WorldWideScience

Sample records for vhf radiotelephone power

  1. 47 CFR 80.873 - VHF radiotelephone transmitter.

    Science.gov (United States)

    2010-10-01

    ...) The transmitter must deliver a carrier power between 8 and 25 watts into a 50 ohm effective resistance... 50 ohms effective resistance over the frequency band specified in § 80.871(d). An individual...

  2. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  3. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  4. 47 CFR 22.727 - Power limits for conventional rural radiotelephone transmitters.

    Science.gov (United States)

    2010-10-01

    ... this section. (a) Maximum ERP. The effective radiated power (ERP) of central office and rural... circumstances. Frequency range (MHz) Maximum ERP (watts) 152-153 1400 157-159 150 454-455 3500 459-460 150 (b) Basic power limit. Except as provided in paragraph (d) of this section, the ERP of central office...

  5. Utilizing Yagi antennas in Lightning Mapping Array to detect low-power VHF signals

    Science.gov (United States)

    Tilles, J.; Thomas, R. J.; Edens, H. E.; Krehbiel, P. R.; Rison, W.

    2013-12-01

    The New Mexico Tech VHF Lightning Mapping Array (LMA) being operated at Langmuir Laboratory in central New Mexico is comprised of 22 time-of-arrival stations spanning an area approximately 60 km north-south and 45 km east-west. Nine stations are at high altitude (3.1-3.3 km GPS) over a 3 x 4 km area around the mountain-top Laboratory, and 13 are on the surrounding plains and the Rio Grande valley, at altitudes between 1.4 and 2.2 km. Each station utilizes a vertical half-wave dipole antenna having about 2 dBi gain at horizontal incidence and providing omnidirectional azimuthal coverage. In 2012, four additional stations utilizing higher gain (11 dBi) Yagi antennas were co-located at four of the surrounding sites within 10-15 km of the laboratory, each pointed over the laboratory area. The purpose was to test if directional antennas would improve detection of low-power sources in the laboratory vicinity, such as those associated with positive breakdown or weak precursor events. The test involved comparing the number and quality of radiation sources obtained by processing data from two sets of stations: first for a 17-station network in which all stations were omnidirectional, and then for the same network with Yagi-based measurements substituted in place of the omni measurements at the four co-located stations. For radiation events located in both datasets, the indicated source power values from Yagi stations were typically 5-10 dB greater than their omnidirectional counterpart for sources over or near the laboratory, consistent with the 9 dB difference in on-axis gain values. The difference decreased through zero and to negative values with increasing distance from the laboratory, confirming that it was due to the directionality of the Yagi antennas. It was expected that a network having Yagi antennas at all outlying stations would improve the network's detection of lower power sources in its central region. Rather, preliminary results show that there is no

  6. 33 CFR 26.03 - Radiotelephone required.

    Science.gov (United States)

    2010-07-01

    ... BRIDGE-TO-BRIDGE RADIOTELEPHONE REGULATIONS § 26.03 Radiotelephone required. (a) Unless an exemption is... 26 feet or over in length while navigating; and (4) Every dredge and floating plant engaged in or... for an unmanned or intermittently manned floating plant under the control of a dredge. (b) Every...

  7. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  8. Discharge Characteristic of VHF-DC Superimposed Magnetron Sputtering System

    Science.gov (United States)

    Toyoda, Hirotaka; Fukuoka, Yushi; Fukui, Takashi; Takada, Noriharu; Sasai, Kensuke

    2014-10-01

    Magnetron plasmas are one of the most important tools for sputter deposition of thin films. However, energetic particles from the sputtered target such as backscattered rare gas atoms or oxygen negative ions from oxide targets sometimes induce physical and chemical damages as well as surface roughening to the deposited film surface during the sputtering processes. To suppress kinetic energy of such particles, superposition of RF or VHF power to the DC power has been investigated. In this study, influence of the VHF power superposition on the DC target voltage, which is important factor to determine kinetic energy of high energy particles, is investigated. In the study, 40 MHz VHF power was superimposed to an ITO target and decrease in the target DC voltage was measured as well as deposited film deposition properties such as deposition rate or electrical conductivity. From systematic measurement of the target voltage, it was revealed that the target voltage can be determined by a very simple parameter, i.e., a ratio of VHF power to the total input power (DC and VHF powers) in spite of the DC discharge current. Part of this work was supported by ASTEP, JST.

  9. Epitaxial growth of GaN by radical-enhanced metalorganic chemical vapor deposition (REMOCVD) in the downflow of a very high frequency (VHF) N2/H2 excited plasma - effect of TMG flow rate and VHF power

    Science.gov (United States)

    Lu, Yi; Kondo, Hiroki; Ishikawa, Kenji; Oda, Osamu; Takeda, Keigo; Sekine, Makoto; Amano, Hiroshi; Hori, Masaru

    2014-04-01

    Gallium nitride (GaN) films have been grown by using our newly developed Radical-Enhanced Metalorganic Chemical Vapor Deposition (REMOCVD) system. This system has three features: (1) application of very high frequency (60 MHz) power in order to increase the plasma density, (2) introduction of H2 gas together with N2 gas in the plasma discharge region to generate not only nitrogen radicals but also active NHx molecules, and (3) radical supply under remote plasma arrangement with suppression of charged ions and photons by employing a Faraday cage. Using this new system, we have studied the effect of the trimethylgallium (TMG) source flow rate and of the plasma generation power on the GaN crystal quality by using scanning electron microscopy (SEM) and double crystal X-ray diffraction (XRD). We found that this REMOCVD allowed the growth of epitaxial GaN films of the wurtzite structure of (0001) orientation on sapphire substrates with a high growth rate of 0.42 μm/h at a low temperature of 800 °C. The present REMOCVD is a promising method for GaN growth at relatively low temperature and without using costly ammonia gas.

  10. VHF Scintillation in an Artificially Heated Ionosphere

    Science.gov (United States)

    Suszcynsky, D. M.; Layne, J.; Light, M. E.; Pigue, M. J.; Rivera, L.

    2017-12-01

    As part of an ongoing project to characterize very-high-frequency (VHF) radio wave propagation through structured ionospheres, Los Alamos National Laboratory has been conducting a set of experiments to measure the scintillation effects of VHF transmissions under a variety of ionospheric conditions. Previous work (see 2015 Fall AGU poster by D. Suszcynsky et al.) measured the S4 index and ionospheric coherence bandwidth in the 32 - 44 MHz frequency range under naturally scintillated conditions in the equatorial region at Kwajalein Atoll during three separate campaigns centered on the 2014 and 2015 equinoxes. In this paper, we will present preliminary results from the February and September, 2017 High Altitude Auroral Research Project (HAARP) Experimental Campaigns where we are attempting to make these measurements under more controlled conditions using the HAARP ionospheric heater in a twisted-beam mode. Two types of measurements are made by transmitting VHF signals through the heated ionospheric volume to the Radio Frequency Propagation (RFProp) satellite experiment. The S4 scintillation index is determined by measuring the power fluctuations of a 135-MHz continuous wave signal and the ionospheric coherence bandwidth is simultaneously determined by measuring the delay spread of a frequency-modulated continuous wave (FMCW) signal in the 130 - 140 MHz frequency range. Additionally, a spatial Fourier transform of the CW time series is used to calculate the irregularity spectral density function. Finally, the temporal evolution of the time series is used to characterize spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities. All results are compared to theory and scaled for comparison to the 32 - 44 MHz Kwajalein measurements.

  11. 47 CFR 80.903 - Inspection of radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... ship passes the inspection, the technician will issue a Communications Act Safety Radiotelephony... 47 Telecommunication 5 2010-10-01 2010-10-01 false Inspection of radiotelephone installation. 80... Passenger Boats § 80.903 Inspection of radiotelephone installation. Every vessel subject to Part III of...

  12. Dihydroazulene/Vinylheptafulvene (DHA/VHF)

    DEFF Research Database (Denmark)

    Vlasceanu, Alexandru

    A theoretical and experimental investigation of conformational modifications on the thermodynamic, optical, and switching properties of dihydroazulene/vinylheptafulvene (DHA/VHF) photoswitches, in the context of molecular solar thermal (MOST) systems, is described herein. The optical properties...... of monomeric DHA/VHF systems are found to be strongly dependent on structural changes which can be tuned via steric modifications. This correlation is then used to infer structural features of more complex, macrocyclic DHA/VHF systems based on their optical properties. The introduction of macrocyclic ring...... strain is furthermore found to significantly influence the switching behavior of DHA/VHF moieties compared to non-cyclized systems. The thermal ring closure of macrocyclic VHF-VHF systems is found to occur in a stepwise manner, enabling the release of the energy on both a fast and slow timescale...

  13. 33 CFR 117.24 - Radiotelephone installation identification.

    Science.gov (United States)

    2010-07-01

    ... using Reflective Blue and Reflective White colors. Color and design information is available from the... the lower right quadrant. Note: It is recommended that the radiotelephone sign be similar in design to...

  14. 47 CFR 80.271 - Technical requirements for portable survival craft radiotelephone transceivers.

    Science.gov (United States)

    2010-10-01

    ... craft radiotelephone transceivers. 80.271 Section 80.271 Telecommunication FEDERAL COMMUNICATIONS... Authorization for Compulsory Ships § 80.271 Technical requirements for portable survival craft radiotelephone transceivers. (a) Portable survival craft radiotelephone transceivers must comply with the following: (1) The...

  15. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  16. Ionospheric modification induced by high-power HF transmitters: a potential for extended range VHF--UHF communications and plasma physics research

    International Nuclear Information System (INIS)

    Utlaut, W.F.

    1975-01-01

    When the ionized upper atmosphere of the earth is illuminated by high-power HF radio waves at appropriate frequencies, the temperature of electrons in the ionosphere can be raised substantially. In addition, radio waves with sufficient energy cause parametric instabilities that generate a spectrum of intense plasma waves. Observations of these phenomena have produced new understanding of plasma processes. One consequence of heating and plasma wave generation is that irregularities are formed in the electron distribution which are aligned with the earth's magnetic field. Because of this, a scatterer of large radar cross section is produced, which scatters HF through UHF communication signals over long distance paths, that would not otherwise be normally possible by ionospheric means. Results of radio, radar, communication, and photometric experiments that explored the characteristics of the volume of ionosphere which has been intentionally modified, temporarily, above facilities near Boulder (Platteville), Colo., and at Arecibo, Puerto Rico are summarized

  17. CMOS VHF transconductance-C lowpass filter

    NARCIS (Netherlands)

    Nauta, Bram

    1990-01-01

    Experimental results of a VHF CMOS transconductance-C lowpass filter are described. The filter is built with transconductors as published earlier. The cutoff frequency can be tuned from 22 to 98 MHz and the measured filter response is very close to the ideal response

  18. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  19. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    International Nuclear Information System (INIS)

    Zhang, H.Y.; He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C.; Zhuge, L.J.; Wu, X.M.

    2015-01-01

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO x are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf 2+ and Hf 4+ . The HfErO films are composed with the structures of HfO 2 , HfO and ErO x , which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO 2 in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO 2 are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  20. 47 CFR 22.970 - Unacceptable interference to part 90 non-cellular 800 MHz licensees from cellular radiotelephone...

    Science.gov (United States)

    2010-10-01

    ...-cellular 800 MHz licensees from cellular radiotelephone or part 90-800 MHz cellular systems. 22.970 Section... MOBILE SERVICES Cellular Radiotelephone Service § 22.970 Unacceptable interference to part 90 non-cellular 800 MHz licensees from cellular radiotelephone or part 90-800 MHz cellular systems. (a) Definition...

  1. 47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...

  2. 47 CFR 22.960 - Cellular unserved area radiotelephone licenses subject to competitive bidding.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular unserved area radiotelephone licenses... (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.960 Cellular... applications for cellular unserved area Phase I and Phase II licenses filed after July 26, 1993 are subject to...

  3. 47 CFR 80.320 - Radiotelephone distress call and message transmission procedure.

    Science.gov (United States)

    2010-10-01

    ... by its call sign or name, to permit direction-finding stations to determine its position. This... 47 Telecommunication 5 2010-10-01 2010-10-01 false Radiotelephone distress call and message... Procedures Distress, Alarm, Urgency and Safety Procedures § 80.320 Radiotelephone distress call and message...

  4. 47 CFR 80.959 - Radiotelephone transmitter.

    Science.gov (United States)

    2010-10-01

    ... watts into 50 ohms nominal resistance when operated with its rated supply voltage. The transmitter must... capability of the transmitter, measurements of primary supply voltage and transmitter output power must be... voltage measured at the power input terminals to the transmitter terminated in a matching artificial load...

  5. 47 CFR 80.102 - Radiotelephone station identification.

    Science.gov (United States)

    2010-10-01

    ... use of the name of the bridge in lieu of the call sign. (c) Ship stations transmitting on any authorized VHF bridge-to-bridge channel may be identified by the name of the ship in lieu of the call sign... may be identified by the name of the ship in lieu of the call sign, or as directed by the agency or...

  6. Environmental/Noise Effects on VHF/UHF UWB SAR

    National Research Council Canada - National Science Library

    Ralston, James

    1998-01-01

    This paper presents a straightforward approach to estimating the impact of natural environmental noise on an overall system noise temperature for very high frequency/ultrahigh frequency synthetic aperture radar (VHF/UHF SAR...

  7. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  8. Using the SLAC VHF and UHF radio systems

    International Nuclear Information System (INIS)

    Struven, W.

    1987-02-01

    The use of the SLAC VHF and UHF Radio Systems and the Tunnel Antenna Systems as they are presently configured is described. The original radio system was built in 1966 and has grown in scope over the years. The Tunnel Antenna Systems were developed for, and first installed in, the PEP ring, and later added to other tunnels and redesigned to cover the UHF range, as well as VHF. The UHF radio system was designed and built for SLC use, and was first used in the SLC Arcs. The three radio systems will be described and the capabilities of each system will be defined

  9. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  10. Combined VLF and VHF lightning observations of Hurricane Rita landfall

    Science.gov (United States)

    Henderson, B. G.; Suszcynsky, D. M.; Wiens, K. C.; Hamlin, T.; Jeffery, C. A.; Orville, R. E.

