas Pinto, Research Scientist at Harvard & MIT, NVIDIA Fellow 2009-2010 Graphics processing units (GPUs) can do much more than render graphics. Scientists and researchers increasingly look to GPUs to improve the efficiency and performance of computationally-intensive experiments across a range of disciplines. GPU Computing Gems: Emerald Edition brings their techniques to you, showcasing GPU-based solutions including: Black hole simulations with CUDA GPU-accelerated computation and interactive display of

Security and policy driven computing

CERN Document Server

Liu, Lei

2010-01-01

Security and Policy Driven Computing covers recent advances in security, storage, parallelization, and computing as well as applications. The author incorporates a wealth of analysis, including studies on intrusion detection and key management, computer storage policy, and transactional management.The book first describes multiple variables and index structure derivation for high dimensional data distribution and applies numeric methods to proposed search methods. It also focuses on discovering relations, logic, and knowledge for policy management. To manage performance, the text discusses con

Computer Activities for Persons With Dementia.

Science.gov (United States)

Tak, Sunghee H; Zhang, Hongmei; Patel, Hetal; Hong, Song Hee

2015-06-01

The study examined participant's experience and individual characteristics during a 7-week computer activity program for persons with dementia. The descriptive study with mixed methods design collected 612 observational logs of computer sessions from 27 study participants, including individual interviews before and after the program. Quantitative data analysis included descriptive statistics, correlational coefficients, t-test, and chi-square. Content analysis was used to analyze qualitative data. Each participant averaged 23 sessions and 591min for 7 weeks. Computer activities included slide shows with music, games, internet use, and emailing. On average, they had a high score of intensity in engagement per session. Women attended significantly more sessions than men. Higher education level was associated with a higher number of different activities used per session and more time spent on online games. Older participants felt more tired. Feeling tired was significantly correlated with a higher number of weeks with only one session attendance per week. More anticholinergic medications taken by participants were significantly associated with a higher percentage of sessions with disengagement. The findings were significant at p < .05. Qualitative content analysis indicated tailoring computer activities appropriate to individual's needs and functioning is critical. All participants needed technical assistance. A framework for tailoring computer activities may provide guidance on developing and maintaining treatment fidelity of tailored computer activity interventions among persons with dementia. Practice guidelines and education protocols may assist caregivers and service providers to integrate computer activities into homes and aging services settings. © The Author 2015. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

COMPUTATIONAL SCIENCE CENTER

Energy Technology Data Exchange (ETDEWEB)

DAVENPORT, J.

2006-11-01

Computational Science is an integral component of Brookhaven's multi science mission, and is a reflection of the increased role of computation across all of science. Brookhaven currently has major efforts in data storage and analysis for the Relativistic Heavy Ion Collider (RHIC) and the ATLAS detector at CERN, and in quantum chromodynamics. The Laboratory is host for the QCDOC machines (quantum chromodynamics on a chip), 10 teraflop/s computers which boast 12,288 processors each. There are two here, one for the Riken/BNL Research Center and the other supported by DOE for the US Lattice Gauge Community and other scientific users. A 100 teraflop/s supercomputer will be installed at Brookhaven in the coming year, managed jointly by Brookhaven and Stony Brook, and funded by a grant from New York State. This machine will be used for computational science across Brookhaven's entire research program, and also by researchers at Stony Brook and across New York State. With Stony Brook, Brookhaven has formed the New York Center for Computational Science (NYCCS) as a focal point for interdisciplinary computational science, which is closely linked to Brookhaven's Computational Science Center (CSC). The CSC has established a strong program in computational science, with an emphasis on nanoscale electronic structure and molecular dynamics, accelerator design, computational fluid dynamics, medical imaging, parallel computing and numerical algorithms. We have been an active participant in DOES SciDAC program (Scientific Discovery through Advanced Computing). We are also planning a major expansion in computational biology in keeping with Laboratory initiatives. Additional laboratory initiatives with a dependence on a high level of computation include the development of hydrodynamics models for the interpretation of RHIC data, computational models for the atmospheric transport of aerosols, and models for combustion and for energy utilization. The CSC was formed to

CONFERENCE: Computers and accelerators

Energy Technology Data Exchange (ETDEWEB)

Anon.

1984-01-15

In September of last year a Conference on 'Computers in Accelerator Design and Operation' was held in West Berlin attracting some 160 specialists including many from outside Europe. It was a Europhysics Conference, organized by the Hahn-Meitner Institute with Roman Zelazny as Conference Chairman, postponed from an earlier intended venue in Warsaw. The aim was to bring together specialists in the fields of accelerator design, computer control and accelerator operation.

A programming approach to computability

CERN Document Server

Kfoury, A J; Arbib, Michael A

1982-01-01

Computability theory is at the heart of theoretical computer science. Yet, ironically, many of its basic results were discovered by mathematical logicians prior to the development of the first stored-program computer. As a result, many texts on computability theory strike today's computer science students as far removed from their concerns. To remedy this, we base our approach to computability on the language of while-programs, a lean subset of PASCAL, and postpone consideration of such classic models as Turing machines, string-rewriting systems, and p. -recursive functions till the final chapter. Moreover, we balance the presentation of un solvability results such as the unsolvability of the Halting Problem with a presentation of the positive results of modern programming methodology, including the use of proof rules, and the denotational semantics of programs. Computer science seeks to provide a scientific basis for the study of information processing, the solution of problems by algorithms, and the design ...

48 CFR 952.204-77 - Computer security.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Computer security. 952.204... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-77 Computer security. As prescribed in 904.404(d)(7), the following clause shall be included: Computer Security (AUG 2006) (a...

AGRIS: Description of computer programs

International Nuclear Information System (INIS)

Schmid, H.; Schallaboeck, G.

1976-01-01

The set of computer programs used at the AGRIS (Agricultural Information System) Input Unit at the IAEA, Vienna, Austria to process the AGRIS computer-readable data is described. The processing flow is illustrated. The configuration of the IAEA's computer, a list of error messages generated by the computer, the EBCDIC code table extended for AGRIS and INIS, the AGRIS-6 bit code, the work sheet format, and job control listings are included as appendixes. The programs are written for an IBM 370, model 145, operating system OS or VS, and require a 130K partition. The programming languages are PL/1 (F-compiler) and Assembler

Scientific computing

CERN Document Server

Trangenstein, John A

2017-01-01

This is the third of three volumes providing a comprehensive presentation of the fundamentals of scientific computing. This volume discusses topics that depend more on calculus than linear algebra, in order to prepare the reader for solving differential equations. This book and its companions show how to determine the quality of computational results, and how to measure the relative efficiency of competing methods. Readers learn how to determine the maximum attainable accuracy of algorithms, and how to select the best method for computing problems. This book also discusses programming in several languages, including C++, Fortran and MATLAB. There are 90 examples, 200 exercises, 36 algorithms, 40 interactive JavaScript programs, 91 references to software programs and 1 case study. Topics are introduced with goals, literature references and links to public software. There are descriptions of the current algorithms in GSLIB and MATLAB. This book could be used for a second course in numerical methods, for either ...

Computational Psychiatry

Science.gov (United States)

Wang, Xiao-Jing; Krystal, John H.

2014-01-01

Psychiatric disorders such as autism and schizophrenia arise from abnormalities in brain systems that underlie cognitive, emotional and social functions. The brain is enormously complex and its abundant feedback loops on multiple scales preclude intuitive explication of circuit functions. In close interplay with experiments, theory and computational modeling are essential for understanding how, precisely, neural circuits generate flexible behaviors and their impairments give rise to psychiatric symptoms. This Perspective highlights recent progress in applying computational neuroscience to the study of mental disorders. We outline basic approaches, including identification of core deficits that cut across disease categories, biologically-realistic modeling bridging cellular and synaptic mechanisms with behavior, model-aided diagnosis. The need for new research strategies in psychiatry is urgent. Computational psychiatry potentially provides powerful tools for elucidating pathophysiology that may inform both diagnosis and treatment. To achieve this promise will require investment in cross-disciplinary training and research in this nascent field. PMID:25442941

A Model of Computation for Bit-Level Concurrent Computing and Programming: APEC

Science.gov (United States)

Ajiro, Takashi; Tsuchida, Kensei

A concurrent model of computation and a language based on the model for bit-level operation are useful for developing asynchronous and concurrent programs compositionally, which frequently use bit-level operations. Some examples are programs for video games, hardware emulation (including virtual machines), and signal processing. However, few models and languages are optimized and oriented to bit-level concurrent computation. We previously developed a visual programming language called A-BITS for bit-level concurrent programming. The language is based on a dataflow-like model that computes using processes that provide serial bit-level operations and FIFO buffers connected to them. It can express bit-level computation naturally and develop compositionally. We then devised a concurrent computation model called APEC (Asynchronous Program Elements Connection) for bit-level concurrent computation. This model enables precise and formal expression of the process of computation, and a notion of primitive program elements for controlling and operating can be expressed synthetically. Specifically, the model is based on a notion of uniform primitive processes, called primitives, that have three terminals and four ordered rules at most, as well as on bidirectional communication using vehicles called carriers. A new notion is that a carrier moving between two terminals can briefly express some kinds of computation such as synchronization and bidirectional communication. The model's properties make it most applicable to bit-level computation compositionally, since the uniform computation elements are enough to develop components that have practical functionality. Through future application of the model, our research may enable further research on a base model of fine-grain parallel computer architecture, since the model is suitable for expressing massive concurrency by a network of primitives.

Offline computing and networking

International Nuclear Information System (INIS)

Appel, J.A.; Avery, P.; Chartrand, G.

1985-01-01

This note summarizes the work of the Offline Computing and Networking Group. The report is divided into two sections; the first deals with the computing and networking requirements and the second with the proposed way to satisfy those requirements. In considering the requirements, we have considered two types of computing problems. The first is CPU-intensive activity such as production data analysis (reducing raw data to DST), production Monte Carlo, or engineering calculations. The second is physicist-intensive computing such as program development, hardware design, physics analysis, and detector studies. For both types of computing, we examine a variety of issues. These included a set of quantitative questions: how much CPU power (for turn-around and for through-put), how much memory, mass-storage, bandwidth, and so on. There are also very important qualitative issues: what features must be provided by the operating system, what tools are needed for program design, code management, database management, and for graphics

Computer Registration Becoming Mandatory

CERN Multimedia

2003-01-01

Following the decision by the CERN Management Board (see Weekly Bulletin 38/2003), registration of all computers connected to CERN's network will be enforced and only registered computers will be allowed network access. The implementation has started with the IT buildings, continues with building 40 and the Prevessin site (as of Tuesday 4th November 2003), and will cover the whole of CERN before the end of this year. We therefore recommend strongly that you register all your computers in CERN's network database including all network access cards (Ethernet AND wireless) as soon as possible without waiting for the access restriction to take force. This will allow you accessing the network without interruption and help IT service providers to contact you in case of problems (e.g. security problems, viruses, etc.) Users WITH a CERN computing account register at: http://cern.ch/register/ (CERN Intranet page) Visitors WITHOUT a CERN computing account (e.g. short term visitors) register at: http://cern.ch/regis...

Tools for computational finance

CERN Document Server

Seydel, Rüdiger U

2017-01-01

Computational and numerical methods are used in a number of ways across the field of finance. It is the aim of this book to explain how such methods work in financial engineering. By concentrating on the field of option pricing, a core task of financial engineering and risk analysis, this book explores a wide range of computational tools in a coherent and focused manner and will be of use to anyone working in computational finance. Starting with an introductory chapter that presents the financial and stochastic background, the book goes on to detail computational methods using both stochastic and deterministic approaches. Now in its sixth edition, Tools for Computational Finance has been significantly revised and contains:    Several new parts such as a section on extended applications of tree methods, including multidimensional trees, trinomial trees, and the handling of dividends; Additional material in the field of generating normal variates with acceptance-rejection methods, and on Monte Carlo methods...

Home, Hearth and Computing.

Science.gov (United States)

Seelig, Anita

1982-01-01

Advantages of having children use microcomputers at school and home include learning about sophisticated concepts early in life without a great deal of prodding, playing games that expand knowledge, and becoming literate in computer knowledge needed later in life. Includes comments from parents on their experiences with microcomputers and…

Mathematics, the Computer, and the Impact on Mathematics Education.

Science.gov (United States)

Tooke, D. James

2001-01-01

Discusses the connection between mathematics and the computer; mathematics curriculum; mathematics instruction, including teachers learning to use computers; and the impact of the computer on learning mathematics. (LRW)

Digital Da Vinci computers in the arts and sciences

CERN Document Server

Lee, Newton

2014-01-01

Explores polymathic education through unconventional and creative applications of computer science in the arts and sciences Examines the use of visual computation, 3d printing, social robotics and computer modeling for computational art creation and design Includes contributions from leading researchers and practitioners in computer science, architecture and digital media

Computer Series, 98. Electronics for Scientists: A Computer-Intensive Approach.

Science.gov (United States)

Scheeline, Alexander; Mork, Brian J.

1988-01-01

Reports the design for a principles-before-details presentation of electronics for an instrumental analysis class. Uses computers for data collection and simulations. Requires one semester with two 2.5-hour periods and two lectures per week. Includes lab and lecture syllabi. (MVL)

Computational Modeling of Space Physiology

Science.gov (United States)

Lewandowski, Beth E.; Griffin, Devon W.

2016-01-01

The Digital Astronaut Project (DAP), within NASAs Human Research Program, develops and implements computational modeling for use in the mitigation of human health and performance risks associated with long duration spaceflight. Over the past decade, DAP developed models to provide insights into space flight related changes to the central nervous system, cardiovascular system and the musculoskeletal system. Examples of the models and their applications include biomechanical models applied to advanced exercise device development, bone fracture risk quantification for mission planning, accident investigation, bone health standards development, and occupant protection. The International Space Station (ISS), in its role as a testing ground for long duration spaceflight, has been an important platform for obtaining human spaceflight data. DAP has used preflight, in-flight and post-flight data from short and long duration astronauts for computational model development and validation. Examples include preflight and post-flight bone mineral density data, muscle cross-sectional area, and muscle strength measurements. Results from computational modeling supplement space physiology research by informing experimental design. Using these computational models, DAP personnel can easily identify both important factors associated with a phenomenon and areas where data are lacking. This presentation will provide examples of DAP computational models, the data used in model development and validation, and applications of the model.

An Annotated and Cross-Referenced Bibliography on Computer Security and Access Control in Computer Systems.

Science.gov (United States)

Bergart, Jeffrey G.; And Others

This paper represents a careful study of published works on computer security and access control in computer systems. The study includes a selective annotated bibliography of some eighty-five important published results in the field and, based on these papers, analyzes the state of the art. In annotating these works, the authors try to be…

Computational biology for ageing

Science.gov (United States)

Wieser, Daniela; Papatheodorou, Irene; Ziehm, Matthias; Thornton, Janet M.

2011-01-01

High-throughput genomic and proteomic technologies have generated a wealth of publicly available data on ageing. Easy access to these data, and their computational analysis, is of great importance in order to pinpoint the causes and effects of ageing. Here, we provide a description of the existing databases and computational tools on ageing that are available for researchers. We also describe the computational approaches to data interpretation in the field of ageing including gene expression, comparative and pathway analyses, and highlight the challenges for future developments. We review recent biological insights gained from applying bioinformatics methods to analyse and interpret ageing data in different organisms, tissues and conditions. PMID:21115530

Managing internode data communications for an uninitialized process in a parallel computer

Science.gov (United States)

Archer, Charles J; Blocksome, Michael A; Miller, Douglas R; Parker, Jeffrey J; Ratterman, Joseph D; Smith, Brian E

2014-05-20

A parallel computer includes nodes, each having main memory and a messaging unit (MU). Each MU includes computer memory, which in turn includes, MU message buffers. Each MU message buffer is associated with an uninitialized process on the compute node. In the parallel computer, managing internode data communications for an uninitialized process includes: receiving, by an MU of a compute node, one or more data communications messages in an MU message buffer associated with an uninitialized process on the compute node; determining, by an application agent, that the MU message buffer associated with the uninitialized process is full prior to initialization of the uninitialized process; establishing, by the application agent, a temporary message buffer for the uninitialized process in main computer memory; and moving, by the application agent, data communications messages from the MU message buffer associated with the uninitialized process to the temporary message buffer in main computer memory.

Context-aware computing and self-managing systems

CERN Document Server

Dargie, Waltenegus

2009-01-01

Bringing together an extensively researched area with an emerging research issue, Context-Aware Computing and Self-Managing Systems presents the core contributions of context-aware computing in the development of self-managing systems, including devices, applications, middleware, and networks. The expert contributors reveal the usefulness of context-aware computing in developing autonomous systems that have practical application in the real world.The first chapter of the book identifies features that are common to both context-aware computing and autonomous computing. It offers a basic definit

Nurturing a growing field: Computers & Geosciences

Science.gov (United States)

Mariethoz, Gregoire; Pebesma, Edzer

2017-10-01

Computational issues are becoming increasingly critical for virtually all fields of geoscience. This includes the development of improved algorithms and models, strategies for implementing high-performance computing, or the management and visualization of the large datasets provided by an ever-growing number of environmental sensors. Such issues are central to scientific fields as diverse as geological modeling, Earth observation, geophysics or climatology, to name just a few. Related computational advances, across a range of geoscience disciplines, are the core focus of Computers & Geosciences, which is thus a truly multidisciplinary journal.

Computing angle of arrival of radio signals

Science.gov (United States)

Borchardt, John J.; Steele, David K.

2017-11-07

Various technologies pertaining to computing angle of arrival of radio signals are described. A system that is configured for computing the angle of arrival of a radio signal includes a cylindrical sheath wrapped around a cylindrical object, where the cylindrical sheath acts as a ground plane. The system further includes a plurality of antennas that are positioned about an exterior surface of the cylindrical sheath, and receivers respectively coupled to the antennas. The receivers output measurements pertaining to the radio signal. A processing circuit receives the measurements and computes the angle of arrival of the radio signal based upon the measurements.

Software for computing and annotating genomic ranges.

Science.gov (United States)

Lawrence, Michael; Huber, Wolfgang; Pagès, Hervé; Aboyoun, Patrick; Carlson, Marc; Gentleman, Robert; Morgan, Martin T; Carey, Vincent J

2013-01-01

We describe Bioconductor infrastructure for representing and computing on annotated genomic ranges and integrating genomic data with the statistical computing features of R and its extensions. At the core of the infrastructure are three packages: IRanges, GenomicRanges, and GenomicFeatures. These packages provide scalable data structures for representing annotated ranges on the genome, with special support for transcript structures, read alignments and coverage vectors. Computational facilities include efficient algorithms for overlap and nearest neighbor detection, coverage calculation and other range operations. This infrastructure directly supports more than 80 other Bioconductor packages, including those for sequence analysis, differential expression analysis and visualization.

What do reversible programs compute?

DEFF Research Database (Denmark)

Axelsen, Holger Bock; Glück, Robert

2011-01-01

Reversible computing is the study of computation models that exhibit both forward and backward determinism. Understanding the fundamental properties of such models is not only relevant for reversible programming, but has also been found important in other fields, e.g., bidirectional model...... transformation, program transformations such as inversion, and general static prediction of program properties. Historically, work on reversible computing has focussed on reversible simulations of irreversible computations. Here, we take the viewpoint that the property of reversibility itself should...... are not strictly classically universal, but that they support another notion of universality; we call this RTM-universality. Thus, even though the RTMs are sub-universal in the classical sense, they are powerful enough as to include a self-interpreter. Lifting this to other computation models, we propose r...

Grid computing infrastructure, service, and applications

CERN Document Server

Jie, Wei; Chen, Jinjun

2009-01-01

Offering a comprehensive discussion of advances in grid computing, this book summarizes the concepts, methods, technologies, and applications. It covers topics such as philosophy, middleware, architecture, services, and applications. It also includes technical details to demonstrate how grid computing works in the real world

Visualization Tools for Teaching Computer Security

Science.gov (United States)

Yuan, Xiaohong; Vega, Percy; Qadah, Yaseen; Archer, Ricky; Yu, Huiming; Xu, Jinsheng

2010-01-01

Using animated visualization tools has been an important teaching approach in computer science education. We have developed three visualization and animation tools that demonstrate various information security concepts and actively engage learners. The information security concepts illustrated include: packet sniffer and related computer network…

Theoretical Computer Science

DEFF Research Database (Denmark)

2002-01-01

The proceedings contains 8 papers from the Conference on Theoretical Computer Science. Topics discussed include: query by committee, linear separation and random walks; hardness results for neural network approximation problems; a geometric approach to leveraging weak learners; mind change...

Paraconsistent Computational Logic

DEFF Research Database (Denmark)

Jensen, Andreas Schmidt; Villadsen, Jørgen

2012-01-01

In classical logic everything follows from inconsistency and this makes classical logic problematic in areas of computer science where contradictions seem unavoidable. We describe a many-valued paraconsistent logic, discuss the truth tables and include a small case study....

The Computational Physics Program of the national MFE Computer Center

International Nuclear Information System (INIS)

Mirin, A.A.

1989-01-01

Since June 1974, the MFE Computer Center has been engaged in a significant computational physics effort. The principal objective of the Computational Physics Group is to develop advanced numerical models for the investigation of plasma phenomena and the simulation of present and future magnetic confinement devices. Another major objective of the group is to develop efficient algorithms and programming techniques for current and future generations of supercomputers. The Computational Physics Group has been involved in several areas of fusion research. One main area is the application of Fokker-Planck/quasilinear codes to tokamaks. Another major area is the investigation of resistive magnetohydrodynamics in three dimensions, with applications to tokamaks and compact toroids. A third area is the investigation of kinetic instabilities using a 3-D particle code; this work is often coupled with the task of numerically generating equilibria which model experimental devices. Ways to apply statistical closure approximations to study tokamak-edge plasma turbulence have been under examination, with the hope of being able to explain anomalous transport. Also, we are collaborating in an international effort to evaluate fully three-dimensional linear stability of toroidal devices. In addition to these computational physics studies, the group has developed a number of linear systems solvers for general classes of physics problems and has been making a major effort at ascertaining how to efficiently utilize multiprocessor computers. A summary of these programs are included in this paper. 6 tabs

76 FR 41522 - In the Matter of Certain Electronic Devices, Including Mobile Phones, Mobile Tablets, Portable...

Science.gov (United States)

2011-07-14

... Devices, Including Mobile Phones, Mobile Tablets, Portable Music Players, and Computers, and Components.... 1337, in the importation, sale for importation and sale within the United States after importation of certain mobile phones, mobile tablets, portable music players, and computers. 76 FR 24051 (Apr. 29, 2011...

New trends in networking, computing, e-learning, systems sciences, and engineering

CERN Document Server

Sobh, Tarek

2015-01-01

This book includes a set of rigorously reviewed world-class manuscripts addressing and detailing state-of-the-art research projects in the areas of Computer Science, Informatics, and Systems Sciences, and Engineering. It includes selected papers form the conference proceedings of the Ninth International Joint Conferences on Computer, Information, and Systems Sciences, and Engineering (CISSE 2013). Coverage includes topics in: Industrial Electronics, Technology & Automation, Telecommunications and Networking, Systems, Computing Sciences and Software Engineering, Engineering Education, Instructional Technology, Assessment, and E-learning.  • Provides the latest in a series of books growing out of the International Joint Conferences on Computer, Information, and Systems Sciences, and Engineering; • Includes chapters in the most advanced areas of Computing, Informatics, Systems Sciences, and Engineering; • Accessible to a wide range of readership, including professors, researchers, practitioners and...

Research on cloud computing solutions

Directory of Open Access Journals (Sweden)

Liudvikas Kaklauskas

2015-07-01

Full Text Available Cloud computing can be defined as a new style of computing in which dynamically scala-ble and often virtualized resources are provided as a services over the Internet. Advantages of the cloud computing technology include cost savings, high availability, and easy scalability. Voas and Zhang adapted six phases of computing paradigms, from dummy termi-nals/mainframes, to PCs, networking computing, to grid and cloud computing. There are four types of cloud computing: public cloud, private cloud, hybrid cloud and community. The most common and well-known deployment model is Public Cloud. A Private Cloud is suited for sensitive data, where the customer is dependent on a certain degree of security.According to the different types of services offered, cloud computing can be considered to consist of three layers (services models: IaaS (infrastructure as a service, PaaS (platform as a service, SaaS (software as a service. Main cloud computing solutions: web applications, data hosting, virtualization, database clusters and terminal services. The advantage of cloud com-puting is the ability to virtualize and share resources among different applications with the objective for better server utilization and without a clustering solution, a service may fail at the moment the server crashes.DOI: 10.15181/csat.v2i2.914

Computing for particle physics. Report of the HEPAP subpanel on computer needs for the next decade

International Nuclear Information System (INIS)

1985-08-01

The increasing importance of computation to the future progress in high energy physics is documented. Experimental computing demands are analyzed for the near future (four to ten years). The computer industry's plans for the near term and long term are surveyed as they relate to the solution of high energy physics computing problems. This survey includes large processors and the future role of alternatives to commercial mainframes. The needs for low speed and high speed networking are assessed, and the need for an integrated network for high energy physics is evaluated. Software requirements are analyzed. The role to be played by multiple processor systems is examined. The computing needs associated with elementary particle theory are briefly summarized. Computing needs associated with the Superconducting Super Collider are analyzed. Recommendations are offered for expanding computing capabilities in high energy physics and for networking between the laboratories

Analysis of a Model for Computer Virus Transmission

Directory of Open Access Journals (Sweden)

Peng Qin

2015-01-01

Full Text Available Computer viruses remain a significant threat to computer networks. In this paper, the incorporation of new computers to the network and the removing of old computers from the network are considered. Meanwhile, the computers are equipped with antivirus software on the computer network. The computer virus model is established. Through the analysis of the model, disease-free and endemic equilibrium points are calculated. The stability conditions of the equilibria are derived. To illustrate our theoretical analysis, some numerical simulations are also included. The results provide a theoretical basis to control the spread of computer virus.