    2009-12-01

    Hurricane Rita displayed abundant lightning in its northern eyewall as it made landfall at 0740 UTC 24 Sep 2005 near the Texas/Louisiana border. For this work, we combined VHF and VLF lightning data from Hurricane Rita, along with radar observations from Gulf Coast WSR-88D stations, for the purpose of demonstrating the combined utility of these two spectral regions for hurricane lightning monitoring. Lightning is a direct consequence of the electrification and breakdown processes that take place during the convective stages of thunderstorm development. As Rita approached the Gulf coast, the VHF lightning emissions were distinctly periodic with a period of 1.5 to 2 hours, which is consistent with the rotational period of hurricanes. VLF lightning emissions, measured by LASA and NLDN, were present in some of these VHF bursts but not all of them. At landfall, there was a significant increase in lightning emissions, accompanied by a significant convective surge observed in radar. Furthermore, VLF and VHF lightning source heights clearly increase as a function of time. The evolution of the IC/CG ratio is consistent with that seen in thunderstorms, showing a dominance of IC activity during storm development, followed by an increase in CG activity at the storm’s peak. The periodic VHF lightning events are correlated with increases in convective growth (quantified by the volume of radar echo >40 dB) above 7 km altitude. VLF can discriminate between lightning types, and in the LASA data, Rita landfall lightning activity was dominated by Narrow Bi-polar Events (NBEs)—high-energy, high-altitude, compact intra-cloud discharges. The opportunity to locate NBE lightning sources in altitude may be particularly useful in quantifying the vertical extent (strength) of the convective development and in possibly deducing vertical charge distributions.

  11. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  12. VHF lightning mapping observations of a triggered lightning flash

    Science.gov (United States)

    Edens, H. E.; Eack, K. B.; Eastvedt, E. M.; Trueblood, J. J.; Winn, W. P.; Krehbiel, P. R.; Aulich, G. D.; Hunyady, S. J.; Murray, W. C.; Rison, W.; Behnke, S. A.; Thomas, R. J.

    2012-10-01

    On 3 August 2010 an extensive lightning flash was triggered over Langmuir Laboratory in New Mexico. The upward positive leader propagated into the storm's midlevel negative charge region, extending over a horizontal area of 13 × 13 km and 7.5 km altitude. The storm had a normal-polarity tripolar charge structure with upper positive charge over midlevel negative charge. Lightning Mapping Array (LMA) observations were used to estimate positive leader velocities along various branches, which were in the range of 1-3 × 104 m s-1, slower than in other studies. The upward positive leader initiated at 3.4 km altitude, but was mapped only above 4.0 km altitude after the onset of retrograde negative breakdown, indicating a change in leader propagation and VHF emissions. The observations suggest that both positive and negative breakdown produce VHF emissions that can be located by time-of-arrival systems, and that not all VHF emissions occurring along positive leader channels are associated with retrograde negative breakdown.

  13. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  14. Development of a High-Brightness VHF Electron Source at LBNL

    International Nuclear Information System (INIS)

    Lidia, Steven M.; Sannibale, Fernando; Staples, John W.; Virostek, Steve P.; Wells, Russell P.

    2007-01-01

    Currently proposed ERL and high average power FEL projects require electron beam sources that can generate ∼1nC bunch charges at high repetition rates. Many proposed sources are based around either high voltage DC or microwave RF guns, each with its particular set of technological limits and system complications. We propose a novel solution that greatly diminishes high voltage breakdown issues while also decreasing peak RF power requirements in a warm copper device, and that has the benefit of mapping the rf oscillation period much more closely to the required beam repetition rate. We present the initial RF and mechanical design for a 750kV electron source and beam injection system utilizing a gun resonant in the VHF band. Beam dynamics simulations demonstrate excellent beam quality preservation and transport

  15. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... resistance when operated with a primary supply voltage of 13.6 volts DC. (d) When an individual demonstration... paragraph must be met as follows: (1) Measurements of primary supply voltage and transmitter output power must be made with the equipment drawing energy only from ship's battery; (2) The primary supply voltage...

  16. 47 CFR 87.131 - Power and emissions.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Power and emissions. 87.131 Section 87.131... Technical Requirements § 87.131 Power and emissions. The following table lists authorized emissions and... Authorized emission(s) 9 Maximum power 1 Aeronautical advisory VHF A3E 10 watts. 10 Aeronautical multicom VHF...

  17. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    , is inherently resonant, and switching losses are greatly reduced by ensuring Zero Voltage Switching (ZVS) of the power semiconductor devices. A design method to ensure ZVS operation when combining the inverter, rectifier, and gate driver is provided. Several parasitic effects and their influence on converter......This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver...... operation are discussed, and measurement results of a 100 MHz prototype converter are presented and evaluated. The designed prototype converter verifies the described topology....

  18. 47 CFR 80.1015 - Power supply.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Power supply. 80.1015 Section 80.1015... MARITIME SERVICES Radiotelephone Installations Required by the Bridge-to-Bridge Act § 80.1015 Power supply. (a) There must be readily available for use under normal load conditions, a power supply sufficient...

  19. Repotenciación de un sistema de radiocomunicaciones VHF

    Directory of Open Access Journals (Sweden)

    Juan Ortega

    2016-11-01

    Full Text Available Las comunicaciones móviles avanzan a pasos acelerados, como fuente de ayuda para la interrelación entre personas, empresas y proyectos que se enmarcan dentro de los criterios zonales de planificación, el cambio en la matriz productiva del país y el Plan Nacional del Buen Vivir. En tal virtud, el estudio de una repotenciación mediante la aplicación de conocimientos y herramientas enmarcadas dentro de las comunicaciones VHF, es fundamental dentro del mejoramiento en términos de calidad de servicio dentro del área de concesión donde se fundamenta el estudio. El presente artículo realiza un análisis situacional de la red de radiocomunicaciones VHF actual de la Empresa Eléctrica Regional Centro Sur C. A., el área de concesión, localización y coberturas de los repetidores existentes, con el diagnóstico actual de la misma. Además, se desarrolla la propuesta de repotenciación detallando la infraestructura necesaria para su ejecución, la ampliación del área de cobertura, la configuración del software para la gestión e interconexión de los equipos de diferentes zonas.

  20. Partial Discharge Spectral Characterization in HF, VHF and UHF Bands Using Particle Swarm Optimization.

    Science.gov (United States)

    Robles, Guillermo; Fresno, José Manuel; Martínez-Tarifa, Juan Manuel; Ardila-Rey, Jorge Alfredo; Parrado-Hernández, Emilio

    2018-03-01

    The measurement of partial discharge (PD) signals in the radio frequency (RF) range has gained popularity among utilities and specialized monitoring companies in recent years. Unfortunately, in most of the occasions the data are hidden by noise and coupled interferences that hinder their interpretation and renders them useless especially in acquisition systems in the ultra high frequency (UHF) band where the signals of interest are weak. This paper is focused on a method that uses a selective spectral signal characterization to feature each signal, type of partial discharge or interferences/noise, with the power contained in the most representative frequency bands. The technique can be considered as a dimensionality reduction problem where all the energy information contained in the frequency components is condensed in a reduced number of UHF or high frequency (HF) and very high frequency (VHF) bands. In general, dimensionality reduction methods make the interpretation of results a difficult task because the inherent physical nature of the signal is lost in the process. The proposed selective spectral characterization is a preprocessing tool that facilitates further main processing. The starting point is a clustering of signals that could form the core of a PD monitoring system. Therefore, the dimensionality reduction technique should discover the best frequency bands to enhance the affinity between signals in the same cluster and the differences between signals in different clusters. This is done maximizing the minimum Mahalanobis distance between clusters using particle swarm optimization (PSO). The tool is tested with three sets of experimental signals to demonstrate its capabilities in separating noise and PDs with low signal-to-noise ratio and separating different types of partial discharges measured in the UHF and HF/VHF bands.

  1. 47 CFR 80.268 - Technical requirements for radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... a visual indication whenever the transmitter is supplying power to the antenna. (4) Have a two-tone... between masts or other supports subject to whipping, a safety link must be installed which under heavy stress will reduce breakage of the antenna, the halyards, or any other supporting elements. (d) The...

  2. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  3. 47 CFR 80.917 - Reserve power supply.

    Science.gov (United States)

    2010-10-01

    ... power supply must be adequately treated to prevent freezing or overheating consistent with the season... 47 Telecommunication 5 2010-10-01 2010-10-01 false Reserve power supply. 80.917 Section 80.917... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.917 Reserve power...

  4. 47 CFR 80.965 - Reserve power supply.

    Science.gov (United States)

    2010-10-01

    ... conditions. When meeting this 2 hour requirement, such reserve power supply must be located on the bridge... radiotelephone must be a “reserve power supply” for the purposes of paragraphs (c), (d) and (e) of this section... meeting the requirements of paragraph (a) of this section as follows: (1) When the reserve power supply...

  5. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  6. Use of vhf dielectric measurements for borehole formation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Poley, J.P.; Nooteboom, J.J.; de Waal, P.J.

    1978-01-01

    A study of the dielectric properties of sedimentary rocks at a sufficiently high frequency may provide useful data for the evaluation of borehole wall formations in exploration and production wells. An experimental program carried out between 1960 and 1967 on sandstone and limestone samples lent further support to these expectations. At frequencies above 20 Mc/s both real and imaginary parts of the complex epsilon* = epsilon' - j epsilon'' were measurable. Moreover, at higher frequencies, epsilon' proved to be independent of the salinity of the water filling the pores, and insensitive to the way in which the oil and the water are actually distributed. The value of epsilon'', on the other hand, turned out to be indicative of the prevailing salinity. By combining other logging data (for instance from an electric or porosity log) with a series of such v.h.f. measurements of epsilon' and epsilon'', the oil or water saturation, the effective formation porosity, the pore-filling fluid salinity, and the rock matrix formation factor might be deduced, if the depth of investigation can be made large enough to overcome the invasion effects.

  7. Observations of lightning processes using VHF radio interferometry

    Science.gov (United States)

    Rhodes, C. T.; Shao, X. M.; Krehbiel, P. R.; Thomas, R.

    1991-01-01

    A single station, multiple baseline radio interferometer was used to locate the direction of VHF radiation from lightning discharges with microsec time resolution. Radiation source directions and electric field waveforms were analyzed for various types of breakdown events. These include initial breakdown and K type events of in-cloud activity, and the leaders of initial and subsequent strokes to ground and activity during and following return strokes. Radiation during the initial breakdown of a flash and in the early stages of initial leaders to ground is found to be similar. In both instances, the activity consists of localized bursts of radiation that are intense and slow moving. Motion within a given burst is unresolved by the interferometer. Radiation from in-cloud K type events is essentially the same as that from dart leaders; in both cases it is produced at the leading edge of a fast moving streamer that propagates along a well defined, often extensive path. K type events are sometimes terminated by fast field changes that are similar to the return stroke initiated by dart leaders; such K type events are the in-cloud analog of the dart leader return stroke process.

  8. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    International Nuclear Information System (INIS)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto

    2015-01-01

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively

  9. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  10. 47 CFR 22.913 - Effective radiated power limits.

    Science.gov (United States)

    2010-10-01

    ... radiated power (ERP) of transmitters in the Cellular Radiotelephone Service must not exceed the limits in this section. (a) Maximum ERP. In general, the effective radiated power (ERP) of base transmitters and... areas, as those areas are defined in § 22.949, the ERP of base transmitters and cellular repeaters of...

  11. Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?

    International Nuclear Information System (INIS)

    Van Erk, W; Luijks, G M J F; Hitchcock, W

    2011-01-01

    Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W -1 drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.

  12. Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?

    Energy Technology Data Exchange (ETDEWEB)

    Van Erk, W [Philips Lighting, Sondervick 47, 5505 NB Veldhoven (Netherlands); Luijks, G M J F [Advanced Development Lighting, Philips Lighting, PO Box 80020, 5600 JM Eindhoven (Netherlands); Hitchcock, W, E-mail: Gerard.luijks@philips.com [Philips Lighting Company, 7265 Route 54, Bath, NY 14810 (United States)

    2011-06-08

    Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W{sup -1} drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.

  13. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  14. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  15. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  16. Some radiation safety aspects of operating medical generators of VHF electromagnetic energy

    International Nuclear Information System (INIS)

    Bosevski, V.; Radev, S.; Donev, Ch.

    1977-01-01

    The state of radiation safety in physiotherapy practice using very-high-frequency diathermy was studied with regard to personnel and patient protection. A specially devised shielding set to protect patients and personnel is offered for adoption, and the necessity is insistently stressed of prohibiting any patient head or gonad exposure. It is pointed out that the protective set developed may also be used at facilities employing other types of VHF electromagnetic energy sources. (author)

  17. Adjuvant VHF therapy in locally recurrent and primary unresectable rectal cancer

    International Nuclear Information System (INIS)

    Trotter, J.M.; Lamb, M.H.; Bayliss, E.J.; Edis, A.J.; Blackwell, J.B.; Shepherd, J.M.; Cassidy, B.