Classical and quantum computing with C++ and Java simulations

CERN Document Server

Hardy, Y

2001-01-01

Classical and Quantum computing provides a self-contained, systematic and comprehensive introduction to all the subjects and techniques important in scientific computing. The style and presentation are readily accessible to undergraduates and graduates. A large number of examples, accompanied by complete C++ and Java code wherever possible, cover every topic. Features and benefits: - Comprehensive coverage of the theory with many examples - Topics in classical computing include boolean algebra, gates, circuits, latches, error detection and correction, neural networks, Turing machines, cryptography, genetic algorithms - For the first time, genetic expression programming is presented in a textbook - Topics in quantum computing include mathematical foundations, quantum algorithms, quantum information theory, hardware used in quantum computing This book serves as a textbook for courses in scientific computing and is also very suitable for self-study. Students, professionals and practitioners in computer...

Intelligent Distributed Computing VI : Proceedings of the 6th International Symposium on Intelligent Distributed Computing

CERN Document Server

Badica, Costin; Malgeri, Michele; Unland, Rainer

2013-01-01

This book represents the combined peer-reviewed proceedings of the Sixth International Symposium on Intelligent Distributed Computing -- IDC~2012, of the International Workshop on Agents for Cloud -- A4C~2012 and of the Fourth International Workshop on Multi-Agent Systems Technology and Semantics -- MASTS~2012. All the events were held in Calabria, Italy during September 24-26, 2012. The 37 contributions published in this book address many topics related to theory and applications of intelligent distributed computing and multi-agent systems, including: adaptive and autonomous distributed systems, agent programming, ambient assisted living systems, business process modeling and verification, cloud computing, coalition formation, decision support systems, distributed optimization and constraint satisfaction, gesture recognition, intelligent energy management in WSNs, intelligent logistics, machine learning, mobile agents, parallel and distributed computational intelligence, parallel evolutionary computing, trus...

High Performance Computing in Science and Engineering '15 : Transactions of the High Performance Computing Center

CERN Document Server

Kröner, Dietmar; Resch, Michael

2016-01-01

This book presents the state-of-the-art in supercomputer simulation. It includes the latest findings from leading researchers using systems from the High Performance Computing Center Stuttgart (HLRS) in 2015. The reports cover all fields of computational science and engineering ranging from CFD to computational physics and from chemistry to computer science with a special emphasis on industrially relevant applications. Presenting findings of one of Europe’s leading systems, this volume covers a wide variety of applications that deliver a high level of sustained performance. The book covers the main methods in high-performance computing. Its outstanding results in achieving the best performance for production codes are of particular interest for both scientists and engineers. The book comes with a wealth of color illustrations and tables of results.

High Performance Computing in Science and Engineering '17 : Transactions of the High Performance Computing Center

CERN Document Server

Kröner, Dietmar; Resch, Michael; HLRS 2017

2018-01-01

This book presents the state-of-the-art in supercomputer simulation. It includes the latest findings from leading researchers using systems from the High Performance Computing Center Stuttgart (HLRS) in 2017. The reports cover all fields of computational science and engineering ranging from CFD to computational physics and from chemistry to computer science with a special emphasis on industrially relevant applications. Presenting findings of one of Europe’s leading systems, this volume covers a wide variety of applications that deliver a high level of sustained performance.The book covers the main methods in high-performance computing. Its outstanding results in achieving the best performance for production codes are of particular interest for both scientists and engineers. The book comes with a wealth of color illustrations and tables of results.

Affective Computing and Sentiment Analysis

CERN Document Server

Ahmad, Khurshid

2011-01-01

This volume maps the watershed areas between two 'holy grails' of computer science: the identification and interpretation of affect -- including sentiment and mood. The expression of sentiment and mood involves the use of metaphors, especially in emotive situations. Affect computing is rooted in hermeneutics, philosophy, political science and sociology, and is now a key area of research in computer science. The 24/7 news sites and blogs facilitate the expression and shaping of opinion locally and globally. Sentiment analysis, based on text and data mining, is being used in the looking at news

Discrete and computational geometry

CERN Document Server

Devadoss, Satyan L

2011-01-01

Discrete geometry is a relatively new development in pure mathematics, while computational geometry is an emerging area in applications-driven computer science. Their intermingling has yielded exciting advances in recent years, yet what has been lacking until now is an undergraduate textbook that bridges the gap between the two. Discrete and Computational Geometry offers a comprehensive yet accessible introduction to this cutting-edge frontier of mathematics and computer science. This book covers traditional topics such as convex hulls, triangulations, and Voronoi diagrams, as well as more recent subjects like pseudotriangulations, curve reconstruction, and locked chains. It also touches on more advanced material, including Dehn invariants, associahedra, quasigeodesics, Morse theory, and the recent resolution of the Poincaré conjecture. Connections to real-world applications are made throughout, and algorithms are presented independently of any programming language. This richly illustrated textbook also fe...

Computational neurology and psychiatry

CERN Document Server

Bhattacharya, Basabdatta; Cochran, Amy

2017-01-01

This book presents the latest research in computational methods for modeling and simulating brain disorders. In particular, it shows how mathematical models can be used to study the relationship between a given disorder and the specific brain structure associated with that disorder. It also describes the emerging field of computational psychiatry, including the study of pathological behavior due to impaired functional connectivity, pathophysiological activity, and/or aberrant decision-making. Further, it discusses the data analysis techniques that will be required to analyze the increasing amount of data being generated about the brain. Lastly, the book offers some tips on the application of computational models in the field of quantitative systems pharmacology. Mainly written for computational scientists eager to discover new application fields for their model, this book also benefits neurologists and psychiatrists wanting to learn about new methods.

Encyclopedia of cloud computing

CERN Document Server

Bojanova, Irena

2016-01-01

The Encyclopedia of Cloud Computing provides IT professionals, educators, researchers and students with a compendium of cloud computing knowledge. Authored by a spectrum of subject matter experts in industry and academia, this unique publication, in a single volume, covers a wide range of cloud computing topics, including technological trends and developments, research opportunities, best practices, standards, and cloud adoption. Providing multiple perspectives, it also addresses questions that stakeholders might have in the context of development, operation, management, and use of clouds. Furthermore, it examines cloud computing's impact now and in the future. The encyclopedia presents 56 chapters logically organized into 10 sections. Each chapter covers a major topic/area with cross-references to other chapters and contains tables, illustrations, side-bars as appropriate. Furthermore, each chapter presents its summary at the beginning and backend material, references and additional resources for further i...

Resilient computer system design

CERN Document Server

Castano, Victor

2015-01-01

This book presents a paradigm for designing new generation resilient and evolving computer systems, including their key concepts, elements of supportive theory, methods of analysis and synthesis of ICT with new properties of evolving functioning, as well as implementation schemes and their prototyping. The book explains why new ICT applications require a complete redesign of computer systems to address challenges of extreme reliability, high performance, and power efficiency. The authors present a comprehensive treatment for designing the next generation of computers, especially addressing safety-critical, autonomous, real time, military, banking, and wearable health care systems.   §  Describes design solutions for new computer system - evolving reconfigurable architecture (ERA) that is free from drawbacks inherent in current ICT and related engineering models §  Pursues simplicity, reliability, scalability principles of design implemented through redundancy and re-configurability; targeted for energy-,...

Executing a gather operation on a parallel computer

Science.gov (United States)

Archer, Charles J [Rochester, MN; Ratterman, Joseph D [Rochester, MN

2012-03-20

Methods, apparatus, and computer program products are disclosed for executing a gather operation on a parallel computer according to embodiments of the present invention. Embodiments include configuring, by the logical root, a result buffer or the logical root, the result buffer having positions, each position corresponding to a ranked node in the operational group and for storing contribution data gathered from that ranked node. Embodiments also include repeatedly for each position in the result buffer: determining, by each compute node of an operational group, whether the current position in the result buffer corresponds with the rank of the compute node, if the current position in the result buffer corresponds with the rank of the compute node, contributing, by that compute node, the compute node's contribution data, if the current position in the result buffer does not correspond with the rank of the compute node, contributing, by that compute node, a value of zero for the contribution data, and storing, by the logical root in the current position in the result buffer, results of a bitwise OR operation of all the contribution data by all compute nodes of the operational group for the current position, the results received through the global combining network.

1984 CERN school of computing

International Nuclear Information System (INIS)

1985-01-01

The eighth CERN School of Computing covered subjects mainly related to computing for elementary-particle physics. These proceedings contain written versions of most of the lectures delivered at the School. Notes on the following topics are included: trigger and data-acquisition plans for the LEP experiments; unfolding methods in high-energy physics experiments; Monte Carlo techniques; relational data bases; data networks and open systems; the Newcastle connection; portable operating systems; expert systems; microprocessors - from basic chips to complete systems; algorithms for parallel computers; trends in supercomputers and computational physics; supercomputing and related national projects in Japan; application of VLSI in high-energy physics, and single-user systems. See hints under the relevant topics. (orig./HSI)

Conducting Computer Security Assessments at Nuclear Facilities

International Nuclear Information System (INIS)

2016-06-01

Computer security is increasingly recognized as a key component in nuclear security. As technology advances, it is anticipated that computer and computing systems will be used to an even greater degree in all aspects of plant operations including safety and security systems. A rigorous and comprehensive assessment process can assist in strengthening the effectiveness of the computer security programme. This publication outlines a methodology for conducting computer security assessments at nuclear facilities. The methodology can likewise be easily adapted to provide assessments at facilities with other radioactive materials

Broadcast Copywriting and Computer Assisted Instruction.

Science.gov (United States)

Hagerman, William L.

The teaching of broadcast copywriting can be enhanced by computer assisted instruction, especially in screening students' writing for adherence to classic "formulas" or "rules" for broadcast writing. Such rules might include avoiding cliches or not beginning a sentence with a subordinate clause. Other rules the computer can…

Graphics supercomputer for computational fluid dynamics research

Science.gov (United States)

Liaw, Goang S.

1994-11-01

The objective of this project is to purchase a state-of-the-art graphics supercomputer to improve the Computational Fluid Dynamics (CFD) research capability at Alabama A & M University (AAMU) and to support the Air Force research projects. A cutting-edge graphics supercomputer system, Onyx VTX, from Silicon Graphics Computer Systems (SGI), was purchased and installed. Other equipment including a desktop personal computer, PC-486 DX2 with a built-in 10-BaseT Ethernet card, a 10-BaseT hub, an Apple Laser Printer Select 360, and a notebook computer from Zenith were also purchased. A reading room has been converted to a research computer lab by adding some furniture and an air conditioning unit in order to provide an appropriate working environments for researchers and the purchase equipment. All the purchased equipment were successfully installed and are fully functional. Several research projects, including two existing Air Force projects, are being performed using these facilities.

GRID computing for experimental high energy physics

International Nuclear Information System (INIS)

Moloney, G.R.; Martin, L.; Seviour, E.; Taylor, G.N.; Moorhead, G.F.

2002-01-01

Full text: The Large Hadron Collider (LHC), to be completed at the CERN laboratory in 2006, will generate 11 petabytes of data per year. The processing of this large data stream requires a large, distributed computing infrastructure. A recent innovation in high performance distributed computing, the GRID, has been identified as an important tool in data analysis for the LHC. GRID computing has actual and potential application in many fields which require computationally intensive analysis of large, shared data sets. The Australian experimental High Energy Physics community has formed partnerships with the High Performance Computing community to establish a GRID node at the University of Melbourne. Through Australian membership of the ATLAS experiment at the LHC, Australian researchers have an opportunity to be involved in the European DataGRID project. This presentation will include an introduction to the GRID, and it's application to experimental High Energy Physics. We will present the results of our studies, including participation in the first LHC data challenge

The DIII-D Computing Environment: Characteristics and Recent Changes

International Nuclear Information System (INIS)

McHarg, B.B. Jr.

1999-01-01

The DIII-D tokamak national fusion research facility along with its predecessor Doublet III has been operating for over 21 years. The DIII-D computing environment consists of real-time systems controlling the tokamak, heating systems, and diagnostics, and systems acquiring experimental data from instrumentation; major data analysis server nodes performing short term and long term data access and data analysis; and systems providing mechanisms for remote collaboration and the dissemination of information over the world wide web. Computer systems for the facility have undergone incredible changes over the course of time as the computer industry has changed dramatically. Yet there are certain valuable characteristics of the DIII-D computing environment that have been developed over time and have been maintained to this day. Some of these characteristics include: continuous computer infrastructure improvements, distributed data and data access, computing platform integration, and remote collaborations. These characteristics are being carried forward as well as new characteristics resulting from recent changes which have included: a dedicated storage system and a hierarchical storage management system for raw shot data, various further infrastructure improvements including deployment of Fast Ethernet, the introduction of MDSplus, LSF and common IDL based tools, and improvements to remote collaboration capabilities. This paper will describe this computing environment, important characteristics that over the years have contributed to the success of DIII-D computing systems, and recent changes to computer systems

Utilizing Computer Integration to Assist Nursing

OpenAIRE

Hujcs, Marianne

1990-01-01

As the use of computers in health care continues to increase, methods of using these computers to assist nursing practice are also increasing. This paper describes how integration within a hospital information system (HIS) contributed to the development of a report format and computer generated alerts used by nurses. Discussion also includes how the report and alerts impact those nurses providing bedside care as well as how integration of an HIS creates challenges for nursing.

COMPUTER VISION SYNDROME: A SHORT REVIEW.

OpenAIRE

Sameena; Mohd Inayatullah

2012-01-01

Computers are probably one of the biggest scientific inventions of the modern era, and since then they have become an integral part of our life. The increased usage of computers have lead to variety of ocular symptoms which includ es eye strain, tired eyes, irritation, redness, blurred vision, and diplopia, collectively referred to as Computer Vision Syndrome (CVS). CVS may have a significant impact not only on visual com fort but also occupational productivit...

Computer Graphics for Multimedia and Hypermedia Development.

Science.gov (United States)

Mohler, James L.

1998-01-01

Discusses several theoretical and technical aspects of computer-graphics development that are useful for creating hypermedia and multimedia materials. Topics addressed include primary bitmap attributes in computer graphics, the jigsaw principle, and raster layering. (MSE)

Computer games as a pedagogical tool in education

OpenAIRE

Maher, Ken

1997-01-01

Designing computer based environments is never easy, especially when considering young learners. Traditionally, computer gaming has been seen as lacking in educational value, but rating highly in satisfaction and motivation. The objective of this dissertation is to look at elements of computer based learning and to ascertain how computer games can be included as a means of improving learning. Various theories are drawn together from psychology, instructional technology and computer gaming, to...

Method and computer program product for maintenance and modernization backlogging

Science.gov (United States)

Mattimore, Bernard G; Reynolds, Paul E; Farrell, Jill M

2013-02-19

According to one embodiment, a computer program product for determining future facility conditions includes a computer readable medium having computer readable program code stored therein. The computer readable program code includes computer readable program code for calculating a time period specific maintenance cost, for calculating a time period specific modernization factor, and for calculating a time period specific backlog factor. Future facility conditions equal the time period specific maintenance cost plus the time period specific modernization factor plus the time period specific backlog factor. In another embodiment, a computer-implemented method for calculating future facility conditions includes calculating a time period specific maintenance cost, calculating a time period specific modernization factor, and calculating a time period specific backlog factor. Future facility conditions equal the time period specific maintenance cost plus the time period specific modernization factor plus the time period specific backlog factor. Other embodiments are also presented.

Image matrix processor for fast multi-dimensional computations

Science.gov (United States)

Roberson, George P.; Skeate, Michael F.

1996-01-01

An apparatus for multi-dimensional computation which comprises a computation engine, including a plurality of processing modules. The processing modules are configured in parallel and compute respective contributions to a computed multi-dimensional image of respective two dimensional data sets. A high-speed, parallel access storage system is provided which stores the multi-dimensional data sets, and a switching circuit routes the data among the processing modules in the computation engine and the storage system. A data acquisition port receives the two dimensional data sets representing projections through an image, for reconstruction algorithms such as encountered in computerized tomography. The processing modules include a programmable local host, by which they may be configured to execute a plurality of different types of multi-dimensional algorithms. The processing modules thus include an image manipulation processor, which includes a source cache, a target cache, a coefficient table, and control software for executing image transformation routines using data in the source cache and the coefficient table and loading resulting data in the target cache. The local host processor operates to load the source cache with a two dimensional data set, loads the coefficient table, and transfers resulting data out of the target cache to the storage system, or to another destination.

Computer architecture a quantitative approach

CERN Document Server

Hennessy, John L

2019-01-01

Computer Architecture: A Quantitative Approach, Sixth Edition has been considered essential reading by instructors, students and practitioners of computer design for over 20 years. The sixth edition of this classic textbook is fully revised with the latest developments in processor and system architecture. It now features examples from the RISC-V (RISC Five) instruction set architecture, a modern RISC instruction set developed and designed to be a free and openly adoptable standard. It also includes a new chapter on domain-specific architectures and an updated chapter on warehouse-scale computing that features the first public information on Google's newest WSC. True to its original mission of demystifying computer architecture, this edition continues the longstanding tradition of focusing on areas where the most exciting computing innovation is happening, while always keeping an emphasis on good engineering design.

User perspectives on computer applications

International Nuclear Information System (INIS)

Trammell, H.E.

1979-04-01

Experiences of a technical group that uses the services of computer centers are recounted. An orientation on the ORNL Engineering Technology Division and its missions is given to provide background on the diversified efforts undertaken by the Division and its opportunities to benefit from computer technology. Specific ways in which computers are used within the Division are described; these include facility control, data acquisition, data analysis, theory applications, code development, information processing, cost control, management of purchase requisitions, maintenance of personnel information, and control of technical publications. Problem areas found to need improvement are the overloading of computers during normal working hours, lack of code transportability, delay in obtaining routine programming, delay in key punching services, bewilderment in the use of large computer centers, complexity of job control language, and uncertain quality of software. 20 figures

Crystal growth and computational materials science

International Nuclear Information System (INIS)

Jayakumar, S.; Ravindran, P.; Arun Kumar, R.; Sudarshan, C.

2012-01-01

The proceedings of the international conference on advanced materials discusses the advances being made in the area of single crystals, their preparation and device development from these crystals and details of the progress that is taking place in the computational field relating to materials science. Computational materials science makes use of advanced simulation tools and computer interfaces to develop a virtual platform which can provide a model for real-time experiments. This book includes selected papers in topics of crystal growth and computational materials science. We are confident that the new concepts and results presented will stimulate and enhance progress of research on crystal growth and computational materials science. Papers relevant to INIS are indexed separately

47 CFR 32.6124 - General purpose computers expense.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false General purpose computers expense. 32.6124... General purpose computers expense. This account shall include the costs of personnel whose principal job is the physical operation of general purpose computers and the maintenance of operating systems. This...

[Computer technologies in teaching pathological anatomy].

Science.gov (United States)

Ponomarev, A B; Fedorov, D N

2015-01-01

The paper gives experience with personal computers used at the Academician A.L. Strukov Department of Pathological Anatomy for more than 20 years. It shows the objective necessity of introducing computer technologies at all stages of acquiring skills in anatomical pathology, including lectures, students' free work, test check, etc.

Computational problems in engineering

CERN Document Server

Mladenov, Valeri

2014-01-01

This book provides readers with modern computational techniques for solving variety of problems from electrical, mechanical, civil and chemical engineering. Mathematical methods are presented in a unified manner, so they can be applied consistently to problems in applied electromagnetics, strength of materials, fluid mechanics, heat and mass transfer, environmental engineering, biomedical engineering, signal processing, automatic control and more.   • Features contributions from distinguished researchers on significant aspects of current numerical methods and computational mathematics; • Presents actual results and innovative methods that provide numerical solutions, while minimizing computing times; • Includes new and advanced methods and modern variations of known techniques that can solve difficult scientific problems efficiently.  

Introduction to This Special Issue on Context-Aware Computing.

Science.gov (United States)

Moran, Thomas P.; Dourish, Paul

2001-01-01

Discusses pervasive, or ubiquitous, computing; explains the notion of context; and defines context-aware computing as the key to disperse and enmesh computation into our lives. Considers context awareness in human-computer interaction and describes the broad topic areas of the essays included in this special issue. (LRW)

Identification of Learning Processes by Means of Computer Graphics.

Science.gov (United States)

Sorensen, Birgitte Holm

1993-01-01

Describes a development project for the use of computer graphics and video in connection with an inservice training course for primary education teachers in Denmark. Topics addressed include research approaches to computers; computer graphics in learning processes; activities relating to computer graphics; the role of the teacher; and student…

International Conference on Computational Intelligence 2015

CERN Document Server

Saha, Sujan

2017-01-01

This volume comprises the proceedings of the International Conference on Computational Intelligence 2015 (ICCI15). This book aims to bring together work from leading academicians, scientists, researchers and research scholars from across the globe on all aspects of computational intelligence. The work is composed mainly of original and unpublished results of conceptual, constructive, empirical, experimental, or theoretical work in all areas of computational intelligence. Specifically, the major topics covered include classical computational intelligence models and artificial intelligence, neural networks and deep learning, evolutionary swarm and particle algorithms, hybrid systems optimization, constraint programming, human-machine interaction, computational intelligence for the web analytics, robotics, computational neurosciences, neurodynamics, bioinspired and biomorphic algorithms, cross disciplinary topics and applications. The contents of this volume will be of use to researchers and professionals alike....

Computational Elastic Knots

KAUST Repository

Zhao, Xin

2013-05-01

Elastic rods have been studied intensively since the 18th century. Even now the theory of elastic rods is still developing and enjoying popularity in computer graphics and physical-based simulation. Elastic rods also draw attention from architects. Architectural structures, NODUS, were constructed by elastic rods as a new method of form-finding. We study discrete models of elastic rods and NODUS structures. We also develop computational tools to find the equilibria of elastic rods and the shape of NODUS. Applications of elastic rods in forming torus knot and closing Bishop frame are included in this thesis.

Computers and conversation

CERN Document Server

Luff, Paul; Gilbert, Nigel G

1986-01-01

In the past few years a branch of sociology, conversation analysis, has begun to have a significant impact on the design of human*b1computer interaction (HCI). The investigation of human*b1human dialogue has emerged as a fruitful foundation for interactive system design.****This book includes eleven original chapters by leading researchers who are applying conversation analysis to HCI. The fundamentals of conversation analysis are outlined, a number of systems are described, and a critical view of their value for HCI is offered.****Computers and Conversation will be of interest to all concerne

Directory of computer users in nuclear medicine

Energy Technology Data Exchange (ETDEWEB)

Erickson, J.J.; Gurney, J.; McClain, W.J. (eds.)

1979-09-01

The Directory of Computer Users in Nuclear Medicine consists primarily of detailed descriptions and indexes to these descriptions. A typical Installation Description contains the name, address, type, and size of the institution and the names of persons within the institution who can be contacted for further information. If the department has access to a central computer facility for data analysis or timesharing, the type of equipment available and the method of access to that central computer is included. The dedicated data processing equipment used by the department in its nuclear medicine studies is described, including the peripherals, languages used, modes of data collection, and other pertinent information. Following the hardware descriptions are listed the types of studies for which the data processing equipment is used, including the language(s) used, the method of output, and an estimate of the frequency of the particular study. An Installation Index and an Organ Studies Index are also included. (PCS)

Directory of computer users in nuclear medicine

International Nuclear Information System (INIS)

Erickson, J.J.; Gurney, J.; McClain, W.J.

1979-09-01

The Directory of Computer Users in Nuclear Medicine consists primarily of detailed descriptions and indexes to these descriptions. A typical Installation Description contains the name, address, type, and size of the institution and the names of persons within the institution who can be contacted for further information. If the department has access to a central computer facility for data analysis or timesharing, the type of equipment available and the method of access to that central computer is included. The dedicated data processing equipment used by the department in its nuclear medicine studies is described, including the peripherals, languages used, modes of data collection, and other pertinent information. Following the hardware descriptions are listed the types of studies for which the data processing equipment is used, including the language(s) used, the method of output, and an estimate of the frequency of the particular study. An Installation Index and an Organ Studies Index are also included

Software for computing and annotating genomic ranges.

Directory of Open Access Journals (Sweden)

Michael Lawrence

Full Text Available We describe Bioconductor infrastructure for representing and computing on annotated genomic ranges and integrating genomic data with the statistical computing features of R and its extensions. At the core of the infrastructure are three packages: IRanges, GenomicRanges, and GenomicFeatures. These packages provide scalable data structures for representing annotated ranges on the genome, with special support for transcript structures, read alignments and coverage vectors. Computational facilities include efficient algorithms for overlap and nearest neighbor detection, coverage calculation and other range operations. This infrastructure directly supports more than 80 other Bioconductor packages, including those for sequence analysis, differential expression analysis and visualization.

Skills and the appreciation of computer art

Science.gov (United States)

Boden, Margaret A.