    1996-01-01

    In a prospective randomized study, 434 MHz microwave therapy combined with external beam radiotherapy (VHF+RT) was compared with standard external beam radiotherapy (RT) in controlling locally recurrent or unresectable primary adenocarcinoma of the rectum. Independent assessors documented quality of life scores, performance status, toxicities local response to treatment, and systemic disease progression before treatment and after treatment and every 8 week thereafter. Of 75 patients randomized, 73 were eligible for inclusion in the study. Forty-three of these patients had local pelvic tumour recurrence only and 21 also had distant metastases. In addition, nine patients had primary inoperable carcinomas, two of whom also had metastases. Thirty-seven patients were randomized to RT and 36 to VHF+RT. Th median dose of radiation in the VHF+RT arm was 4275 cGy with a median fraction size of 150 cGy and median duration of therapy of 48.5 days versus 4500 cGy in the RT-only arm with a median fraction size of 180 cGy and median duration of therapy of 38 days. These doses are unlikely to be significantly different in biological effect. No significant difference between the two groups was observed in extent and duration of local control, measures of toxicity or quality of life scores. Additionally, survival and cumulative incidence of pelvic site of first progression did not differ significantly between the groups. It is concluded that VHF microwave therapy in conjunction with radiotherapy produces no therapeutic advantage over conventional radiation therapy alone in the treatment of locally recurrent rectal carcinoma. 35 refs., 8 tabs., 3 figs

  18. TH-AB-209-09: Quantitative Imaging of Electrical Conductivity by VHF-Induced Thermoacoustics

    Energy Technology Data Exchange (ETDEWEB)

    Patch, S; Hull, D [Avero Diagnostics, Irving, TX (United States); See, W [Medical College of Wisconsin, Milwaukee, WI (United States); Hanson, G [UW-Milwaukee, Milwaukee, WI (United States)

    2016-06-15

    Purpose: To demonstrate that very high frequency (VHF) induced thermoacoustics has the potential to provide quantitative images of electrical conductivity in Siemens/meter, much as shear wave elastography provides tissue stiffness in kPa. Quantitatively imaging a large organ requires exciting thermoacoustic pulses throughout the volume and broadband detection of those pulses because tomographic image reconstruction preserves frequency content. Applying the half-wavelength limit to a 200-micron inclusion inside a 7.5 cm diameter organ requires measurement sensitivity to frequencies ranging from 4 MHz down to 10 kHz, respectively. VHF irradiation provides superior depth penetration over near infrared used in photoacoustics. Additionally, VHF signal production is proportional to electrical conductivity, and prostate cancer is known to suppress electrical conductivity of prostatic fluid. Methods: A dual-transducer system utilizing a P4-1 array connected to a Verasonics V1 system augmented by a lower frequency focused single element transducer was developed. Simultaneous acquisition of VHF-induced thermoacoustic pulses by both transducers enabled comparison of transducer performance. Data from the clinical array generated a stack of 96-images with separation of 0.3 mm, whereas the single element transducer imaged only in a single plane. In-plane resolution and quantitative accuracy were measured at isocenter. Results: The array provided volumetric imaging capability with superior resolution whereas the single element transducer provided superior quantitative accuracy. Combining axial images from both transducers preserved resolution of the P4-1 array and improved image contrast. Neither transducer was sensitive to frequencies below 50 kHz, resulting in a DC offset and low-frequency shading over fields of view exceeding 15 mm. Fresh human prostates were imaged ex vivo and volumetric reconstructions reveal structures rarely seen in diagnostic images. Conclusion

  19. Characterization of VHF radar observations associated with equatorial Spread F by narrow-band optical measurements

    Directory of Open Access Journals (Sweden)

    R. Sekar

    2004-09-01

    Full Text Available The VHF radars have been extensively used to investigate the structures and dynamics of equatorial Spread F (ESF irregularities. However, unambiguous identification of the nature of the structures in terms of plasma depletion or enhancement requires another technique, as the return echo measured by VHF radar is proportional to the square of the electron density fluctuations. In order to address this issue, co-ordinated radar backscatter and thermospheric airglow intensity measurements were carried out during March 2003 from the MST radar site at Gadanki. Temporal variations of 630.0-nm and 777.4-nm emission intensities reveal small-scale ("micro" and large-scale ("macro" variations during the period of observation. The micro variations are absent on non-ESF nights while the macro variations are present on both ESF and non-ESF nights. In addition to the well-known anti-correlation between the base height of the F-region and the nocturnal variation of thermospheric airglow intensities, the variation of the base height of the F-layer, on occasion, is found to manifest as a bottomside wave-like structure, as seen by VHF radar on an ESF night. The micro variations in the airglow intensities are associated with large-scale irregular plasma structures and found to be in correspondence with the "plume" structures obtained by VHF radar. In addition to the commonly observed depletions with upward movement, the observation unequivocally reveals the presence of plasma enhancements which move downwards. The observation of enhancement in 777.4-nm airglow intensity, which is characterized as plasma enhancement, provides an experimental verification of the earlier prediction based on numerical modeling studies.

  20. Comparison Study of Lightning observations from VHF interferometer and Geostationary Lightning Mapper

    Science.gov (United States)

    Kudo, A.; Stock, M.; Ushio, T.

    2017-12-01

    We compared the optical observation from Geostationary Lightning Mapper (GLM) which is mounted on the geostationary meteorological satellite GOES-16 launched last year, and the radio observations from the ground-based VHF broad band interferometer. GLM detects 777.4 nm wavelength infrared optical signals from thunderstorm cells which are illuminated by the heated path during lightning discharge, and was developed mainly for the purpose of increasing the lead time for warning of severe weather and clarifying the discharge mechanism. Its detection has 2 ms frame rate, and 8 km square of space resolution at nadir. The VHF broad band interferometer is able to capture the electromagnetic waves from 20 MHz to 75 MHz and estimate the direction of arrival of the radiation sources using the interferometry technique. This system also has capability of observing the fast discharge process which cannot be captured by other systems, so it is expected to able to make detailed comparison. The recording duration of the system is 1 second. We installed the VHF broad band interferometer which consists of three VHF antenna and one fast antenna at Huntsville, Alabama from April 22nd to May 15th and in this total observation period, 720 triggers of data were observed by the interferometer. For comparison, we adopted the data from April 27th , April 30th. Most April 27th data has GLM "event" detection which is coincident time period. In time-elevation plot comparison, we found GLM detection timing was well coincide with interferometer during K-changes or return strokes and few detection during breakdown process. On the other hand, no GLM detection near the site for all data in April 30th and we are triyng to figure out the reason. We would like to thank University of Alabama Huntsville, New Mexico Institute of Mining and Technology, and RAIRAN Pte. Ltd for the help during the campaign.

  1. Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

    Science.gov (United States)

    2015-05-01

    Transactions on. 2002;50(5):591-599. 22. Nerguizian C, Despins C, Affes S, Djadel M. Radio-channel characterization of an underground mine at 2.4 ghz...INTENTIONALLY LEFT BLANK. viii 1. Introduction Reliable wireless communication is of paramount importance for many important civilian and military...report, we study near-ground, wireless channel modeling in the lower VHF band for indoor and indoor/outdoor scenarios, drawing from extensive propagation

  2. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  3. A beaded collar for dual micro GPS/VHF transmitter attachment to nutria

    Science.gov (United States)

    Haramis, G.M.; White, T.S.

    2011-01-01

    We report on the development of an approximately 85-g beaded collar for dual micro GPS/VHF transmitter attachment to semi-aquatic nutria (Myocastor coypus). Prototype collars were tested on captive nutria and refined during field trials. Central to the design was novel use of the VHF transmitter antenna as a collar. A circular collar was formed by passing the 44-cm antenna cable through a pre-made hole in the transmitter, leaving an approximately 16-cm upright antenna. GPS units were mounted separately via a hole in the base of each unit. For good satellite contact, GPS units (28 g) were maintained at the nape of the neck by counterbalance of the heavier VHF transmitters (50 g) positioned under the neck. To reduce friction, we lined the collar with alternate-sized plastic and, later, more durable nylon beads. The final collar configuration was worn for approximately 1 month deployments with only minor neck abrasion; one collar was worn successfully for 5 months. Foot entanglement remained the greatest risk of injury from the collar. By fitting collars tightly, we reduced the incidence of foot entanglement to 2 of 33 deployments (6%). Successful GPS tracks were acquired on 29 of 33 deployments (88%).

  4. A signature correlation study of ground target VHF/UHF ISAR imagery

    Science.gov (United States)

    Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Kersey, William T.; Waldman, Jerry; Carter, Steve; Nixon, William E.

    2003-09-01

    VV and HH-polarized radar signatures of several ground targets were acquired in the VHF/UHF band (171-342 MHz) by using 1/35th scale models and an indoor radar range operating from 6 to 12 GHz. Data were processed into medianized radar cross sections as well as focused, ISAR imagery. Measurement validation was confirmed by comparing the radar cross section of a test object with a method of moments radar cross section prediction code. The signatures of several vehicles from three vehicle classes (tanks, trunks, and TELs) were measured and a signature cross-correlation study was performed. The VHF/UHF band is currently being exploited for its foliage penetration ability, however, the coarse image resolution which results from the relatively long radar wavelengths suggests a more challenging target recognition problem. One of the study's goals was to determine the amount of unique signature content in VHF/UHF ISAR imagery of military ground vehicles. Open-field signatures are compared with each other as well as with simplified shapes of similar size. Signatures were also acquired on one vehicle in a variety of configurations to determine the impact of monitor target variations on the signature content at these frequencies.

  5. Effect of geomagnetic storms on VHF scintillations observed at low latitude

    Science.gov (United States)

    Singh, S. B.; Patel, Kalpana; Singh, A. K.

    2018-06-01

    A geomagnetic storm affects the dynamics and composition of the ionosphere and also offers an excellent opportunity to study the plasma dynamics. In the present study, we have used the VHF scintillations data recorded at low latitude Indian station Varanasi (Geomag. latitude = 14^{°}55^' }N, long. = 154^{°}E) which is radiated at 250 MHz from geostationary satellite UFO-02 during the period 2011-2012 to investigate the effects of geomagnetic storms on VHF scintillation. Various geomagnetic and solar indices such as Dst index, Kp index, IMF Bz and solar wind velocity (Vx) are used to describe the geomagnetic field variation observed during geomagnetic storm periods. These indices are very helpful to find out the proper investigation and possible interrelation between geomagnetic storms and observed VHF scintillation. The pre-midnight scintillation is sometimes observed when the main phase of geomagnetic storm corresponds to the pre-midnight period. It is observed that for geomagnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time and extends to early morning hours.

  6. VHF radar observations of gravity waves at a low latitude

    Directory of Open Access Journals (Sweden)

    G. Dutta

    1999-08-01

    Full Text Available Wind observations made at Gadanki (13.5°N by using Indian MST Radar for few days in September, October, December 1995 and January, 1996 have been analyzed to study gravity wave activity in the troposphere and lower stratosphere. Horizontal wind variances have been computed for gravity waves of period (2-6 h from the power spectral density (PSD spectrum. Exponential curves of the form eZ/H have been fitted by least squares technique to these variance values to obtain height variations of the irregular winds upto the height of about 15 km, where Z is the height in kilometers. The value of H, the scale height, as determined from curve fitting is found to be less than the theoretical value of scale height of neutral atmosphere in this region, implying that the waves are gaining energy during their passage in the troposphere. In other words, it indicates that the sources of gravity waves are present in the troposphere. The energy densities of gravity wave fluctuations have been computed. Polynomial fits to the observed values show that wave energy density increases in the troposphere, its source region, and then decreases in the lower stratosphere.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; waves and tides

  7. Two-dimensional simulations of multi-hollow VHF SiH4/H2 plasma

    Directory of Open Access Journals (Sweden)

    Li-Wen Su

    2018-02-01

    Full Text Available A triode multi-hollow VHF SiH4/H2 plasma (60 MHz was examined at a pressure of 20 Pa by two-dimensional simulations using the fluid model. In this study, we considered the effect of the rate constant of reaction, SiH3 + SiH3→SiH2 + SiH4, on the plasma characteristics. A typical VHF plasma of a high-electron density with a low-electron temperature was obtained between two discharge electrodes. Spatial profiles of SiH3+, SiH2+, SiH3- and SiH3 densities were similar to that of the electron density while the electron temperature had a maximum value near the two discharge electrodes. It was found that the SiH3 radical density did not decrease rapidly near the substrate and the electron temperature was lower than 1 eV, suggesting that the triode multi-hollow plasma source can provide high quality amorphous silicon with a high deposition rate.

  8. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other.

    Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  9. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  10. VHF/UHF imagery and RCS measurements of ground targets in forested terrain

    Science.gov (United States)

    Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Waldman, Jerry; Nixon, William E.

    2002-08-01

    The monostatic VV and HH-polarized radar signatures of several targets and trees have been measured at foliage penetration frequencies (VHF/UHF) by using 1/35th scale models and an indoor radar range operating at X-band. An array of high-fidelity scale model ground vehicles and test objects as well as scaled ground terrain and trees have been fabricated for the study. Radar measurement accuracy has been confirmed by comparing the signature of a test object with a method of moments radar cross section prediction code. In addition to acquiring signatures of targets located on a smooth, dielectric ground plane, data have also been acquired with targets located in simulated wooded terrain that included scaled tree trunks and tree branches. In order to assure the correct backscattering behavior, all dielectric properties of live tree wood and moist soil were scaled properly to match the complex dielectric constant of the full-scale materials. The impact of the surrounding tree clutter on the VHF/UHF radar signatures of ground vehicles was accessed. Data were processed into high-resolution, polar-formatted ISAR imagery and signature comparisons are made between targets in open-field and forested scenarios.

  11. In situ occupational and general public exposure to VHF/UHF transmission for air traffic communication.

    Science.gov (United States)

    Joseph, Wout; Goeminne, Francis; Verloock, Leen; Vermeeren, Günter; Martens, Luc

    2012-09-01

    Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric-field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m(-1) for occupational exposure and from 0.007 to 8.0 V m(-1) for general public exposure. The average fields equal 5.2 V m(-1) for workers, and 0.7 V m(-1) for general public.

  12. In situ occupational and general public exposure to VHF/UHF transmission for air traffic communication

    International Nuclear Information System (INIS)

    Joseph, W.; Goeminne, F.; Verloock, L.; Vermeeren, G.; Martens, L.