2016-04-01

The appreciation of art normally includes recognition of the artist's skills in making it. Most people cannot appreciate computer art in that way, because they know little or nothing about coding. Various suggestions are made about how computer artists and/or curators might design and present computer art in such a way as to make the relevant making-skills more intelligible.

Computer vision for an autonomous mobile robot

CSIR Research Space (South Africa)

Withey, Daniel J

2015-10-01

Full Text Available Computer vision systems are essential for practical, autonomous, mobile robots – machines that employ artificial intelligence and control their own motion within an environment. As with biological systems, computer vision systems include the vision...

SIAM Conference on Computational Science and Engineering

Energy Technology Data Exchange (ETDEWEB)

None, None

2005-08-29

The Second SIAM Conference on Computational Science and Engineering was held in San Diego from February 10-12, 2003. Total conference attendance was 553. This is a 23% increase in attendance over the first conference. The focus of this conference was to draw attention to the tremendous range of major computational efforts on large problems in science and engineering, to promote the interdisciplinary culture required to meet these large-scale challenges, and to encourage the training of the next generation of computational scientists. Computational Science & Engineering (CS&E) is now widely accepted, along with theory and experiment, as a crucial third mode of scientific investigation and engineering design. Aerospace, automotive, biological, chemical, semiconductor, and other industrial sectors now rely on simulation for technical decision support. For federal agencies also, CS&E has become an essential support for decisions on resources, transportation, and defense. CS&E is, by nature, interdisciplinary. It grows out of physical applications and it depends on computer architecture, but at its heart are powerful numerical algorithms and sophisticated computer science techniques. From an applied mathematics perspective, much of CS&E has involved analysis, but the future surely includes optimization and design, especially in the presence of uncertainty. Another mathematical frontier is the assimilation of very large data sets through such techniques as adaptive multi-resolution, automated feature search, and low-dimensional parameterization. The themes of the 2003 conference included, but were not limited to: Advanced Discretization Methods; Computational Biology and Bioinformatics; Computational Chemistry and Chemical Engineering; Computational Earth and Atmospheric Sciences; Computational Electromagnetics; Computational Fluid Dynamics; Computational Medicine and Bioengineering; Computational Physics and Astrophysics; Computational Solid Mechanics and Materials; CS

77 FR 18860 - Certain Consumer Electronics, Including Mobile Phones and Tablets; Notice of Receipt of Complaint...

Science.gov (United States)

2012-03-28

... INTERNATIONAL TRADE COMMISSION [DN 2885] Certain Consumer Electronics, Including Mobile Phones and.... International Trade Commission has received a complaint entitled Certain Consumer Electronics, Including Mobile... electronics, including mobile phones and tablets. The complaint names as respondents ASUSTeK Computer, Inc. of...

Quantum computers: Definition and implementations

International Nuclear Information System (INIS)

Perez-Delgado, Carlos A.; Kok, Pieter

2011-01-01

The DiVincenzo criteria for implementing a quantum computer have been seminal in focusing both experimental and theoretical research in quantum-information processing. These criteria were formulated specifically for the circuit model of quantum computing. However, several new models for quantum computing (paradigms) have been proposed that do not seem to fit the criteria well. Therefore, the question is what are the general criteria for implementing quantum computers. To this end, a formal operational definition of a quantum computer is introduced. It is then shown that, according to this definition, a device is a quantum computer if it obeys the following criteria: Any quantum computer must consist of a quantum memory, with an additional structure that (1) facilitates a controlled quantum evolution of the quantum memory; (2) includes a method for information theoretic cooling of the memory; and (3) provides a readout mechanism for subsets of the quantum memory. The criteria are met when the device is scalable and operates fault tolerantly. We discuss various existing quantum computing paradigms and how they fit within this framework. Finally, we present a decision tree for selecting an avenue toward building a quantum computer. This is intended to help experimentalists determine the most natural paradigm given a particular physical implementation.

Exploiting Virtualization and Cloud Computing in ATLAS

International Nuclear Information System (INIS)

Harald Barreiro Megino, Fernando; Van der Ster, Daniel; Benjamin, Doug; De, Kaushik; Gable, Ian; Paterson, Michael; Taylor, Ryan; Hendrix, Val; Vitillo, Roberto A; Panitkin, Sergey; De Silva, Asoka; Walker, Rod

2012-01-01

The ATLAS Computing Model was designed around the concept of grid computing; since the start of data-taking, this model has proven very successful in the federated operation of more than one hundred Worldwide LHC Computing Grid (WLCG) sites for offline data distribution, storage, processing and analysis. However, new paradigms in computing, namely virtualization and cloud computing, present improved strategies for managing and provisioning IT resources that could allow ATLAS to more flexibly adapt and scale its storage and processing workloads on varied underlying resources. In particular, ATLAS is developing a “grid-of-clouds” infrastructure in order to utilize WLCG sites that make resources available via a cloud API. This work will present the current status of the Virtualization and Cloud Computing R and D project in ATLAS Distributed Computing. First, strategies for deploying PanDA queues on cloud sites will be discussed, including the introduction of a “cloud factory” for managing cloud VM instances. Next, performance results when running on virtualized/cloud resources at CERN LxCloud, StratusLab, and elsewhere will be presented. Finally, we will present the ATLAS strategies for exploiting cloud-based storage, including remote XROOTD access to input data, management of EC2-based files, and the deployment of cloud-resident LCG storage elements.

Cloud Computing Security Issues and Challenges

OpenAIRE

Kuyoro S. O.; Ibikunle F; Awodele O

2011-01-01

Cloud computing is a set of IT services that are provided to a customer over a network on a leased basis and with the ability to scale up or down their service requirements. Usually cloud computing services are delivered by a third party provider who owns the infrastructure. It advantages to mention but a few include scalability, resilience, flexibility, efficiency and outsourcing non-core activities. Cloud computing offers an innovative business model for organizations to adopt IT services w...

Second Annual AEC Scientific Computer Information Exhange Meeting. Proceedings of the technical program theme: computer graphics

Energy Technology Data Exchange (ETDEWEB)

Peskin,A.M.; Shimamoto, Y.

1974-01-01

The topic of computer graphics serves well to illustrate that AEC affiliated scientific computing installations are well represented in the forefront of computing science activities. The participant response to the technical program was overwhelming--both in number of contributions and quality of the work described. Session I, entitled Advanced Systems, contains presentations describing systems that contain features not generally found in graphics facilities. These features can be roughly classified as extensions of standard two-dimensional monochromatic imaging to higher dimensions including color and time as well as multidimensional metrics. Session II presents seven diverse applications ranging from high energy physics to medicine. Session III describes a number of important developments in establishing facilities, techniques and enhancements in the computer graphics area. Although an attempt was made to schedule as many of these worthwhile presentations as possible, it appeared impossible to do so given the scheduling constraints of the meeting. A number of prospective presenters 'came to the rescue' by graciously withdrawing from the sessions. Some of their abstracts have been included in the Proceedings.

Parallel Computing for Brain Simulation.

Science.gov (United States)

Pastur-Romay, L A; Porto-Pazos, A B; Cedron, F; Pazos, A

2017-01-01

The human brain is the most complex system in the known universe, it is therefore one of the greatest mysteries. It provides human beings with extraordinary abilities. However, until now it has not been understood yet how and why most of these abilities are produced. For decades, researchers have been trying to make computers reproduce these abilities, focusing on both understanding the nervous system and, on processing data in a more efficient way than before. Their aim is to make computers process information similarly to the brain. Important technological developments and vast multidisciplinary projects have allowed creating the first simulation with a number of neurons similar to that of a human brain. This paper presents an up-to-date review about the main research projects that are trying to simulate and/or emulate the human brain. They employ different types of computational models using parallel computing: digital models, analog models and hybrid models. This review includes the current applications of these works, as well as future trends. It is focused on various works that look for advanced progress in Neuroscience and still others which seek new discoveries in Computer Science (neuromorphic hardware, machine learning techniques). Their most outstanding characteristics are summarized and the latest advances and future plans are presented. In addition, this review points out the importance of considering not only neurons: Computational models of the brain should also include glial cells, given the proven importance of astrocytes in information processing. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Computer use, sleep duration and health symptoms

DEFF Research Database (Denmark)

Nuutinen, Teija; Roos, Eva; Ray, Carola

2014-01-01

OBJECTIVES: This study investigated whether computer use is associated with health symptoms through sleep duration among 15-year olds in Finland, France and Denmark. METHODS: We used data from the WHO cross-national Health Behaviour in School-aged Children study collected in Finland, France...... and Denmark in 2010, including data on 5,402 adolescents (mean age 15.61 (SD 0.37), girls 53 %). Symptoms assessed included feeling low, irritability/bad temper, nervousness, headache, stomachache, backache, and feeling dizzy. We used structural equation modeling to explore the mediating effect of sleep...... duration on the association between computer use and symptom load. RESULTS: Adolescents slept approximately 8 h a night and computer use was approximately 2 h a day. Computer use was associated with shorter sleep duration and higher symptom load. Sleep duration partly mediated the association between...

Computer Series, 115.

Science.gov (United States)

Birk, James P., Ed.

1990-01-01

Reviewed are six computer programs which may be useful in teaching college level chemistry. Topics include dynamic data storage in FORTRAN, "KC?DISCOVERER," pH of acids and bases, calculating percent boundary surfaces for orbitals, and laboratory interfacing with PT Nomograph for the Macintosh. (CW)

COMPUTATIONAL MODELS FOR SUSTAINABLE DEVELOPMENT

OpenAIRE

Monendra Grover; Rajesh Kumar; Tapan Kumar Mondal; S. Rajkumar

2011-01-01

Genetic erosion is a serious problem and computational models have been developed to prevent it. The computational modeling in this field not only includes (terrestrial) reserve design, but also decision modeling for related problems such as habitat restoration, marine reserve design, and nonreserve approaches to conservation management. Models have been formulated for evaluating tradeoffs between socioeconomic, biophysical, and spatial criteria in establishing marine reserves. The percolatio...

Computer-readable ''Nuclear Data Sheets''

International Nuclear Information System (INIS)

Ewbank, W.B.

1975-01-01

The evaluated nuclear structure data contained in ''Nuclear Data Sheets'' are available in computer-readable form. Experimentally established properties of nuclear levels are included as well as radiations from nuclear reactions and radioactive decay. Portions of the data can be selected for distribution in several formats on magnetic tape or computer cards. A variety of different listing and drawing formats are also available. 4 figures

Guide to Computational Geometry Processing

DEFF Research Database (Denmark)

Bærentzen, Jakob Andreas; Gravesen, Jens; Anton, François

be processed before it is useful. This Guide to Computational Geometry Processing reviews the algorithms for processing geometric data, with a practical focus on important techniques not covered by traditional courses on computer vision and computer graphics. This is balanced with an introduction...... to the theoretical and mathematical underpinnings of each technique, enabling the reader to not only implement a given method, but also to understand the ideas behind it, its limitations and its advantages. Topics and features: Presents an overview of the underlying mathematical theory, covering vector spaces......, metric space, affine spaces, differential geometry, and finite difference methods for derivatives and differential equations Reviews geometry representations, including polygonal meshes, splines, and subdivision surfaces Examines techniques for computing curvature from polygonal meshes Describes...

Patient-Specific Computational Modeling

CERN Document Server

Peña, Estefanía

2012-01-01

This book addresses patient-specific modeling. It integrates computational modeling, experimental procedures, imagine clinical segmentation and mesh generation with the finite element method (FEM) to solve problems in computational biomedicine and bioengineering. Specific areas of interest include cardiovascular problems, ocular and muscular systems and soft tissue modeling. Patient-specific modeling has been the subject of serious research over the last seven years and interest in the area is continually growing and this area is expected to further develop in the near future.

Computational quantum chemistry website

International Nuclear Information System (INIS)

1997-01-01

This report contains the contents of a web page related to research on the development of quantum chemistry methods for computational thermochemistry and the application of quantum chemistry methods to problems in material chemistry and chemical sciences. Research programs highlighted include: Gaussian-2 theory; Density functional theory; Molecular sieve materials; Diamond thin-film growth from buckyball precursors; Electronic structure calculations on lithium polymer electrolytes; Long-distance electronic coupling in donor/acceptor molecules; and Computational studies of NOx reactions in radioactive waste storage

Quantum computers and quantum computations

International Nuclear Information System (INIS)

Valiev, Kamil' A

2005-01-01

This review outlines the principles of operation of quantum computers and their elements. The theory of ideal computers that do not interact with the environment and are immune to quantum decohering processes is presented. Decohering processes in quantum computers are investigated. The review considers methods for correcting quantum computing errors arising from the decoherence of the state of the quantum computer, as well as possible methods for the suppression of the decohering processes. A brief enumeration of proposed quantum computer realizations concludes the review. (reviews of topical problems)

Quantum Computing for Computer Architects

CERN Document Server

Metodi, Tzvetan

2011-01-01

Quantum computers can (in theory) solve certain problems far faster than a classical computer running any known classical algorithm. While existing technologies for building quantum computers are in their infancy, it is not too early to consider their scalability and reliability in the context of the design of large-scale quantum computers. To architect such systems, one must understand what it takes to design and model a balanced, fault-tolerant quantum computer architecture. The goal of this lecture is to provide architectural abstractions for the design of a quantum computer and to explore

Providing full point-to-point communications among compute nodes of an operational group in a global combining network of a parallel computer

Energy Technology Data Exchange (ETDEWEB)

Archer, Charles J.; Faraj, Daniel A.; Inglett, Todd A.; Ratterman, Joseph D.