    2012-01-01

    Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m -1 for occupational exposure and from 0.007 to 8.0 V m -1 for general public exposure. The average fields equal 5.2 V m -1 for workers, and 0.7 V m -1 for general public. (authors)

  13. Morphology and Structural Characterization of Carbon Nanowalls Grown via VHF-PECVD

    Science.gov (United States)

    Akmal Hasanudin, M.; Wahab, Y.; Ismail, A. K.; Zahid Jamal, Z. A.

    2018-03-01

    A 150 MHz very high frequency plasma enhanced chemical vapor deposition (150 MHz VHF-PECVD) system was utilized to fabricate two-dimensional carbon nanostructure from the mixture of methane and hydrogen. Morphology and structural properties of the grown nanostructure were investigated by FESEM imaging and Raman spectroscopy. Carbon nanowalls (CNW) with dense and wavy-like structure were successfully synthesized. The wavy-like morphology of CNW was found to be more distinct during growth at small electrode spacing and denser with increasing deposition time due to better flux of hydrocarbon radicals to the substrate and higher rate of reaction, respectively. Typical characteristics of CNW were observed from strong D band, narrow bandwidth of G band and single broad peak of 2D band of Raman spectra indicating the presence of disordered nanocrystalline graphite structure with high degree of graphitization.

  14. Graphene-based tunable non-foster circuit for VHF applications

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Jing; Nagarkoti, Deepak Singh; Rajab, Khalid Z.; Hao, Yang, E-mail: y.hao@qmul.ac.uk [School of Electronic Engineering and Computer Science, Queen Mary, University of London, London, E1 4NS (United Kingdom)

    2016-06-15

    This paper presents a negative impedance converter (NIC) based on graphene field effect transistors (GFETs) for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS) topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010)] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS) show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency) using Nyquist stability criterion to ensure there are no oscillation issues.

  15. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  16. Evolution of Very High Frequency Power Supplies

    DEFF Research Database (Denmark)

    Knott, Arnold; Andersen, Toke Meyer; Kamby, Peter

    2013-01-01

    The ongoing demand for smaller and lighter power supplies is driving the motivation to increase the switching frequencies of power converters. Drastic increases however come along with new challenges, namely the increase of switching losses in all components. The application of power circuits used...... in radio frequency transmission equipment helps to overcome those. However those circuits were not designed to meet the same requirements as power converters. This paper summarizes the contributions in recent years in application of very high frequency (VHF) technologies in power electronics, shows results...... of the recent advances and describes the remaining challenges. The presented results include a self-oscillating gate-drive, air core inductor optimizations, an offline LED driver with a power density of 8.9 W/cm3 and a 120 MHz, 9 W DC powered LED driver with 89 % efficiency as well as a bidirectional VHF...

  17. Mechanical design and fabrication of the VHF-gun, the Berkeley normal-conducting continuous-wave high-brightness electron source

    Science.gov (United States)

    Wells, R. P.; Ghiorso, W.; Staples, J.; Huang, T. M.; Sannibale, F.; Kramasz, T. D.

    2016-02-01

    A high repetition rate, MHz-class, high-brightness electron source is a key element in future high-repetition-rate x-ray free electron laser-based light sources. The VHF-gun, a novel low frequency radio-frequency gun, is the Lawrence Berkeley National Laboratory (LBNL) response to that need. The gun design is based on a normal conducting, single cell cavity resonating at 186 MHz in the VHF band and capable of continuous wave operation while still delivering the high accelerating fields at the cathode required for the high brightness performance. The VHF-gun was fabricated and successfully commissioned in the framework of the Advanced Photo-injector EXperiment, an injector built at LBNL to demonstrate the capability of the gun to deliver the required beam quality. The basis for the selection of the VHF-gun technology, novel design features, and fabrication techniques are described.

  18. First Joint Observations of Radio Aurora by the VHF and HF Radars of the ISTP SB RAS

    Science.gov (United States)

    Berngardt, O. I.; Lebedev, V. P.; Kutelev, K. A.; Kushnarev, D. S.; Grkovich, K. V.

    2018-01-01

    Two modern radars for diagnosis of the ionosphere by the radio-wave backscattering method, namely, the Irkutsk incoherent scatter radar at VHF (IISR, 154-162 MHz) and the Ekaterinburg coherent radar at HF (EKB, 8-20 MHz) are operated at the Institute of Solar-Terrestrial Physics, Siberian Branch of the Russian Academy of Sciences (ISTP SB RAS). The paper analyzes the results of joint observations of strong scattering (radio aurora) on June 8, 2015. To determine the geographical position of the radio aurora, we developed original methods that take into account both the features of the radio-wave propagation and the features of the radar antenna systems. It is shown that there are areas where the spatial position of the HF and VHF radio aurora can coincide. This permits using the radars as a single complex for diagnosis of the characteristics of small-scale high-latitude irregularities in the ionospheric E and F layers. A comparative analysis of the characteristics and temporal dynamics of the radio-aurora region in the HF and VHF ranges is performed. Using the DMSP satellite data, it has been shown that the radio aurora dynamics during this experiment with the EKB radar can be related with the spatial dynamics of the localized area with high electric field, which moves from high to equatorial latitudes. It is found that due to the broader field of view, radio aurora at the HF radar was stably observed 6-12 min earlier than at the VHF radar. This permits using the EKB radar data for prediction of the radio-aurora detection by the IISR radar.

  19. Broadband VHF Interferometer Observations of an Energetic In-cloud Pulse (EIP)

    Science.gov (United States)

    Tilles, J.; Krehbiel, P. R.; Stanley, M. A.; Rison, W.; Lyu, F.; Cummer, S.; Liu, N.; Dwyer, J. R.; Brown, R. G.; Wilson, J. G.

    2017-12-01

    Energetic in-cloud pulses (EIPs) are a little-known in-cloud subprocess of lightning. While they may be best identified by their large peak current (>200 kA) [Lyu et al., Geophys. Res. Lett., 42, 2015], they differ from narrow bipolar events (NBEs) - another type of in-cloud, high peak-current process - in that the sferic of an EIP lasts an order of magnitude longer ( ˜100 us) than that of a typical NBE ( ˜10 us). To further differentiate them from NBEs, EIPs are generally embedded within other electrical activity, whereas NBEs are known to primarily occur in isolation or as a lightning-initiating event [Smith et al., J. Geophys. Res., 104, D4, 4189-4212, 1999; Rison et al., Nat. Commun., 7, 10721, 2016]. Moreover, EIPs may have an intrinsic connection with the production of terrestrial gamma ray flashes (TGFs) [Cummer et al., Geophys. Res. Lett., 41, 8586-8593, 2014].Here we present coincident broadband VHF interferometer (INTF) observations and electric and magnetic field waveforms of an EIP with an associated NLDN peak current of 247 kA. The EIP occurs nearly 4 ms into a normal-polarity intracloud flash as part of the upward extension of the negative-polarity lightning leader. For this reason, we suspect that EIPs are a more energetic version of initial breakdown pulses (IBPs), which accompany the development of negative stepped leaders [e.g. Marshall et al., J. Geophys. Res. Atmos., 119, 445-460, 2014]. In addition, we show similarities with NBE-producing fast breakdown [Rison et al., 2016; Tilles et al., AE12A-03, AGU Fall Meeting, 2016], in that the breakdown accompanying the EIP propagates over a similar vertical extent ( ˜0.5-1 km) and with similar propagation speed ( ˜3×107 m/s). The INTF was developed by New Mexico Tech and has been deployed at Kennedy Space Center since July 2016. It employed three 100-m baselines in 2016, has a bandwidth of 14-88 MHz and samples at 180 MS/s with 16-bit resolution. A synchronously digitized fast antenna (FA), with

  20. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  1. Ion upflow and downflow at the topside ionosphere observed by the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    M. Endo

    2000-02-01

    Full Text Available We have determined the MLT distribution and KP dependence of the ion upflow and downflow of the thermal bulk oxygen ion population based on a data analysis using the EISCAT VHF radar CP-7 data obtained at Tromsø during the period between 1990 and 1996: (1 both ion upflow and downflow events can be observed at any local time (MLT, irrespective of dayside and nightside, and under any magnetic disturbance level, irrespective of quiet and disturbed levels; (2 these upflow and downflow events are more frequently observed in the nightside than in the dayside; (3 the upflow events are more frequently observed than the downflow events at any local time except midnight and at any KP level and the difference of the occurrence frequencies between the upflow and downflow events is smaller around midnight; and (4 the occurrence frequencies of both the ion upflow and downflow events appear to increase with increasing KP level, while the occurrence frequency of the downflow appears to stop increasing at some KP level.Key words: Ionosphere (particle acceleration; plasma waves and instabilities - Space plasma physics (transport processes

  2. VHF and HF radar measurements of E and R region plasma drifts at the magnetic equator

    International Nuclear Information System (INIS)

    Viswanathan, K.S.; Namboothiri, S.P.; Rao, P.B.

    1992-01-01

    Simultaneous observations of E region horizontal irregularity drifts by VHF backscatter radar and of F region vertical plasma drift by HF Doppler radar conducted during daytime on a few magnetically quiet days at Trivandrum (dip 0.2 degree N) are presented. A comparative study of the two measurements indicates broadly (1) a resemblance in the daytime changes of the E-W component between the electric field and (2) evidence of quasi-periodic electric field variations with periods ranging mostly from 1 to 2 hours. The electric fields derived from HF Doppler radar observations are somewhat lower than those deduced by HVHF radar observations. The correlation coefficient for the variations of the electric fields measured by the two experimental techniques is found to be in the range of about 0.5 to 0.9. The observed difference in the E and F region electric fields at the magnetic equator is discussed in terms of the measurement uncertainties and the limitations involved in deriving E-W electric fields. The observations are suggestive of a latitudinal variation in the E-W component of the electric field in the equatorial ionosphere

  3. Spatial and temporal variations of small-scale plasma turbulence parameters in the equatorial electrojet: HF and VHF radar observational results

    Directory of Open Access Journals (Sweden)

    G. Manju

    2005-06-01

    Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.

  4. Spatial and temporal variations of small-scale plasma turbulence parameters in the equatorial electrojet: HF and VHF radar observational results

    Directory of Open Access Journals (Sweden)

    G. Manju

    2005-06-01

    Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.

  5. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  6. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  7. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  8. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  9. Low-Profile Multiband and Flush-Mountable Wideband Antennas for HF/VHF and K/Ka Band Applications

    Science.gov (United States)

    Garrido Lopez, David

    This thesis introduces several novel antenna systems with extended performance capabilities achieved by either enabling multiple operation bands or by widening the bandwidth. Proposed theoretical concepts are successfully tested through simulations and experiments with excellent agreement are demonstrated. The designs developed in this thesis research are low-profile or flush mountable, enabling simple platform integration. In the HF/VHF bands, the development of a novel low-profile multiband antenna for vehicular applications is presented. Specifically, an inverted-F antenna is used as a driven element, to operate at the lowest frequency of 27 MHz, whereas two parasitic elements are built as inverted-L monopoles to enable resonances at 49 and 53 MHz. To eliminate the need for an external matching network, an offset feeding technique is used. When the antenna is mounted on a vehicle and bent to follow its profile, a very low-profile is achieved (lambda/44) while good impedance and far-field performance are maintained across all three bands. The developed antenna system is not only electrically smallest among others found in the literature, but it is easily modified for other band selections and tuning of each band can be readily achieved. Vehicular antennas are often used for high power applications, which may cause exposure of nearby individuals to possibly dangerous electromagnetic fields. To assess this hazard, the RF exposure of a vehicle's crew is discussed and an original and fast modeling approach for prediction thereof is demonstrated. The modeling approach is based on eigenmode analysis for acquiring a range of frequencies where the shielding effectiveness of a vehicle cabin is expected to be lower than average. This approach is typically much faster and requires less computational resources as compared to classical full-wave analyses. This analysis also shows that the position of an antenna system is critical and must be considered when high-power RF

  10. Very High Frequency Galvanic Isolated Offline Power Supply

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf

    During the last decades many researchers have turned their attention to raising the operation frequency of power converters to the very high frequency (VHF) range going from 30 MHz to 300 MHz. Increasing the operating frequency of a power converter leads to smaller energy storing components...... inverters with a single combined rectifier. The converter designed to deliver 9 W to a 60 V LED load and is achieving an efficiency of 89.4% and a power density of 2.14 W3 . The development of this converter proof that offline VHF converter can be implemented with high efficiencies even for low power applications...... are described together with the possibility of using capacitors as the power galvanic isolation, both methods of creating galvanic isolation are implemented in converters. Regarding EMC a series of converters with different filter implementations are examined. The results from the conducted mea-surement from 150...

  11. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  12. Three-Dimensional Reconstruction of Cloud-to-Ground Lightning Using High-Speed Video and VHF Broadband Interferometer

    Science.gov (United States)

    Li, Yun; Qiu, Shi; Shi, Lihua; Huang, Zhengyu; Wang, Tao; Duan, Yantao

    2017-12-01

    The time resolved three-dimensional (3-D) spatial reconstruction of lightning channels using high-speed video (HSV) images and VHF broadband interferometer (BITF) data is first presented in this paper. Because VHF and optical radiations in step formation process occur with time separation no more than 1 μs, the observation data of BITF and HSV at two different sites provide the possibility of reconstructing the time resolved 3-D channel of lightning. With the proposed procedures for 3-D reconstruction of leader channels, dart leaders as well as stepped leaders with complex multiple branches can be well reconstructed. The differences between 2-D speeds and 3-D speeds of leader channels are analyzed by comparing the development of leader channels in 2-D and 3-D space. Since return stroke (RS) usually follows the path of previous leader channels, the 3-D speeds of the return strokes are first estimated by combination with the 3-D structure of the preceding leaders and HSV image sequences. For the fourth RS, the ratios of the 3-D to 2-D RS speeds increase with height, and the largest ratio of the 3-D to 2-D return stroke speeds can reach 2.03, which is larger than the result of triggered lightning reported by Idone. Since BITF can detect lightning radiation in a 360° view, correlated BITF and HSV observations increase the 3-D detection probability than dual-station HSV observations, which is helpful to obtain more events and deeper understanding of the lightning process.

  13. Investigation of atmospheric high-energy phenomena onboard International Space Station: microsatellite ''Chibis-AI'' and VHF interferometer ''Kite''

    International Nuclear Information System (INIS)

    Dolgonosov, M.; Gotlib, V.; Karedin, V.; Kosov, A.; Nazarov, V.; Zelenyi, L.; Klimov, S.

    2017-01-01

    Space Research Institute of the RAS is gradually developing its own program of the space-born experiments to study high- energy process in the terrestrial atmosphere. Terrestrial Gamma-ray Flashes (TGFS) and Compact Intracloud Discharges (CIDs) are among principal goals of the scientific research of the program. To conduct research is supposed to produce new «instruments»: microsatellite «ChibiS-AI» and VHF interferometer «Kite» aboard International Space Station. Microsatellite ”Chibis-AI” will be constructed on the platform originally designed at the Special Engineering Department of Space Research Institute of the Russian Academy of Sciences in 2011. It's forerunner «Chibis-M» was successfully launched in 2012. Expected date of «Chibis-AI» launch is 2019. The principal idea underlying design of the scientific payload of the microsatellite ”Chibis-AI” is the joint observations of the TGF and CID emissions by different detectors installed onboard: Radio Frequency Analyzer (RFA) and Neutron and Gamma spectrometer (N GS). RFA contained two passbands in the range 15-26 and 26-48 MHZ with a digitization at 96 megasamples/s. NGS is based on LaBr3(Ce3+) crystal with the maximum achievable today spectral resolution and efficiency of gamma rays in the energy range 100 Kev - 10 MeV among scintillation crystals. The microsatellite orbit will be circular with inclination 51° with initial elevation above sea level around 550 km. VHF interferometer «Kite» to be installed in 2019-2020 aboard 188. To implement interferometric scheme 4 antennas will be installed on the 188 surface. The passband of the instrument will be ∼50-100 MHZ. Technical details of both experiments, its current stage and features as well results of the previous experiment «Chibis-M» will be discussed. (author)

  14. Power

    DEFF Research Database (Denmark)

    Elmholdt, Claus Westergård; Fogsgaard, Morten

    2016-01-01

    and creativity suggests that when managers give people the opportunity to gain power and explicate that there is reason to be more creative, people will show a boost in creative behaviour. Moreover, this process works best in unstable power hierarchies, which implies that power is treated as a negotiable....... It is thus a central point that power is not necessarily something that breaks down and represses. On the contrary, an explicit focus on the dynamics of power in relation to creativity can be productive for the organisation. Our main focus is to elaborate the implications of this for practice and theory...

  15. On the Ongoing Evolution of Very High Frequency Power Supplies

    DEFF Research Database (Denmark)

    Knott, Arnold; Andersen, Toke Meyer; Kamby, Peter

    2013-01-01

    The ongoing demand for smaller and lighter power supplies is driving the motivation to increase the switching frequencies of power converters. Drastic increases however come along with new challenges, namely the increase of switching losses in all components. The application of power circuits used...... in radio frequency transmission equipment helps to overcome those. However those circuits were not designed to meet the same requirements as power converters. This paper summarizes the contributions in recent years in application of very high frequency (VHF) technologies in power electronics, describes...

  16. Examples of mesoscale structures and short-term wind variations detected by VHF Doppler radar

    Science.gov (United States)

    Forbes, G. S.

    1986-01-01

    The first of three wind profilers planned for operation in central and western Pennsylvania began full-time, high-quality operation during July 1985. It is located about 20 km south-southeast of University Park and operates at 50 MHz. Another 50-MHz radar and a 400-MHz radar are to be installed over the next few months, to complete a mesoscale triangle with sides of 120 to 160 km. During the period since early July, a number of weather systems have passed over the wind profiler. Those accompanied by thunderstorms caused data losses either because the Department computer system lost power or because power went out at the profiler site. A backup power supply and an automatic re-start program will be added to the profiler system to minimize such future losses. Data have normally been averaged over a one-hour period, although there have been some investigations of shorter-period averaging. In each case, preliminary examinations reveal that the profiler winds are indicative of meteorological phenomena. The only occasions of bad or missing data are obtained when airplane noise is occasionally experienced and when the returned power is nearly at the noise level, at the upper few gates, where a consensus wind cannot be determined. Jets streams, clouds, and diurnal variations of winds are discussed.

  17. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  18. VHF Series-Input Parallel-Output Interleaved Self-Oscillating Resonant SEPIC Converter

    DEFF Research Database (Denmark)

    Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.

    2013-01-01

    If the switches of two resonant SEPIC converters are capacitively coupled, it is possible to obtain a self-oscillating converter in which the two power stages operate in interleaved mode. This paper describes a topology where the inputs of two SEPIC converters are connected in series, thereby sha...

  19. Time and latitudinal distribution of the ionospheric irregularities in Brazil, through the VHF-scintillation and ionogram data analysis

    International Nuclear Information System (INIS)

    Nelson, O.R.

    1984-01-01

    Equatorial ionospheric irregularity distribution morphology, and dynamics, and the dynamics of the ambient ionosphere were investigated. Spread F data from ionograms over Fortaleza (4 0 S; 38 0 O) and Cachoeira Paulista (22,7 0 S; 45 0 O), and simultaneous VHF scintillations of geoestationary satellite beacon received over Natal (5,6 0 S; 33,7 0 O) were used to determine the irregularity local time versus seasonal distribution, over the equatorial and low latitude location, during the solar activity maximum as well as minimum epochs. Concept of flux tube alignment properties of the transequatorial plasma bubbles were used to determine statistical features of the plasma bubble rise velocities. Calculations of plasma bubble rise velocities were then carried out for different solar activity epochs and compared with prereversal enhancement amplitude in the F-layer vertical rise velocities, for the same epochs. Using theoretical considerations on the development of plasma bubble based on flux tube integrated properties, the observed dependence of the plasma bubble rise velocities and the F-region dynamo electric field has been analysed to estimate the average ionizations depletions in the plasma bubble. Possible causes for the lack of correlation often observed between bubble rise velocities and F-Layer velocities also are discussed. (Author) [pt

  20. Degree of dissociation measured by FTIR absorption spectroscopy applied to VHF silane plasmas

    International Nuclear Information System (INIS)

    Sansonnens, L.; Howling, A.A.; Hollenstein, C.

    1997-10-01

    In situ Fourier transform infrared (FTIR) absorption spectroscopy has been used to determine the fractional depletion of silane in a radio-frequency (rf) glow discharge. The technique used a simple single pass arrangement and was implemented in a large area industrial reactor for deposition of amorphous silicon. Measurements were made on silane plasmas for a range of excitation frequencies. It was observed that at constant plasma power, the fractional depletion increased from 35% at 13.56 MHz to 70% at 70 MHz. With a simple model based on the density continuity equations in the gas phase, it was shown that this increase is due to a higher dissociation rate and is largely responsible for the observed increase in the deposition rate with the frequency. (author) 5 figs., 30 refs

  1. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  2. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  3. A no-tune no-match wideband probe for nuclear quadrupole resonance spectroscopy in the VHF range

    Science.gov (United States)

    Scharfetter, Hermann; Petrovic, Andreas; Eggenhofer, Heidi; Stollberger, Rudolf

    2014-12-01

    Nuclear quadrupole resonance (NQR) spectroscopy is a method for the characterization of chemical compounds containing so-called quadrupolar nuclei. Similar to nuclear magnetic resonance (NMR), the sample under investigation is irradiated with strong radiofrequency (RF) pulses, which stimulate the emission of weak RF signals from the quadrupolar nuclei. The signals are then amplified and Fourier transformed so as to obtain a spectrum. In principle, narrowband NQR spectra can be measured with NMR spectrometers. However, pure NQR signals require the absence of a static magnetic field and several special applications require the characterization of a substance over a large bandwidth, e.g. 50-100% of the central frequency, which is hardly possible with standard NMR equipment. Dedicated zero-field NQR equipment is not widespread and current concepts employ resonating probes which are tuned and matched over a wide range by using mechanical capacitors driven by stepper motors. While providing the highest signal to noise ratio (SNR) such probes are slow in operation and can only be operated from dedicated NMR consoles. We developed a low-cost NQR wideband probe without tuning and matching for applications in the very high frequency (VHF) range below 300 MHz. The probe coil was realized as part of a reactive network which approximates an exponential transmission line. The input reflection coefficient of the two developed prototype probe coils is ≤ 20 dB between 90-145 MHz and 74.5-99.5 MHz, respectively. Two wideband NQR spectra of published test substances were acquired with an SNR of better than 20 dB after sufficient averaging. The measured signals and the SNR correspond very well to the theoretically expected values and demonstrate the feasibility of the method. Because there is no need for tuning and matching, our probes can be operated easily from any available NMR console.

  4. Morphological study of the field-aligned E-layer irregularities observed by the Gadanki VHF radar

    Directory of Open Access Journals (Sweden)

    C. J. Pan

    2004-11-01

    Full Text Available We report on the field-aligned irregularities observed in the low-latitude sporadic E-layer (Es with the Gadanki (13.5° N, 79.2° E; geomagnetic latitude 6.3° N VHF radar. The radar was operated intermittently for 15 days during the summer months in 1998 and 1999, for both daytime and nighttime observation. The total observation periods are 161h for the nighttime and 68h for the daytime. The observations were used to study the percentage of occurrence of the E-region echoes for both daytime and nighttime. The statistical characteristics of the mean radial velocity and spectral width are presented for three cases based on the echo occurrence characteristics and the altitude of observations (from 90 to 140km ranges, namely, the lower E-region daytime (90-110km, the lower E-region nighttime (90-105km and the upper E-region nighttime (105-140km echoes. The results are compared with that of Piura, a low-latitude station located at about the same geomagnetic latitude, but to the south of the equator. By comparing the behaviors of the lower E-region radar echoes of the summer months between Gadanki and Piura, we find that the lower altitude echoes below about 100km are rarely reported in Piura but commonly seen in Gadanki. Features of the nighttime echoes observed by these two radars are quite similar but daytime FAI echoes are again seldom detected by Piura.

  5. A Tower-based Prototype VHF/UHF Radar for Subsurface Sensing: System Description and Data Inversion Results

    Science.gov (United States)

    Moghaddam, Mahta; Pierce, Leland; Tabatabaeenejad, Alireza; Rodriguez, Ernesto

    2005-01-01

    Knowledge of subsurface characteristics such as permittivity variations and layering structure could provide a breakthrough in many terrestrial and planetary science disciplines. For Earth science, knowledge of subsurface and subcanopy soil moisture layers can enable the estimation of vertical flow in the soil column linking surface hydrologic processes with that in the subsurface. For planetary science, determining the existence of subsurface water and ice is regarded as one of the most critical information needs for the study of the origins of the solar system. The subsurface in general can be described as several near-parallel layers with rough interfaces. Each homogenous rough layer can be defined by its average thickness, permittivity, and rms interface roughness assuming a known surface spectral distribution. As the number and depth of layers increase, the number of measurements needed to invert for the layer unknowns also increases, and deeper penetration capability would be required. To nondestructively calculate the characteristics of the rough layers, a multifrequency polarimetric radar backscattering approach can be used. One such system is that we have developed for data prototyping of the Microwave Observatory of Subcanopy and Subsurface (MOSS) mission concept. A tower-mounted radar makes backscattering measurements at VHF, UHF, and L-band frequencies. The radar is a pulsed CW system, which uses the same wideband antenna to transmit and receive the signals at all three frequencies. To focus the beam at various incidence angles within the beamwidth of the antenna, the tower is moved vertically and measurements made at each position. The signals are coherently summed to achieve focusing and image formation in the subsurface. This requires an estimate of wave velocity profiles. To solve the inverse scattering problem for subsurface velocity profile simultaneously with radar focusing, we use an iterative technique based on a forward numerical solution of

  6. Embedded Solenoid Transformer for Power Conversion

    DEFF Research Database (Denmark)

    2015-01-01

    A resonant power converter for operation in the radio frequency range, preferably in the VHF, comprises at least one PCB-embedded transformer. The transformer is configured for radio frequency operation and comprises a printed circuit board defining a horizontal plane, the printed circuit board...... comprising at least two horizontal conductive layers separated by an isolating layer, a first embedded solenoid forming a primary winding of the transformer and a second embedded solenoid being arranged parallel to the first solenoid and forming a secondary winding of the transformer, wherein the first...

  7. Microcrystalline thin-film solar cell deposition on moving substrates using a linear VHF-PECVD reactor and a cross-flow geometry

    International Nuclear Information System (INIS)

    Flikweert, A J; Zimmermann, T; Merdzhanova, T; Weigand, D; Appenzeller, W; Gordijn, A

    2012-01-01

    A concept for high-rate plasma deposition (PECVD) of hydrogenated microcrystalline silicon on moving substrates (dynamic deposition) is developed and evaluated. The chamber allows for substrates up to a size of 40 × 40 cm 2 . The deposition plasma is sustained between linear VHF electrodes (60 MHz) and a moving substrate. Due to the gas flow geometry and the high degree of source gas depletion, from the carrier's point of view the silane concentration varies when passing the electrodes. This is known to lead to different growth conditions which can induce transitions from microcrystalline to amorphous growth. The effect of different silane concentrations is simulated at a standard RF showerhead electrode by intentionally varying the silane concentration during deposition in static mode. This variation may decrease the layer quality of microcrystalline silicon, due to a shift of the crystallinity away from the optimum. However, adapting the input silane concentration, state-of-the-art solar cells are obtained. Microcrystalline cells (ZnO : Al/Ag back contacts) produced by the linear VHF plasma sources show an efficiency of 7.9% and 6.6% for depositions in static and dynamic mode, respectively. (paper)

  8. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  9. Intrinsic Nonlinearities and Layout Impacts of 100 V Integrated Power MOSFETs in Partial SOI Process

    DEFF Research Database (Denmark)

    Fan, Lin; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Parasitic capacitances of power semiconductors are a part of the key design parameters of state-of-the-art very high frequency (VHF) power supplies. In this poster, four 100 V integrated power MOSFETs with different layout structures are designed, implemented, and analyzed in a 0.18 ȝm partial...... Silicon-on-Insulator (SOI) process with a die area 2.31 mm2.  A small-signal model of power MOSFETs is proposed to systematically analyze the nonlinear parasitic capacitances in different transistor states: off-state, sub-threshold region, and on-state in the linear region. 3D plots are used to summarize...