2018-01-30

Methods, apparatus, and products are disclosed for providing full point-to-point communications among compute nodes of an operational group in a global combining network of a parallel computer, each compute node connected to each adjacent compute node in the global combining network through a link, that include: receiving a network packet in a compute node, the network packet specifying a destination compute node; selecting, in dependence upon the destination compute node, at least one of the links for the compute node along which to forward the network packet toward the destination compute node; and forwarding the network packet along the selected link to the adjacent compute node connected to the compute node through the selected link.

Science and Technology Resources on the Internet: Computer Security.

Science.gov (United States)

Kinkus, Jane F.

2002-01-01

Discusses issues related to computer security, including confidentiality, integrity, and authentication or availability; and presents a selected list of Web sites that cover the basic issues of computer security under subject headings that include ethics, privacy, kids, antivirus, policies, cryptography, operating system security, and biometrics.…

User Participation and Participatory Design: Topics in Computing Education.

Science.gov (United States)

Kautz, Karlheinz

1996-01-01

Discusses user participation and participatory design in the context of formal education for computing professionals. Topics include the current curriculum debate; mathematical- and engineering-based education; traditional system-development training; and an example of a course program that includes computers and society, and prototyping. (53…

Computer Vision Syndrome and Associated Factors Among Medical ...

African Journals Online (AJOL)

among college students the effects of computer use on the eye and vision related problems. ... which included the basic demographic profile, hours of computer use per ..... Male was reported by Costa et al., among call center workers in. Brazil.[17]. Headache .... the use of computer had become universal in higher education.

3-dimensional magnetotelluric inversion including topography using deformed hexahedral edge finite elements and direct solvers parallelized on symmetric multiprocessor computers - Part II: direct data-space inverse solution

Science.gov (United States)

Kordy, M.; Wannamaker, P.; Maris, V.; Cherkaev, E.; Hill, G.

2016-01-01

Following the creation described in Part I of a deformable edge finite-element simulator for 3-D magnetotelluric (MT) responses using direct solvers, in Part II we develop an algorithm named HexMT for 3-D regularized inversion of MT data including topography. Direct solvers parallelized on large-RAM, symmetric multiprocessor (SMP) workstations are used also for the Gauss-Newton model update. By exploiting the data-space approach, the computational cost of the model update becomes much less in both time and computer memory than the cost of the forward simulation. In order to regularize using the second norm of the gradient, we factor the matrix related to the regularization term and apply its inverse to the Jacobian, which is done using the MKL PARDISO library. For dense matrix multiplication and factorization related to the model update, we use the PLASMA library which shows very good scalability across processor cores. A synthetic test inversion using a simple hill model shows that including topography can be important; in this case depression of the electric field by the hill can cause false conductors at depth or mask the presence of resistive structure. With a simple model of two buried bricks, a uniform spatial weighting for the norm of model smoothing recovered more accurate locations for the tomographic images compared to weightings which were a function of parameter Jacobians. We implement joint inversion for static distortion matrices tested using the Dublin secret model 2, for which we are able to reduce nRMS to ˜1.1 while avoiding oscillatory convergence. Finally we test the code on field data by inverting full impedance and tipper MT responses collected around Mount St Helens in the Cascade volcanic chain. Among several prominent structures, the north-south trending, eruption-controlling shear zone is clearly imaged in the inversion.

Solving computationally expensive engineering problems

CERN Document Server

Leifsson, Leifur; Yang, Xin-She

2014-01-01

Computational complexity is a serious bottleneck for the design process in virtually any engineering area. While migration from prototyping and experimental-based design validation to verification using computer simulation models is inevitable and has a number of advantages, high computational costs of accurate, high-fidelity simulations can be a major issue that slows down the development of computer-aided design methodologies, particularly those exploiting automated design improvement procedures, e.g., numerical optimization. The continuous increase of available computational resources does not always translate into shortening of the design cycle because of the growing demand for higher accuracy and necessity to simulate larger and more complex systems. Accurate simulation of a single design of a given system may be as long as several hours, days or even weeks, which often makes design automation using conventional methods impractical or even prohibitive. Additional problems include numerical noise often pr...

Discrete mathematics using a computer

CERN Document Server

Hall, Cordelia

2000-01-01

Several areas of mathematics find application throughout computer science, and all students of computer science need a practical working understanding of them. These core subjects are centred on logic, sets, recursion, induction, relations and functions. The material is often called discrete mathematics, to distinguish it from the traditional topics of continuous mathematics such as integration and differential equations. The central theme of this book is the connection between computing and discrete mathematics. This connection is useful in both directions: • Mathematics is used in many branches of computer science, in applica­ tions including program specification, datastructures,design and analysis of algorithms, database systems, hardware design, reasoning about the correctness of implementations, and much more; • Computers can help to make the mathematics easier to learn and use, by making mathematical terms executable, making abstract concepts more concrete, and through the use of software tools su...

Parameterized algorithmics for computational social choice : nine research challenges

NARCIS (Netherlands)

Bredereck, R.; Chen, J.; Faliszewski, P.; Guo, J.; Niedermeier, R.; Woeginger, G.J.

2014-01-01

Computational Social Choice is an interdisciplinary research area involving Economics, Political Science, and Social Science on the one side, and Mathematics and Computer Science (including Artificial Intelligence and Multiagent Systems) on the other side. Typical computational problems studied in

Computational algorithm for molybdenite concentrate annealing

International Nuclear Information System (INIS)

Alkatseva, V.M.

1995-01-01

Computational algorithm is presented for annealing of molybdenite concentrate with granulated return dust and that of granulated molybdenite concentrate. The algorithm differs from the known analogies for sulphide raw material annealing by including the calculation of return dust mass in stationary annealing; the latter quantity varies form the return dust mass value obtained in the first iteration step. Masses of solid products are determined by distribution of concentrate annealing products, including return dust and benthonite. The algorithm is applied to computations for annealing of other sulphide materials. 3 refs

Intelligent computing systems emerging application areas

CERN Document Server

Virvou, Maria; Jain, Lakhmi

2016-01-01

This book at hand explores emerging scientific and technological areas in which Intelligent Computing Systems provide efficient solutions and, thus, may play a role in the years to come. It demonstrates how Intelligent Computing Systems make use of computational methodologies that mimic nature-inspired processes to address real world problems of high complexity for which exact mathematical solutions, based on physical and statistical modelling, are intractable. Common intelligent computational methodologies are presented including artificial neural networks, evolutionary computation, genetic algorithms, artificial immune systems, fuzzy logic, swarm intelligence, artificial life, virtual worlds and hybrid methodologies based on combinations of the previous. The book will be useful to researchers, practitioners and graduate students dealing with mathematically-intractable problems. It is intended for both the expert/researcher in the field of Intelligent Computing Systems, as well as for the general reader in t...

Diffusion MRI and MR spectroscopy reveal microstructural and metabolic brain alterations in chronic mild stress exposed rats: A CMS recovery study.

Science.gov (United States)

Khan, Ahmad Raza; Hansen, Brian; Wiborg, Ove; Kroenke, Christopher D; Jespersen, Sune Nørhøj

2018-02-15

Chronic mild stress (CMS) induced depression elicits several debilitating symptoms and causes a significant economic burden on society. High variability in the symptomatology of depression poses substantial impediment to accurate diagnosis and therapy outcome. CMS exposure induces significant metabolic and microstructural alterations in the hippocampus (HP), prefrontal cortex (PFC), caudate-putamen (CP) and amygdala (AM), however, recovery from these maladaptive changes are limited and this may provide negative effects on the therapeutic treatment and management of depression. The present study utilized anhedonic rats from the unpredictable CMS model of depression to study metabolic recovery in the ventral hippocampus (vHP) and microstructural recovery in the HP, AM, CP, and PFC. The study employed 1 H MR spectroscopy ( 1 H MRS) and in-vivo diffusion MRI (d-MRI) at the age of week 18 (week 1 post CMS exposure) week 20 (week 3 post CMS) and week 25 (week 8 post CMS exposure) in the anhedonic group, and at the age of week 18 and week 22 in the control group. The d-MRI data have provided an array of diffusion tensor metrics (FA, MD, AD, and RD), and fast kurtosis metrics (MKT, W L and W T ). CMS exposure induced a significant metabolic alteration in vHP, and significant microstructural alterations were observed in the HP, AM, and PFC in comparison to the age match control and within the anhedonic group. A significantly high level of N-acetylaspartate (NAA) was observed in vHP at the age of week 18 in comparison to age match control and week 20 and week 25 of the anhedonic group. HP and AM showed significant microstructural alterations up to the age of week 22 in the anhedonic group. PFC showed significant microstructural alterations only at the age of week 18, however, most of the metrics showed significantly higher value at the age of week 20 in the anhedonic group. The significantly increased NAA concentration may indicate impaired catabolism due to astrogliosis or

Applications of computational intelligence in nuclear reactors

International Nuclear Information System (INIS)

Jayalal, M.L.; Jehadeesan, R.

2016-01-01

Computational intelligence techniques have been successfully employed in a wide range of applications which include the domains of medical, bioinformatics, electronics, communications and business. There has been progress in applying of computational intelligence in the nuclear reactor domain during the last two decades. The stringent nuclear safety regulations pertaining to reactor environment present challenges in the application of computational intelligence in various nuclear sub-systems. The applications of various methods of computational intelligence in the domain of nuclear reactors are discussed in this paper. (author)

Introduction to Xgrid: Cluster Computing for Everyone

OpenAIRE

Breen, Barbara J.; Lindner, John F.

2010-01-01

Xgrid is the first distributed computing architecture built into a desktop operating system. It allows you to run a single job across multiple computers at once. All you need is at least one Macintosh computer running Mac OS X v10.4 or later. (Mac OS X Server is not required.) We provide explicit instructions and example code to get you started, including examples of how to distribute your computing jobs, even if your initial cluster consists of just two old laptops in your basement.

Applied computational physics

CERN Document Server

Boudreau, Joseph F; Bianchi, Riccardo Maria

2018-01-01

Applied Computational Physics is a graduate-level text stressing three essential elements: advanced programming techniques, numerical analysis, and physics. The goal of the text is to provide students with essential computational skills that they will need in their careers, and to increase the confidence with which they write computer programs designed for their problem domain. The physics problems give them an opportunity to reinforce their programming skills, while the acquired programming skills augment their ability to solve physics problems. The C++ language is used throughout the text. Physics problems include Hamiltonian systems, chaotic systems, percolation, critical phenomena, few-body and multi-body quantum systems, quantum field theory, simulation of radiation transport, and data modeling. The book, the fruit of a collaboration between a theoretical physicist and an experimental physicist, covers a broad range of topics from both viewpoints. Examples, program libraries, and additional documentatio...

Positron scattering by atomic hydrogen including positronium formation

International Nuclear Information System (INIS)

Higgins, K.; Burke, P.G.

1993-01-01

Positron scattering by atomic hydrogen including positronium formation has been formulated using the R-matrix method and a general computer code written. Partial wave elastic and ground state positronium formation cross sections have been calculated for L ≤ 6 using a six-state approximation which includes the ground state and the 2s and 2p pseudostates of both hydrogen and positronium. The elastic scattering results obtained are in good agreement with those derived from a highly accurate calculation based upon the intermediate energy R-matrix approach. As in a previous coupled-channel static calculation, resonance effects are observed at intermediate energies in the S-wave positronium formation cross section. However, in the present results, the dominant resonance arises in the P-wave cross sections at an energy of 2.73 Ryd and with a width of 0.19 Ryd. (author)

Microfluidic System Simulation Including the Electro-Viscous Effect

Science.gov (United States)

Rojas, Eileen; Chen, C. P.; Majumdar, Alok

2007-01-01

This paper describes a practical approach using a general purpose lumped-parameter computer program, GFSSP (Generalized Fluid System Simulation Program) for calculating flow distribution in a network of micro-channels including electro-viscous effects due to the existence of electrical double layer (EDL). In this study, an empirical formulation for calculating an effective viscosity of ionic solutions based on dimensional analysis is described to account for surface charge and bulk fluid conductivity, which give rise to electro-viscous effect in microfluidics network. Two dimensional slit micro flow data was used to determine the model coefficients. Geometry effect is then included through a Poiseuille number correlation in GFSSP. The bi-power model was used to calculate flow distribution of isotropically etched straight channel and T-junction microflows involving ionic solutions. Performance of the proposed model is assessed against experimental test data.

Privacy-Preserving Computation with Trusted Computing via Scramble-then-Compute

OpenAIRE

Dang Hung; Dinh Tien Tuan Anh; Chang Ee-Chien; Ooi Beng Chin

2017-01-01

We consider privacy-preserving computation of big data using trusted computing primitives with limited private memory. Simply ensuring that the data remains encrypted outside the trusted computing environment is insufficient to preserve data privacy, for data movement observed during computation could leak information. While it is possible to thwart such leakage using generic solution such as ORAM [42], designing efficient privacy-preserving algorithms is challenging. Besides computation effi...

Workshop on Computational Optimization

CERN Document Server

2015-01-01

Our everyday life is unthinkable without optimization. We try to minimize our effort and to maximize the achieved profit. Many real world and industrial problems arising in engineering, economics, medicine and other domains can be formulated as optimization tasks. This volume is a comprehensive collection of extended contributions from the Workshop on Computational Optimization 2013. It presents recent advances in computational optimization. The volume includes important real life problems like parameter settings for controlling processes in bioreactor, resource constrained project scheduling, problems arising in transport services, error correcting codes, optimal system performance and energy consumption and so on. It shows how to develop algorithms for them based on new metaheuristic methods like evolutionary computation, ant colony optimization, constrain programming and others.

Summer School and Conference : Computations with Modular Forms

CERN Document Server

Wiese, Gabor

2014-01-01

This volume contains original research articles, survey articles and lecture notes related to the Computations with Modular Forms 2011 Summer School and Conference, held at the University of Heidelberg. A key theme of the Conference and Summer School was the interplay between theory, algorithms and experiment. The 14 papers offer readers both, instructional courses on the latest algorithms for computing modular and automorphic forms, as well as original research articles reporting on the latest developments in the field. The three Summer School lectures provide an introduction to modern algorithms together with some theoretical background for computations of and with modular forms, including computing cohomology of arithmetic groups, algebraic automorphic forms, and overconvergent modular symbols. The 11 Conference papers cover a wide range of themes related to computations with modular forms, including lattice methods for algebraic modular forms on classical groups, a generalization of the Maeda conjecture, ...

Future requirements and roles of computers in aerodynamics

Science.gov (United States)

Gregory, T. J.

1978-01-01

While faster computers will be needed to make solution of the Navier-Stokes equations practical and useful, most all of the other aerodynamic solution techniques can benefit from faster computers. There is a wide variety of computational and measurement techniques, the prospect of more powerful computers permits extension and an enhancement across all aerodynamic methods, including wind-tunnel measurement. It is expected that, as in the past, a blend of methods will be used to predict aircraft aerodynamics in the future. These will include methods based on solution of the Navier-Stokes equations and the potential flow equations as well as those based on empirical and measured results. The primary flows of interest in aircraft aerodynamics are identified, the predictive methods currently in use and/or under development are reviewed and two of these methods are analyzed in terms of the computational resources needed to improve their usefulness and practicality.

1st International Conference on Computational Intelligence and Informatics

CERN Document Server

Prasad, V; Rani, B; Udgata, Siba; Raju, K

2017-01-01

The book covers a variety of topics which include data mining and data warehousing, high performance computing, parallel and distributed computing, computational intelligence, soft computing, big data, cloud computing, grid computing, cognitive computing, image processing, computer networks, wireless networks, social networks, wireless sensor networks, information and network security, web security, internet of things, bioinformatics and geoinformatics. The book is a collection of best papers submitted in the First International Conference on Computational Intelligence and Informatics (ICCII 2016) held during 28-30 May 2016 at JNTUH CEH, Hyderabad, India. It was hosted by Department of Computer Science and Engineering, JNTUH College of Engineering in association with Division V (Education & Research) CSI, India. .

Investigating the Interactive Effects of Sex Steroid Hormones and Brain-Derived Neurotrophic Factor during Adolescence on Hippocampal NMDA Receptor Expression

Directory of Open Access Journals (Sweden)

Cushla R. McCarthny

2018-01-01

Full Text Available Sex steroid hormones have neuroprotective properties which may be mediated by brain-derived neurotrophic factor (BDNF. This study sought to determine the interactive effects of preadolescent hormone manipulation and BDNF heterozygosity (+/− on hippocampal NMDA-R expression. Wild-type and BDNF+/− mice were gonadectomised, and females received either 17β-estradiol or progesterone treatment, while males received either testosterone or dihydrotestosterone (DHT treatment. Dorsal (DHP and ventral hippocampus (VHP were dissected, and protein expression of GluN1, GluN2A, GluN2B, and PSD-95 was assessed by Western blot analysis. Significant genotype × OVX interactions were found for GluN1 and GluN2 expression within the DHP of female mice, suggesting modulation of select NMDA-R levels by female sex hormones is mediated by BDNF. Furthermore, within the DHP BDNF+/− mice show a hypersensitive response to hormone treatment on GluN2 expression which may result from upstream alterations in TrkB phosphorylation. In contrast to the DHP, the VHP showed no effects of hormone manipulation but significant effects of genotype on NMDA-R expression. Castration had no effect on NMDA-R expression; however, androgen treatment had selective effects on GluN2B. These data show case distinct, interactive roles for sex steroid hormones and BDNF in the regulation of NMDA-R expression that are dependent on dorsal versus ventral hippocampal region.

Academic Training Lecture Regular Programme: Computer Security - Introduction to information and computer security (1/4)

CERN Multimedia

2012-01-01

Computer Security: Introduction to information and computer security (1/4), by Sebastian Lopienski (CERN).   Monday, 21 May, 2012 from 11:00 to 12:00 (Europe/Zurich) at CERN ( 31-3-004 - IT Auditorium ) Sebastian Lopienski is CERN's Deputy Computer Security Officer. He works on security strategy and policies; offers internal consultancy and audit services; develops and maintains security tools for vulnerability assessment and intrusion detection; provides training and awareness raising; and does incident investigation and response. During his work at CERN since 2001, Sebastian has had various assignments, including designing and developing software to manage and support services hosted in the CERN Computer Centre; providing Central CVS Service for software projects at CERN; and development of applications for accelerator controls in Java. He graduated from the University of Warsaw (MSc in Computer Science) in 2002, and earned an MBA degree at the Enterprise Administration Institute in Ai...

Computer virus information update CIAC-2301

Energy Technology Data Exchange (ETDEWEB)

Orvis, W.J.

1994-01-15

While CIAC periodically issues bulletins about specific computer viruses, these bulletins do not cover all the computer viruses that affect desktop computers. The purpose of this document is to identify most of the known viruses for the MS-DOS and Macintosh platforms and give an overview of the effects of each virus. The authors also include information on some windows, Atari, and Amiga viruses. This document is revised periodically as new virus information becomes available. This document replaces all earlier versions of the CIAC Computer virus Information Update. The date on the front cover indicates date on which the information in this document was extracted from CIAC`s Virus database.

Including gauge corrections to thermal leptogenesis

International Nuclear Information System (INIS)

Huetig, Janine

2013-01-01

. Furthermore, we have computed the Majorana neutrino production rate itself in chapter 6 to test our numerical procedure. In this context we have calculated the tree-level result as well as the gauge corrected result for the Majorana neutrino production rate. Finally in chapter 7, we have implemented the Majorana neutrino ladder rung diagram into our setup for leptogenesis: As a first consideration, we have collected all gauge corrected diagrams up to three-loop order for the asymmetry-causing two-loop diagrams. However, the results of chap. 5 showed that it is not sufficient to just include diagrams up to three-loop level. Due to the necessity of resumming all n-loop diagrams, we have constructed a cylindrical diagram that fulfils this condition. This diagram is the link between the Majorana neutrino ladder rung diagram calculated before on the one hand and the lepton asymmetry on the other. Therefore we have been able to derive a complete expression for the integrated lepton number matrix including all leading order corrections. The numerical analysis of this lepton number matrix needs a great computational effort since for the resulting eight-dimensional integral two ordinary differential equations have to be computed for each point the routine evaluates. Thus the result remains yet inaccessible. Research perspectives: Summarising, this thesis provides the basis for a systematic inclusion of gauge interactions in thermal leptogenesis scenarios. As a next step, one should evaluate the expression for the integrated lepton number numerically to gain a value, which can be used for comparison to earlier results such as the solutions of the Boltzmann equations as well as the Kadanoff-Baym ansatz with the implemented Standard Model widths. This numerical result would be the first quantitative number, which contains leading order corrections due to all interactions of the Majorana neutrino with the Standard Model particles. Further corrections by means of including washout effects

Including gauge corrections to thermal leptogenesis

Energy Technology Data Exchange (ETDEWEB)

Huetig, Janine

2013-05-17

. Furthermore, we have computed the Majorana neutrino production rate itself in chapter 6 to test our numerical procedure. In this context we have calculated the tree-level result as well as the gauge corrected result for the Majorana neutrino production rate. Finally in chapter 7, we have implemented the Majorana neutrino ladder rung diagram into our setup for leptogenesis: As a first consideration, we have collected all gauge corrected diagrams up to three-loop order for the asymmetry-causing two-loop diagrams. However, the results of chap. 5 showed that it is not sufficient to just include diagrams up to three-loop level. Due to the necessity of resumming all n-loop diagrams, we have constructed a cylindrical diagram that fulfils this condition. This diagram is the link between the Majorana neutrino ladder rung diagram calculated before on the one hand and the lepton asymmetry on the other. Therefore we have been able to derive a complete expression for the integrated lepton number matrix including all leading order corrections. The numerical analysis of this lepton number matrix needs a great computational effort since for the resulting eight-dimensional integral two ordinary differential equations have to be computed for each point the routine evaluates. Thus the result remains yet inaccessible. Research perspectives: Summarising, this thesis provides the basis for a systematic inclusion of gauge interactions in thermal leptogenesis scenarios. As a next step, one should evaluate the expression for the integrated lepton number numerically to gain a value, which can be used for comparison to earlier results such as the solutions of the Boltzmann equations as well as the Kadanoff-Baym ansatz with the implemented Standard Model widths. This numerical result would be the first quantitative number, which contains leading order corrections due to all interactions of the Majorana neutrino with the Standard Model particles. Further corrections by means of including washout effects

The Dynamic Geometrisation of Computer Programming

Science.gov (United States)

Sinclair, Nathalie; Patterson, Margaret

2018-01-01

The goal of this paper is to explore dynamic geometry environments (DGE) as a type of computer programming language. Using projects created by secondary students in one particular DGE, we analyse the extent to which the various aspects of computational thinking--including both ways of doing things and particular concepts--were evident in their…

Essentials of Computational Electromagnetics

CERN Document Server

Sheng, Xin-Qing

2012-01-01

Essentials of Computational Electromagnetics provides an in-depth introduction of the three main full-wave numerical methods in computational electromagnetics (CEM); namely, the method of moment (MoM), the finite element method (FEM), and the finite-difference time-domain (FDTD) method. Numerous monographs can be found addressing one of the above three methods. However, few give a broad general overview of essentials embodied in these methods, or were published too early to include recent advances. Furthermore, many existing monographs only present the final numerical results without specifyin

Computable Frames in Computable Banach Spaces

Directory of Open Access Journals (Sweden)

S.K. Kaushik

2016-06-01

Full Text Available We develop some parts of the frame theory in Banach spaces from the point of view of Computable Analysis. We define computable M-basis and use it to construct a computable Banach space of scalar valued sequences. Computable Xd frames and computable Banach frames are also defined and computable versions of sufficient conditions for their existence are obtained.

Specialized computer architectures for computational aerodynamics

Science.gov (United States)

Stevenson, D. K.

1978-01-01

In recent years, computational fluid dynamics has made significant progress in modelling aerodynamic phenomena. Currently, one of the major barriers to future development lies in the compute-intensive nature of the numerical formulations and the relative high cost of performing these computations on commercially available general purpose computers, a cost high with respect to dollar expenditure and/or elapsed time. Today's computing technology will support a program designed to create specialized computing facilities to be dedicated to the important problems of computational aerodynamics. One of the still unresolved questions is the organization of the computing components in such a facility. The characteristics of fluid dynamic problems which will have significant impact on the choice of computer architecture for a specialized facility are reviewed.

Cloud computing for comparative genomics.