  10. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  11. Microfabricated Air-core Toroidal Inductor In Very High Frequency Power Converters

    DEFF Research Database (Denmark)

    Lê Thanh, Hoà; Nour, Yasser; Han, Anpan

    2018-01-01

    Miniaturization of power supplies is required for future intelligent electronic systems e.g. internet of things devices. Inductors play an essential role, and they are by far the most bulky and expensive components in power supplies. This paper presents a miniaturized microelectromechanical systems...... (MEMS) inductor and its performance in a very high frequency (VHF) power converter. The MEMS inductor is a siliconembedded air-core toroidal inductor, and it is constructed with through-silicon vias, suspended copper windings, silicon fixtures, and a silicon support die. The air-core inductors...

  12. Silicon Nitride Deposition for Flexible Organic Electronic Devices by VHF (162 MHz)-PECVD Using a Multi-Tile Push-Pull Plasma Source.

    Science.gov (United States)

    Kim, Ki Seok; Kim, Ki Hyun; Ji, You Jin; Park, Jin Woo; Shin, Jae Hee; Ellingboe, Albert Rogers; Yeom, Geun Young

    2017-10-19

    Depositing a barrier film for moisture protection without damage at a low temperature is one of the most important steps for organic-based electronic devices. In this study, the authors investigated depositing thin, high-quality SiN x film on organic-based electronic devices, specifically, very high-frequency (162 MHz) plasma-enhanced chemical vapor deposition (VHF-PECVD) using a multi-tile push-pull plasma source with a gas mixture of NH 3 /SiH 4 at a low temperature of 80 °C. The thin deposited SiN x film exhibited excellent properties in the stoichiometry, chemical bonding, stress, and step coverage. Thin film quality and plasma damage were investigated by the water vapor transmission rate (WVTR) and by electrical characteristics of organic light-emitting diode (OLED) devices deposited with SiN x , respectively. The thin deposited SiN x film exhibited a low WVTR of 4.39 × 10 -4  g (m 2 · day) -1 for a single thin (430 nm thick) film SiN x and the electrical characteristics of OLED devices before and after the thin SiN x film deposition on the devices did not change, which indicated no electrical damage during the deposition of SiN x on the OLED device.

  13. Estimation of mesospheric vertical winds from a VHF meteor radar at King Sejong Station, Antarctica (62.2S, 58.8W)

    Science.gov (United States)

    Kim, Y.; Lee, C.; Kim, J.; Jee, G.

    2013-12-01

    For the first time, vertical winds near the mesopause region were estimated from radial velocities of meteor echoes detected by a VHF meteor radar at King Sejong Station (KSS) in 2011 and 2012. Since the radar usually detects more than a hundred echoes every hour in an altitude bin of 88 - 92 km, much larger than other radars, we were able to fit measured radial velocities of these echoes with a 6 component model that consists of horizontal winds, spatial gradients of horizontal winds and vertical wind. The conventional method of deriving horizontal winds from meteor echoes utilizes a 2 component model, assuming that vertical winds and spatial gradients of horizontal winds are negligible. We analyzed the radar data obtained for 8400 hours in 2012 and 8100 hours in 2011. We found that daily mean values of vertical winds are mostly within +/- 1 m/s, whereas those of zonal winds are a few tens m/s mostly eastward. The daily mean vertical winds sometimes stay positive or negative for more than 20 days, implying that the atmosphere near the mesopause experiences episodically a large scale low and high pressure environments, respectively, like the tropospheric weather system. By conducting Lomb-normalized periodogram analysis, we also found that the vertical winds have diurnal, semidiurnal and terdiurnal tidal components with about equal significance, in contrast to horizontal winds that show a dominant semidiurnal one. We will discuss about uncertainties of the estimated vertical wind and possible reasons of its tidal and daily variations.

  14. Mesospheric Temperatures and Winds measured by a VHF Meteor Radar at King Sejong Station (62.2S, 58.8W), Antarctica

    Science.gov (United States)

    Kim, Yongha; Kim, Jeong-Han; Jee, Geonwha; Lee, Chang-Sup

    2010-05-01

    A VHF radar at King Sejong Station, Antarctica has been measuring meteor echoes since March 2007. Temperatures near the mesopause are derived from meteor decay times with an improved method of selecting meteor echo samples, and compared with airglow temperatures simultaneously observed by a spectral airglow temperature imager (SATI). The temperatures derived from meteor decay times are mostly consistent with the rotational temperatures of SATI OH(6-2) and O2(0-1) emissions from March through October. During southern summer when SATI cannot be operated due to brief night time, the meteor radar observation shows cold mesospheric temperatures, significantly lower than the CIRA86 model. The meteor radar observation also provides wind field information between 80 and 100 km of altitude. The measured meridional winds seem to follow the summer pole to winter pole circulation, and thus are correlated with the measured seasonal temperature change. However, the correlation between meridional winds and temperatures is not found in day by day base, as a previous study reported. Tidal characteristics of both zonal and meridional winds will also be compared with those of other Antarctic stations.

  15. Seasonal temperature variation around the mesopause inferred from a VHF meteor radar at King Sejong Station (62S, 59W), Antarctica

    Science.gov (United States)

    Kim, Yongha; Kim, Jeong-Han; Lee, Changsup; Jee, Gun-Hwa

    A VHF meteor radar, installed at King Sejong Station in March, 2007, has been detecting echoes from more than 20,000 meteors per day. Meteor echoes are decayed typically within seconds as meteors spread away by atmospheric diffusion. The diffusion coefficients can thus be obtained from decay times of meteor echo signals, providing with information on the atmospheric temperatures and pressures at meteor altitudes from 70 to 100 km. In this study, we present altitude profiles of 15-min averaged diffusion coefficients in each month, which clearly show a minimum at 80 - 85 km. The minimum appears at higher altitude during austral summer than winter, and seems to be near the lower level of two temperature minimum structure around the mesopause seen by TIMED/SABER data at high latitudes. The higher mesopause level (95-100 km) of the SABER data does not appear in our diffusion profiles probably because it is too close the limit of meaningful diffusion coefficients that can be derived from meteor decay detection. In order to understand temperature variation around the mesopause more directly, we will discuss various methods to extract temperature profiles from the diffusion profiles. We will also present monthly averaged OH and O2 airglow temperatures observed at the same site, and compare them with those derived from the meteor radar observation.

  16. A VHF Interleaved Self-Oscillating Resonant SEPIC Converter with Phase-Shift Burst-Mode Control

    DEFF Research Database (Denmark)

    Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    This paper presents design and implementation of the phase-shift burst-mode control method for interleaved selfoscillating resonant SEPIC converters for LED lighting applications. The proposed control method utilizes delays in the turn-on and turn-off of the power stage and control circuitry...... in order to reduce requirements for the comparator in the regulation circuit. The control method is experimentally evaluated on a 49 MHz dc-dc converter prototype, and the results are presented. The designed converter demonstrates peak efficiency of 81%, maintains efficiency above 75% from 20% load to full...

  17. Growth of crystallized Ge films from VHF inductively-coupled plasma of H2-diluted GeH4

    International Nuclear Information System (INIS)

    Sakata, T.; Makihara, K.; Murakami, H.; Higashi, S.; Miyazaki, S.

    2007-01-01

    We have studied the Ge crystalline nucleation and film growth on quartz substrate at 250 deg. C from inductively-coupled plasma (ICP) of GeH 4 diluted with H 2 . The ICP was generated by supplying 60 MHz power to an external single-turn antenna which was placed on a quartz plate window of a stainless steel reactor and parallel to the substrate. We have found that the growth rate is significantly increased when the preferential growth of the (110) plane becomes pronounced after the formation of randomly-oriented crystalline network. The (110) oriented Ge films, of which average crystallinity is as high as 70%. The integrated intensity ratio of TO phonons in crystalline phase to those in disordered phase, were grown at a rate of ∼ 4.0 nm/s after the formation of amorphous incubation layer with a thickness of ∼ 0.1 μm on quartz

  18. Investigation of inertia-gravity waves in the upper troposphere/lower stratosphere over Northern Germany observed with collocated VHF/UHF radars

    Directory of Open Access Journals (Sweden)

    A. Serafimovich

    2005-01-01

    Full Text Available A case study to investigate the properties of inertia-gravity waves in the upper troposphere/lower stratosphere has been carried out over Northern Germany during the occurrence of an upper tropospheric jet in connection with a poleward Rossby wave breaking event from 17-19 December 1999. The investigations are based on the evaluation of continuous radar measurements with the OSWIN VHF radar at Kühlungsborn (54.1 N, 11.8 E and the 482 MHz UHF wind profiler at Lindenberg (52.2 N, 14.1 E. Both radars are separated by about 265 km. Based on wavelet transformations of both data sets, the dominant vertical wavelengths of about 2-4 km for fixed times as well as the dominant observed periods of about 11 h and weaker oscillations with periods of  6 h for the altitude range between 5 and 8 km are comparable. Gravity wave parameters have been estimated at both locations separately and by a complex cross-spectral analysis of the data of both radars. The results show the appearance of dominating inertia-gravity waves with characteristic horizontal wavelengths of  300 km moving in the opposite direction than the mean background wind and a secondary less pronounced wave with a horizontal wavelength in the order of about 200 km moving with the wind. Temporal and spatial differences of the observed waves are discussed.

  19. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    The amplitude scintillations of very high frequency electromagnetic wave ... Scintillations at low latitude are known to occur in discrete patches [5,6] and are part .... weakly ionized plasma with a density gradient and a relative drift of ions and ...

  20. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  1. Microwave components for cellular portable radiotelephone

    Science.gov (United States)

    Muraguchi, Masahiro; Aikawa, Masayoshi

    1995-09-01

    Mobile and personal communication systems are expected to represent a huge market for microwave components in the coming years. A number of components in silicon bipolar, silicon Bi-CMOS, GaAs MESFET, HBT and HEMT are now becoming available for system application. There are tradeoffs among the competing technologies with regard to performance, cost, reliability and time-to-market. This paper describes process selection and requirements of cost and r.f. performances to microwave semiconductor components for digital cellular and cordless telephones. Furthermore, new circuit techniques which were developed by NTT are presented.

  2. Fuel cell/photovoltaic integrated power system for a remote telecommunications repeater

    Energy Technology Data Exchange (ETDEWEB)

    Lehman, P.; Chamberlin, C.; Zoellick, J.; Engel, R.; Rommel, D. [Humbolt State University, Arcata, CA (United States). Schatz Energy Research Center

    2002-07-01

    There is a special energy supply challenge associated with remote telecommunication systems, as they require reliable, unattended power system operation in areas and locations where there is no grid power. To supply back-up power to the Schoolhouse Peak remote photovoltaic-powered radio-telephone repeater located in Redwood National Park in northwestern California, the Schatz Energy Research Center built and operated a proton exchange membrane (PEM) fuel cell power system. In those instances where solar insolation is insufficient to maintain state-of-charge of the system's battery, the fuel cell automatically starts. Remote monitoring and control is made possible with the use of a cellular modem. The original fuel cell stack logged 3239 hours of run time in 229 days of operation. Subsequent to improvements and a rebuilt fuel cell stack, it operated for 3836 hours during 269 days. In this paper, system performance, long-term fuel cell voltage decay, and lessons learned and applied in system refurbishment were discussed. During this trial, the flawless performance of the hydrogen storage and delivery subsystem, the battery voltage-sensing relay, the safety shutdowns, and the remote data acquisition and control equipment was noted. To protect the stack from sudden temperature increases while minimizing unneeded parasitic loads, experience showed that a temperature-controlled fan switch, despite its additional complexity, was justified. 4 refs., 10 figs.

  3. 47 CFR 80.1095 - Survival craft equipment.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Survival craft equipment. 80.1095 Section 80... for Ship Stations § 80.1095 Survival craft equipment. (a) At least three two-way VHF radiotelephone... they can be rapidly placed in any survival craft other than life rafts required by Regulation III/26.1...

  4. 47 CFR 87.475 - Frequencies.

    Science.gov (United States)

    2010-10-01

    ... with simultaneous radiotelephone channels and their associated glide path station frequency from the...) VHF omni-range (VOR) stations are to be assigned frequencies in the 112.050-117.950 MHz band (50 kHz channel spacing) and the following frequencies in the 108-112 MHz band: 108.200 108.250 108.400 108.450...

  5. Enlaces de datos En VHF (VDL dentro del contexto CNS/ATM para la prestación de los servicios de tránsito aéreo en Colombia

    Directory of Open Access Journals (Sweden)

    Édgar Leonardo Gómez Gómez

    2012-09-01

    Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.

  6. Large power electron tubes for high frequency heating

    International Nuclear Information System (INIS)

    Okamoto, Tadashi; Sato, Hisaaki.