Science.gov (United States)

Wall, Dennis P; Kudtarkar, Parul; Fusaro, Vincent A; Pivovarov, Rimma; Patil, Prasad; Tonellato, Peter J

2010-05-18

Large comparative genomics studies and tools are becoming increasingly more compute-expensive as the number of available genome sequences continues to rise. The capacity and cost of local computing infrastructures are likely to become prohibitive with the increase, especially as the breadth of questions continues to rise. Alternative computing architectures, in particular cloud computing environments, may help alleviate this increasing pressure and enable fast, large-scale, and cost-effective comparative genomics strategies going forward. To test this, we redesigned a typical comparative genomics algorithm, the reciprocal smallest distance algorithm (RSD), to run within Amazon's Elastic Computing Cloud (EC2). We then employed the RSD-cloud for ortholog calculations across a wide selection of fully sequenced genomes. We ran more than 300,000 RSD-cloud processes within the EC2. These jobs were farmed simultaneously to 100 high capacity compute nodes using the Amazon Web Service Elastic Map Reduce and included a wide mix of large and small genomes. The total computation time took just under 70 hours and cost a total of $6,302 USD. The effort to transform existing comparative genomics algorithms from local compute infrastructures is not trivial. However, the speed and flexibility of cloud computing environments provides a substantial boost with manageable cost. The procedure designed to transform the RSD algorithm into a cloud-ready application is readily adaptable to similar comparative genomics problems.

Third International Joint Conference on Computational Intelligence (IJCCI 2011)

CERN Document Server

Dourado, António; Rosa, Agostinho; Filipe, Joaquim; Computational Intelligence

2013-01-01

The present book includes a set of selected extended papers from the third International Joint Conference on Computational Intelligence (IJCCI 2011), held in Paris, France, from 24 to 26 October 2011. The conference was composed of three co-located conferences:  The International Conference on Fuzzy Computation (ICFC), the International Conference on Evolutionary Computation (ICEC), and the International Conference on Neural Computation (ICNC). Recent progresses in scientific developments and applications in these three areas are reported in this book. IJCCI received 283 submissions, from 59 countries, in all continents. This book includes the revised and extended versions of a strict selection of the best papers presented at the conference.

Contemporary high performance computing from petascale toward exascale

CERN Document Server

Vetter, Jeffrey S

2013-01-01

Contemporary High Performance Computing: From Petascale toward Exascale focuses on the ecosystems surrounding the world's leading centers for high performance computing (HPC). It covers many of the important factors involved in each ecosystem: computer architectures, software, applications, facilities, and sponsors. The first part of the book examines significant trends in HPC systems, including computer architectures, applications, performance, and software. It discusses the growth from terascale to petascale computing and the influence of the TOP500 and Green500 lists. The second part of the

A survey of computer science capstone course literature

Science.gov (United States)

Dugan, Robert F., Jr.

2011-09-01

In this article, we surveyed literature related to undergraduate computer science capstone courses. The survey was organized around course and project issues. Course issues included: course models, learning theories, course goals, course topics, student evaluation, and course evaluation. Project issues included: software process models, software process phases, project type, documentation, tools, groups, and instructor administration. We reflected on these issues and thecomputer science capstone course we have taught for seven years. The survey summarized, organized, and synthesized the literature to provide a referenced resource for computer science instructors and researchers interested in computer science capstone courses.

Quasicrystals and Quantum Computing

Science.gov (United States)

Berezin, Alexander A.

1997-03-01

In Quantum (Q) Computing qubits form Q-superpositions for macroscopic times. One scheme for ultra-fast (Q) computing can be based on quasicrystals. Ultrafast processing in Q-coherent structures (and the very existence of durable Q-superpositions) may be 'consequence' of presence of entire manifold of integer arithmetic (A0, aleph-naught of Georg Cantor) at any 4-point of space-time, furthermore, at any point of any multidimensional phase space of (any) N-particle Q-system. The latter, apart from quasicrystals, can include dispersed and/or diluted systems (Berezin, 1994). In such systems such alleged centrepieces of Q-Computing as ability for fast factorization of long integers can be processed by sheer virtue of the fact that entire infinite pattern of prime numbers is instantaneously available as 'free lunch' at any instant/point. Infinitely rich pattern of A0 (including pattern of primes and almost primes) acts as 'independent' physical effect which directly generates Q-dynamics (and physical world) 'out of nothing'. Thus Q-nonlocality can be ultimately based on instantaneous interconnectedness through ever- the-same structure of A0 ('Platonic field' of integers).

Innovations and advances in computing, informatics, systems sciences, networking and engineering

CERN Document Server

Elleithy, Khaled

2015-01-01

Innovations and Advances in Computing, Informatics, Systems Sciences, Networking and Engineering  This book includes a set of rigorously reviewed world-class manuscripts addressing and detailing state-of-the-art research projects in the areas of Computer Science, Informatics, and Systems Sciences, and Engineering. It includes selected papers from the conference proceedings of the Eighth and some selected papers of the Ninth International Joint Conferences on Computer, Information, and Systems Sciences, and Engineering (CISSE 2012 & CISSE 2013). Coverage includes topics in: Industrial Electronics, Technology & Automation, Telecommunications and Networking, Systems, Computing Sciences and Software Engineering, Engineering Education, Instructional Technology, Assessment, and E-learning.  ·       Provides the latest in a series of books growing out of the International Joint Conferences on Computer, Information, and Systems Sciences, and Engineering; ·       Includes chapters in the most a...

Future computing needs for Fermilab

International Nuclear Information System (INIS)

1983-12-01

The following recommendations are made: (1) Significant additional computing capacity and capability beyond the present procurement should be provided by 1986. A working group with representation from the principal computer user community should be formed to begin immediately to develop the technical specifications. High priority should be assigned to providing a large user memory, software portability and a productive computing environment. (2) A networked system of VAX-equivalent super-mini computers should be established with at least one such computer dedicated to each reasonably large experiment for both online and offline analysis. The laboratory staff responsible for mini computers should be augmented in order to handle the additional work of establishing, maintaining and coordinating this system. (3) The laboratory should move decisively to a more fully interactive environment. (4) A plan for networking both inside and outside the laboratory should be developed over the next year. (5) The laboratory resources devoted to computing, including manpower, should be increased over the next two to five years. A reasonable increase would be 50% over the next two years increasing thereafter to a level of about twice the present one. (6) A standing computer coordinating group, with membership of experts from all the principal computer user constituents of the laboratory, should be appointed by and report to the director. This group should meet on a regularly scheduled basis and be charged with continually reviewing all aspects of the laboratory computing environment

Cloud Computing Security Issues - Challenges and Opportunities

OpenAIRE

Vaikunth, Pai T.; Aithal, P. S.

2017-01-01

Cloud computing services enabled through information communication technology delivered to a customer as services over the Internet on a leased basis have the capability to extend up or down their service requirements or needs. In this model, the infrastructure is owned by a third party vendor and the cloud computing services are delivered to the requested customers. Cloud computing model has many advantages including scalability, flexibility, elasticity, efficiency, and supports outsourcing ...

Nonlinear dynamics as an engine of computation.

Science.gov (United States)

Kia, Behnam; Lindner, John F; Ditto, William L

2017-03-06

Control of chaos teaches that control theory can tame the complex, random-like behaviour of chaotic systems. This alliance between control methods and physics-cybernetical physics-opens the door to many applications, including dynamics-based computing. In this article, we introduce nonlinear dynamics and its rich, sometimes chaotic behaviour as an engine of computation. We review our work that has demonstrated how to compute using nonlinear dynamics. Furthermore, we investigate the interrelationship between invariant measures of a dynamical system and its computing power to strengthen the bridge between physics and computation.This article is part of the themed issue 'Horizons of cybernetical physics'. © 2017 The Author(s).

Open client/server computing and middleware

CERN Document Server

Simon, Alan R

2014-01-01

Open Client/Server Computing and Middleware provides a tutorial-oriented overview of open client/server development environments and how client/server computing is being done.This book analyzes an in-depth set of case studies about two different open client/server development environments-Microsoft Windows and UNIX, describing the architectures, various product components, and how these environments interrelate. Topics include the open systems and client/server computing, next-generation client/server architectures, principles of middleware, and overview of ProtoGen+. The ViewPaint environment

Structured brain computing and its learning

International Nuclear Information System (INIS)

Ae, Tadashi; Araki, Hiroyuki; Sakai, Keiichi

1999-01-01

We have proposed a two-level architecture for brain computing, where two levels are introduced for processing of meta-symbol. At level 1 a conventional pattern recognition is performed, where neural computation is included, and its output gives the meta-symbol which is a symbol enlarged from a symbol to a kind of pattern. At Level 2 an algorithm acquisition is made by using a machine for abstract states. We are also developing the VLSI chips at each level for SBC (Structured Brain Computer) Ver.1.0

Computer programming and computer systems

CERN Document Server

Hassitt, Anthony

1966-01-01

Computer Programming and Computer Systems imparts a "reading knowledge? of computer systems.This book describes the aspects of machine-language programming, monitor systems, computer hardware, and advanced programming that every thorough programmer should be acquainted with. This text discusses the automatic electronic digital computers, symbolic language, Reverse Polish Notation, and Fortran into assembly language. The routine for reading blocked tapes, dimension statements in subroutines, general-purpose input routine, and efficient use of memory are also elaborated.This publication is inten

76 FR 45860 - In the Matter of Certain Electronic Devices, Including Wireless Communication Devices, Portable...

Science.gov (United States)

2011-08-01

..., Including Wireless Communication Devices, Portable Music and Data Processing Devices, and Tablet Computers... electronic devices, including wireless communication devices, portable music and data processing devices, and...''). The complaint further alleges that an industry in the United States exists or is in the process of...

12 CFR 1780.11 - Computing time.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Computing time. 1780.11 Section 1780.11 Banks... time. (a) General rule. In computing any period of time prescribed or allowed by this subpart, the date of the act or event that commences the designated period of time is not included. The last day so...

Computational multiscale modeling of intergranular cracking

International Nuclear Information System (INIS)

Simonovski, Igor; Cizelj, Leon

2011-01-01

A novel computational approach for simulation of intergranular cracks in a polycrystalline aggregate is proposed in this paper. The computational model includes a topological model of the experimentally determined microstructure of a 400 μm diameter stainless steel wire and automatic finite element discretization of the grains and grain boundaries. The microstructure was spatially characterized by X-ray diffraction contrast tomography and contains 362 grains and some 1600 grain boundaries. Available constitutive models currently include isotropic elasticity for the grain interior and cohesive behavior with damage for the grain boundaries. The experimentally determined lattice orientations are employed to distinguish between resistant low energy and susceptible high energy grain boundaries in the model. The feasibility and performance of the proposed computational approach is demonstrated by simulating the onset and propagation of intergranular cracking. The preliminary numerical results are outlined and discussed.

Computational Nanotechnology Molecular Electronics, Materials and Machines

Science.gov (United States)

Srivastava, Deepak; Biegel, Bryan A. (Technical Monitor)

2002-01-01

This presentation covers research being performed on computational nanotechnology, carbon nanotubes and fullerenes at the NASA Ames Research Center. Topics cover include: nanomechanics of nanomaterials, nanotubes and composite materials, molecular electronics with nanotube junctions, kinky chemistry, and nanotechnology for solid-state quantum computers using fullerenes.

Applied computing in medicine and health

CERN Document Server

Al-Jumeily, Dhiya; Mallucci, Conor; Oliver, Carol

2015-01-01

Applied Computing in Medicine and Health is a comprehensive presentation of on-going investigations into current applied computing challenges and advances, with a focus on a particular class of applications, primarily artificial intelligence methods and techniques in medicine and health. Applied computing is the use of practical computer science knowledge to enable use of the latest technology and techniques in a variety of different fields ranging from business to scientific research. One of the most important and relevant areas in applied computing is the use of artificial intelligence (AI) in health and medicine. Artificial intelligence in health and medicine (AIHM) is assuming the challenge of creating and distributing tools that can support medical doctors and specialists in new endeavors. The material included covers a wide variety of interdisciplinary perspectives concerning the theory and practice of applied computing in medicine, human biology, and health care. Particular attention is given to AI-bas...

Mobile computing initiatives within pharmacy education.

Science.gov (United States)

Cain, Jeff; Bird, Eleanora R; Jones, Mikael

2008-08-15

To identify mobile computing initiatives within pharmacy education, including how devices are obtained, supported, and utilized within the curriculum. An 18-item questionnaire was developed and delivered to academic affairs deans (or closest equivalent) of 98 colleges and schools of pharmacy. Fifty-four colleges and schools completed the questionnaire for a 55% completion rate. Thirteen of those schools have implemented mobile computing requirements for students. Twenty schools reported they were likely to formally consider implementing a mobile computing initiative within 5 years. Numerous models of mobile computing initiatives exist in terms of device obtainment, technical support, infrastructure, and utilization within the curriculum. Responders identified flexibility in teaching and learning as the most positive aspect of the initiatives and computer-aided distraction as the most negative, Numerous factors should be taken into consideration when deciding if and how a mobile computing requirement should be implemented.

New trends in computational collective intelligence