    1988-01-01

    On the large power electron tubes used for electron cyclotron heating, lower hybrid resonance frequency heating, and ion cyclotron range of frequency heating, namely gyrotron, klystron and quadrupole tube, the features, the present status of development, the construction, the principle and so on are explained. The research and development of gyrotrons are most advanced in USSR, the inventor. The course of the development of gyrotrons in foreign countries and in Japan is described. There are many variants of gyrotrons, for example whispering gallery mode, klystron type, backward wave oscillator type, gyro-peniotron and others. The principle of gyrotrons is explained, and about the examples of the developed gyrotrons, the design parameters are shown. For the purpose of using for the LHRF heating in JT-60, a superlarge power klystron of 1 MW output at 2 GHz frequency, which is the largest class in the world, has been developed. Its total length is 2.7 m, and weight is 1.5 t. It features, construction, function and performance are reported. The trend of large power quadrupole tubes is toward stable action with large power in VHF zone, and the typical products in USA and Europe are shown. (Kako, I.)

  7. 47 CFR 22.867 - Effective radiated power limits.

    Science.gov (United States)

    2010-10-01

    ... MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.867... operating on the frequency ranges listed in § 22.857 must not exceed the limits in this section. (a) The peak ERP of airborne mobile station transmitters must not exceed 12 Watts. (b) The peak ERP of ground...

  8. Horizontal maps of echo power in the lower stratosphere using the MU radar

    Directory of Open Access Journals (Sweden)

    M. Hirono

    2004-03-01

    Full Text Available In recent works, zenithal and azimuthal angle variations of echo power measured by VHF Stratosphere-Troposphere (ST radars have been analyzed in detail using different radar multi-beam configurations. It was found that the azimuthal angle corresponding to maximum echo power is closely related to the direction of the horizontal wind shear. These properties indicate that local wind shear affects the tilt of the scatterers. Moreover, horizontal maps of echo power collected using a large set of beams steered pulse-to-pulse up to 40 degrees off zenith revealed that the power distribution pattern in the troposphere is often skewed. In this work, a three-dimensional description of echo power variations up to 24 degrees off zenith is shown for measurements in the lower stratosphere (i.e. up to approximately 20km using a "sequential multi-beam" (SMB configuration. Such a description was not possible above the tropopause with classical multi-beam configurations because of the loss of radar sensitivity due to the limited integration time by the use of a large number of beams. This work attempts to complete previous descriptions of the phenomenon by some observations in the lower stratosphere discussed in association with complementary balloon measurements. Key words. Meteorology and atmospheric dynamics (turbulence – Radio Science (remote sensing

  9. Horizontal maps of echo power in the lower stratosphere using the MU radar

    Directory of Open Access Journals (Sweden)

    M. Hirono

    2004-03-01

    Full Text Available In recent works, zenithal and azimuthal angle variations of echo power measured by VHF Stratosphere-Troposphere (ST radars have been analyzed in detail using different radar multi-beam configurations. It was found that the azimuthal angle corresponding to maximum echo power is closely related to the direction of the horizontal wind shear. These properties indicate that local wind shear affects the tilt of the scatterers. Moreover, horizontal maps of echo power collected using a large set of beams steered pulse-to-pulse up to 40 degrees off zenith revealed that the power distribution pattern in the troposphere is often skewed. In this work, a three-dimensional description of echo power variations up to 24 degrees off zenith is shown for measurements in the lower stratosphere (i.e. up to approximately 20km using a "sequential multi-beam" (SMB configuration. Such a description was not possible above the tropopause with classical multi-beam configurations because of the loss of radar sensitivity due to the limited integration time by the use of a large number of beams. This work attempts to complete previous descriptions of the phenomenon by some observations in the lower stratosphere discussed in association with complementary balloon measurements.

    Key words. Meteorology and atmospheric dynamics (turbulence – Radio Science (remote sensing

  10. Pragmatic power

    CERN Document Server

    Eccles, William

    2008-01-01

    Pragmatic Power is focused on just three aspects of the AC electrical power system that supplies and moves the vast majority of electrical energy nearly everywhere in the world: three-phase power systems, transformers, and induction motors. The reader needs to have had an introduction to electrical circuits and AC power, although the text begins with a review of the basics of AC power. Balanced three-phase systems are studied by developing their single-phase equivalents. The study includes a look at how the cost of ""power"" is affected by reactive power and power factor. Transformers are cons

  11. A Reliable File Group Sending Method Based on Low-bandwidth VHF Radio%一种超短波电台低带宽下文件可靠群发方法

    Institute of Scientific and Technical Information of China (English)

    杨紫薇; 丁敬海; 张士军

    2016-01-01

    在现代连队指挥系统内,普遍采用无线超短波电台传输文件作为通信方式。传统的发送方式是发送方不断检测接收节点的应答帧来判断是否需要续传文件,但在文件群发过程中,发送方频繁查询接收方是否成功接收会严重占用带宽,造成网络瘫痪,从而导致文件传输成功率低下。然而作为连队指挥系统的可靠性要求之一,在超短波电台传输带宽较低(4800 KBps)的情况下,指挥车对作战单元群发文件的成功率决不能低于90%。为了解决这一难题,提出了一种新的文件可靠群发方法,该方法对发送方设计通信首帧,将文件分割编序封装并按周期顺序发送,同时各个接收节点对文件进行CRC校验,索引漏帧并主动发起补传要求。通过这种通信方法,连队通信网络内,指挥车可以一次将10 KB的文件发送至10个作战单元,经过测试,数据通信成功率保持在90%以上。%In company’ s modern command system,files transmission by wireless FM radio is a universal communication method. The traditional sending method is that the sender determines whether to resume files or not by detecting response frame continuously from the receiver. But during the file group sending process,if the sender checks the file transfer result from the receiver frequently,then bandwidth may be consumed seriously and network paralysis even arises,thus the low success rate of file transfer will be caused. As one of the reliability requirements of company command system,the success rate of file group transfer must reach more than 90% by low bandwidth VHF radio (4 800 Kbps). In order to solve this problem,a reliable file group sending method is proposed in this paper,in which a kind of head frame is designed for the sender. The files are divided into several frames,a sequence number is assigned to each frame,and then each file frame is sent in order. Meanwhile, the receivers

  12. Power corrupts

    International Nuclear Information System (INIS)

    Bacon, H.; Valentine, J.

    1981-01-01

    The subject is covered in chapters, entitled: radiation (hazards associated with nuclear power production); wastes (radioactive wastes); accidents (actual and postulated, resulting in the release of radiation); the FBR and the plutonium cycle; costs (economics of nuclear power); spent fuel transport; civil liberties; doing without nuclear power (UK power demand; low energy strategy; energy policy; government policies; alternative energy sources). (U.K.)

  13. Fusion power

    International Nuclear Information System (INIS)

    Hancox, R.

    1981-01-01

    The principles of fusion power, and its advantages and disadvantages, are outlined. Present research programmes and future plans directed towards the development of a fusion power reactor, are summarized. (U.K.)

  14. Power Electronics

    DEFF Research Database (Denmark)

    Iov, Florin; Ciobotaru, Mihai; Blaabjerg, Frede

    2008-01-01

    is to change the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. The other is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most...... emerging renewable energy sources, wind energy, which by means of power electronics are changing from being a minor energy source to be acting as an important power source in the energy system. Power electronics is the enabling technology and the presentation will cover the development in wind turbine...... technology from kW to MW, discuss which power electronic solutions are most feasible and used today....

  15. Normative Power

    DEFF Research Database (Denmark)

    's normative power than any other academic journal, including a special issue on "What Kind of Power?" in 2006. As the leading journal in the debate, this special issue brings together seven normative power articles published in JEPP since the 2006 special issue, together with Ian Manners' ‘Normative power......The social sciences have many different understandings of ‘normative power', but in European Union (EU) studies normative power has three particular meanings. The first meaning of normative power is its emphasis on normative theory, that is, how we judge and justify truth claims in social science...... effects of EU relations with the world in areas ranging from inter-regional relations, through traditional diplomacy, to environmental politics. Research areas of particular interest include the study of the interplay between physical, material and normative forms of power, as well as the constitutive...

  16. Power marketing

    International Nuclear Information System (INIS)

    Sioshansi, F.P.; Altman, A.M.

    1998-01-01

    One of the most significant developments in the US electric power industry in recent years has been the phenomenal growth of power marketing. What was barely a blimp on the radar screen in 1992 has turned out to be a jumbo jet. This article explains what is power marketing who are power marketers, what role play these players and what will be their longer-term impact on the traditional industry [it

  17. Power program and nuclear power

    International Nuclear Information System (INIS)

    Chernilin, Yu.F.

    1990-01-01

    Main points of the USSR power program and the role of nuclear power in fuel and power complex of the country are considered. Data on dynamics of economic indices of electric power generation at nuclear power plants during 1980-1988 and forecasts till 2000 are presented. It is shown that real cost of 1 kW/h of electric power is equal to 1.3-1.8 cop., and total reduced cost is equal to 1.8-2.4 cop

  18. Power Electronics

    Indian Academy of Sciences (India)

    They cover a wide spectrum of areas from power supplies to power system ... Ramanarayanan describe the modelling and design of a family of soft transition ... of power when the drive is operating in the braking mode and fast dynamic response. ... time models are extremely important, as they can be included in real time ...

  19. Power Outages

    Science.gov (United States)

    ... Publications Emergency Alerts Preparedness Portal Preparedness Messaging Calendar Social Media Preparedness Toolkits Preparedness News Languages About Us Build a Kit Close Search Enter Search Term(s): Main Content Home Be Informed Power Outages Power Outages Extended power outages may impact ...

  20. Nuclear Power

    International Nuclear Information System (INIS)

    Douglas-Hamilton, J.; Home Robertson, J.; Beith, A.J.

    1987-01-01

    In this debate the Government's policy on nuclear power is discussed. Government policy is that nuclear power is the safest and cleanest way of generating electricity and is cheap. Other political parties who do not endorse a nuclear energy policy are considered not to be acting in the people's best interests. The debate ranged over the risks from nuclear power, the UK safety record, safety regulations, and the environmental effects of nuclear power. The Torness nuclear power plant was mentioned specifically. The energy policy of the opposition parties is strongly criticised. The debate lasted just over an hour and is reported verbatim. (UK)

  1. Power Talk

    DEFF Research Database (Denmark)

    Angjelichinoski, Marko; Stefanovic, Cedomir; Popovski, Petar

    2016-01-01

    A standard way to realize communication in microgrid control is to use an external communication network, such as modems for wireless or power-line communication, whose implementation may be inefficient in terms of deployment cost, complexity, and system stability. In this chapter we present......, while its reliability and availability draw on the reliability and availability of the microgrid power transmission system....... a communication solution, denoted as power talk, which is solely based on the use of the existing microgrid power equipment (i.e., power electronics and buses). The pivotal idea is to modulate information in the power-related parameters of the microgrid buses by use of the flexibility of power electronic...

  2. Nuclear power

    International Nuclear Information System (INIS)

    Porter, Arthur.

    1980-01-01

    This chapter of the final report of the Royal Commission on Electric Power Planning in Ontario updates its interim report on nuclear power in Ontario (1978) in the light of the Three Mile Island accident and presents the commission's general conclusions and recommendations relating to nuclear power. The risks of nuclear power, reactor safety with special reference to Three Mile Island and incidents at the Bruce generating station, the environmental effects of uranium mining and milling, waste management, nuclear power economics, uranium supplies, socio-political issues, and the regulation of nuclear power are discussed. Specific recommendations are made concerning the organization and public control of Ontario Hydro, but the commission concluded that nuclear power is acceptable in Ontario as long as satisfactory progress is made in the disposal of uranium mill tailings and spent fuel wastes. (LL)

  3. Stockholm Power Tech. Power systems

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    The proceedings from this symposium is presented in six volumes: Invited speakers` sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume

  4. Stockholm Power Tech. Power systems

    International Nuclear Information System (INIS)

    1995-01-01

    The proceedings from this symposium is presented in six volumes: Invited speakers' sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume

  5. FY 1999 research and development of technologies for commercialization of photovoltaic power generation systems. Development of technologies for fabrication of thin-film solar cells/materials and substrates (Development of technologies for fabrication of high-quality amorphous materials and substrates); 1999 nendo taiyoko hatsuden system jitsuyoka gijutsu kaihatsu seika hokokusho. Usumaku taiyo denchi no seizo gijutsu kaihatsu / zairyo kiban seizo gijutsu kaihatsu (kohinshitsu amorphous kei zairyo kiban no seizo gijutsu kaihatsu)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    The research and development project is implemented for the amorphous/microcrystalline solar cells with the thin microcrystalline silicon film as the i layer, and the FY 1999 results are reported. The fabrication technologies are investigated for the microcrystalline silicon solar cells of pin or nip structure by RF or VHF plasma CVD using SiH{sub 4} and H{sub 2} as the stock gases. The tests are conducted for evaluating characteristics of the thin microcrystalline silicon film, to investigate the effects of film-making pressure, power and hydrogen dilution rate on the characteristics at a constant film-making temperature of 180 degrees C. The researches on the fabrication technologies for the microcrystalline solar cell of pin structure confirm that use of VHF plasma CVD improves crystallinity, electrical and optical characteristics of the p-type thin microcrystalline silicon film. The researches on the fabrication technologies for the microcrystalline solar cell of nip structure covers transparent substrates, film-making speed of the p layer, power and substrates, and a conversion efficiency of 7.5% is realized by the solar cell formed on a texture substrate. (NEDO)

  6. Southwestern Federal Power System 1995 Financial Statement audit under the Chief Financial Officers Act (WR-FC-96-02)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-22

    The Southwestern Federal Power System encompasses the operation of 24 hydroelectric power plants by the U.S. Army Corps of Engineers and the marketing of power and energy from those plants by the Southwestern Power Administration of the U.S. Department of Energy. To integrate the operation of these hydroelectric generating plants and to transmit power from the dams to its customers, Southwestern Power Administration (Southwestern) maintains 2,220 kilometers (1,380 miles) of high-voltage transmission lines, 24 substations, and 46 microwave and VHF radio sites. Southwestern`s headquarters are in Tulsa, Oklahoma; its dispatch center is in Springfield, Missouri; and its maintenance crews are based in Jonesboro, Arkansas, in Gore and Tupelo, Oklahoma, and in Springfield, Missouri. Three offices - Power Marketing and Delivery, Maintenance, and Administration and Rates - are responsible for meeting Southwestern`s mission. Twelve of the 24 generating plants are scheduled directly by Southwestern, and a total of 19 contribute to the interconnected system operations. Generation at the five remaining projects (Denison, Narrows, Sam Rayburn, Whitney, and Willis) is used to serve specific customer loads. At the end of fiscal year 1995, Southwestern marketed power and energy to 10 generation and transmission cooperatives, one distribution cooperative, three military installations, 44 municipal utilities, and three municipal utility joint-action agencies. One of the joint-action agencies has its own allocation of power from Southwestern; the other two serve 33 municipal utilities to whom Southwestern has allocated power. The total number of power allocation customers is 92. Additionally, excess energy is occasionally sold to non-allocation utilities.

  7. Nuclear power

    International Nuclear Information System (INIS)

    King, P.

    1990-01-01

    Written from the basis of neutrality, neither for nor against nuclear power this book considers whether there are special features of nuclear power which mean that its development should be either promoted or restrained by the State. The author makes it dear that there are no easy answers to the questions raised by the intervention of nuclear power but calls for openness in the nuclear decision making process. First, the need for energy is considered; most people agree that energy is the power to progress. Then the historicalzed background to the current position of nuclear power is given. Further chapters consider the fuel cycle, environmental impacts including carbon dioxide emission and the greenhouse effect, the costs, safety and risks and waste disposal. No conclusion either for or against nuclear power is made. The various shades of opinion are outlined and the arguments presented so that readers can come to their own conclusions. (UK)

  8. Cyber Power

    Science.gov (United States)

    2010-05-01

    government. Another way of looking at power in the cyber domain is to consider the three faces or aspects of relational power. 1st Face: (A induces B do...power. For example, on the February 2010 anniversary of the Iranian Revolution, the government slowed the internet to prevent protesters sending films ...all but a few government controlled Web sites. The damage to business and tourism was significant, but the Chinese government was more concerned

  9. Star power

    International Nuclear Information System (INIS)

    Kennedy, Tom

    2003-01-01

    Discusses the fight over the diminishing supply of fossil fuels and how there could be an unlimited, clean and politically free source of power just over the horizon. Fusion was discovered as a much better, inexhaustable supply of power, it only takes a few atoms to fuse for fusion to take off. Fusion once started will continue until all the fuel is exhausted. It is expected, that with the current rate of progess, in fifty years time scientists will achieve practical fusion power

  10. Power Talk

    DEFF Research Database (Denmark)

    Liu, Hongpeng; Yang, Yongheng; Loh, Poh Chiang

    2016-01-01

    In this paper, a novel communication strategy called Power Talk is introduced to realize the power line communication among the Voltage Source Converters (VSC) of DC MicroGrids (MGs). Each VSC transmits information by changing the control parameters, and receives information by observing the local...

  11. Power Talk

    DEFF Research Database (Denmark)

    Stefanovic, Cedomir; Popovski, Petar; Angjelichinoski, Marko

    2015-01-01

    We introduce a novel communication strategy for DC Micro Grids (MGs), termed power talk, in which the devices communicate by modulating the power levels in the DC bus. The information is transmitted by varying the parameters that the MG units use to control the level of the common bus voltage...

  12. Nuclear power

    International Nuclear Information System (INIS)

    Abd Khalik Wood

    2003-01-01

    This chapter discuss on nuclear power and its advantages. The concept of nucleus fission, fusion, electric generation are discussed in this chapter. Nuclear power has big potential to become alternative energy to substitute current conventional energy from coal, oil and gas

  13. Power Electronics

    Indian Academy of Sciences (India)

    Such real time models are extremely important, as they can be included in real time simulation of sys- tems to evolve control schemes for the converters as well as to study the effect on the power system. In view of the control possibilities offered by the use of power converters and the newly emerging applications, there has ...

  14. Powering Mexico

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This article examines Mexico's demand for electricity and the market for independent power generation. The topics discussed in the article include the outlook for the 1990s for growth in Mexico's economy and energy demand, renewable energy, energy conservation, small-scale, off-grid renewable energy systems, and estimates of Mexico's market for electric power generating equipment

  15. Pulsed power

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    The key element of our pulsed power program is concentration of power in time and space by suppression of breakdown in dielectrics and in vacuum. Magnetically insulated vacuum transmission lines and magnetic suppression of insulator flashover have continued as the main reserch directions. Vacuum insulated line studies at Physics International have been expanded and a test bed at Sandia, called MITE (Magnetically Insulated Transmission Experiment), is under development. The choice for the baseline EBFA design will depend on the outcome of these studies and should be made in July 1977. The slow and intermediate speed pulsed power approaches to EBFA will be based on Proto I and Proto II results and several of the projected EBFA subsystems are presently being tested in Proto II. A further stage of power concentration, within the vacuum diode itself, would considerably ease the burden on dielectrics; methods of power multiplication involving magnetically imploded plasmas are being considered and tests have begun using the Ripple III apparatus

  16. Nuclear power

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    The committee concludes that the nature of the proliferation problem is such that even stopping nuclear power completely could not stop proliferation completely. Countries can acquire nuclear weapons by means independent of commercial nuclear power. It is reasonable to suppose if a country is strongly motivated to acquire nuclear weapons, it will have them by 2010, or soon thereafter, no matter how nuclear power is managed in the meantime. Unilateral and international diplomatic measures to reduce the motivations that lead to proliferation should be high on the foreign policy agenda of the United States. A mimimum antiproliferation prescription for the management of nuclear power is to try to raise the political barriers against proliferation through misuse of nuclear power by strengthening the Non-Proliferation Treaty, and to seek to raise the technological barriers by placing fuel-cycle operations involving weapons-usable material under international control. Any such measures should be considered tactics to slow the spread of nuclear weapons and thus earn time for the exercise of statesmanship. The committee concludes the following about technical factors that should be considered in formulating nuclear policy: (1) rate of growth of electricity use is a primary factor; (2) growth of conventional nuclear power will be limited by producibility of domestic uranium sources; (3) greater contribution of nuclear power beyond 400 GWe past the year 2000 can only be supported by advanced reactor systems; and (4) several different breeder reactors could serve in principle as candidates for an indefinitely sustainable source of energy

  17. Power generation

    International Nuclear Information System (INIS)

    Nunez, Anibal D.

    2001-01-01

    In the second half of twentieth century, nuclear power became an industrial reality. Now the operating 433 power plants, the 37 plants under construction, near 9000 years/reactor with only one serious accident with emission of radioactive material to the environment (Chernobyl) show the maturity of this technology. Today nuclear power contribute a 17% to the global generation and an increase of 75 % of the demand of electricity is estimated for 2020 while this demand is expected to triplicate by 2050. How this requirement can be satisfied? All the indicators seems to demonstrate that nuclear power will be the solution because of the shortage of other sources, the increase of the prices of the non renewable fuels and the scarce contribution of the renewable ones. In addition, the climatic changes produced by the greenhouse effect make even more attractive nuclear power. The situation of Argentina is analyzed and compared with other countries. The convenience of an increase of nuclear power contribution to the total national generation seems clear and the conclusion of the construction of the Atucha II nuclear power plant is recommended

  18. Nuclear power

    International Nuclear Information System (INIS)

    Abd Khalik Wood

    2005-01-01

    This chapter discussed the following topics related to the nuclear power: nuclear reactions, nuclear reactors and its components - reactor fuel, fuel assembly, moderator, control system, coolants. The topics titled nuclear fuel cycle following subtopics are covered: , mining and milling, tailings, enrichment, fuel fabrication, reactor operations, radioactive waste and fuel reprocessing. Special topic on types of nuclear reactor highlighted the reactors for research, training, production, material testing and quite detail on reactors for electricity generation. Other related topics are also discussed: sustainability of nuclear power, renewable nuclear fuel, human capital, environmental friendly, emission free, impacts on global warming and air pollution, conservation and preservation, and future prospect of nuclear power

  19. Nuclear power

    International Nuclear Information System (INIS)

    Bupp, I.C.

    1991-01-01

    Is a nuclear power renaissance likely to occur in the United States? This paper investigates the many driving forces that will determine the answer to that question. This analysis reveals some frequently overlooked truths about the current state of nuclear technology: An examination of the issues also produces some noteworthy insights concerning government regulations and related technologies. Public opinion will play a major role in the unfolding story of the nuclear power renaissance. Some observers are betting that psychological, sociological, and political considerations will hod sway over public attitudes. Others wager that economic and technical concerns will prevail. The implications for the nuclear power renaissance are striking

  20. Nuclear power

    International Nuclear Information System (INIS)

    1987-01-01

    ''Nuclear Power'' describes how a reactor works and examines the different designs including Magnox, AGR, RBMK and PWR. It charts the growth of nuclear generation in the world and its contributions to world energy resources. (author)

  1. Power stations

    International Nuclear Information System (INIS)

    Cawte, H.; Philpott, E.F.

    1980-01-01

    The object is to provide a method of operating a dual purpose power station so that the steam supply system is operated at a high load factor. The available steam not required for electricity generation is used to provide process heat and the new feature is that the process plant capacity is determined to make the most economic use of the steam supply system, and not to match the passout capacity of the turbine of the turbogenerator. The product of the process plant should, therefore, be capable of being stored. A dual-purpose power station with a nuclear-powered steam source, turbogenerating means connected to the steam source and steam-powered process plant susceptible to wide variation in its rate of operation is described. (U.K.)

  2. Introduction to electrical power and power electronics

    CERN Document Server

    Patel, Mukund R

    2012-01-01

    Power Generation, Distribution, and Utilization AC Power Fundamentals Common Aspects of Power Equipments AC Generator AC and DC Motors Transformer Power Cable Power Distribution Fault Current Analysis System ProtectionEconomic Use of PowerElectrochemical BatteryPower Electronics and Motor Drives Power Electronics Devices DC-DC Converters AC-DC-AC Converters Variable-Frequency Drives Quality of Power Power Converter CoolingAppendixIndex

  3. Results of tests of the X2274 high power tetrode in a JT-60 110 to 130 MHz ICRH amplifier

    International Nuclear Information System (INIS)

    Remsen, D.B.; Loring, C.M.; McNees, S.G.; Moriyama, S.; Ogawa, Y.; Anno, K.; Fujii, T.; Terakado, M.; Kogure, S.; Nagashima, T.; Ohta, M.

    1990-09-01

    This paper reports the results of tests of the newly developed Varian EIMAC X2274 in the JAERI JT-60 ICRH system at pulse lengths up to 6 seconds at 131 MHz. It is our belief that these tests achieved the highest long pulse, or CW, power that has ever been delivered by a single power grid tube at frequencies above 100 MHz. Varian's EIMAC X2274, developed in conjunction with General Atomics and the US Department of Energy, uses an improved pyrolytic graphite grid configuration which provides significantly better vhf performance than the grids of the X2242 tetrode which was tested in this system in 1989. The EIMAC X2274 combines the improved grids with a new anode design which reduces the required water flow approximately 50% and increases the maximum anode dissipation 80%. All tests were performed at 131 MHz, the system's highest operating frequency. Tests of both prototype EIMAC X2274s produced essentially identical results. The basic objectives of these tests were: to demonstrate that the system with the EIMAC X2274 can reliably produce 1.5 MW at 130 MHz at 5 second pulse lengths for the JT-60U tokamak and to collect data for use in the design of future high power ICRH systems. In these tests the tube and system produced up to 1.7 MW at pulse lengths up to 5.4 seconds: i.e, the EIMAC X2274 in this system can easily meet Objective 1. The remainder of this paper shows that Objective 2 has been fulfilled. In addition to the high power tests, operational range tests were performed under variable VSWR conditions. Unlike the EIMAC X2242 tests were rf current heating of the screen grid limited output power, system parameters, rather than tube parameters, limited the output power in the high power tests. Operational range tests were conducted at output power levels chosen to be well within the system's anode cooling capability

  4. Wind power

    International Nuclear Information System (INIS)

    Gipe, P.

    2007-01-01

    This book is a translation of the edition published in the USA under the title of ''wind power: renewable energy for home, farm and business''. In the wake of mass blackouts and energy crises, wind power remains a largely untapped resource of renewable energy. It is a booming worldwide industry whose technology, under the collective wing of aficionados like author Paul Gipe, is coming of age. Wind Power guides us through the emergent, sometimes daunting discourse on wind technology, giving frank explanations of how to use wind technology wisely and sound advice on how to avoid common mistakes. Since the mid-1970's, Paul Gipe has played a part in nearly every aspect of wind energy development from installing small turbines to promoting wind energy worldwide. As an American proponent of renewable energy, Gipe has earned the acclaim and respect of European energy specialists for years, but his arguments have often fallen on deaf ears at home. Today, the topic of wind power is cropping up everywhere from the beaches of Cape Cod to the Oregon-Washington border, and one wind turbine is capable of producing enough electricity per year to run 200 average American households. Now, Paul Gipe is back to shed light on this increasingly important energy source with a revised edition of Wind Power. Over the course of his career, Paul Gipe has been a proponent, participant, observer, and critic of the wind industry. His experience with wind has given rise to two previous books on the subject, Wind Energy Basics and Wind Power for Home and Business, which have sold over 50,000 copies. Wind Power for Home and Business has become a staple for both homeowners and professionals interested in the subject, and now, with energy prices soaring, interest in wind power is hitting an all-time high. With chapters on output and economics, Wind Power discloses how much you can expect from each method of wind technology, both in terms of energy and financial savings. The book updated models

  5. Malaysia power

    Energy Technology Data Exchange (ETDEWEB)

    Husin, Z.A. (Tenaga Nasional Berhad (Malaysia))

    1994-09-01

    Describes the organisation of the Malaysian electric power industry and the role of natural gas and coal in power generation in the country. At present, electricity is produced by three utilities: Tenaga Nasional Berhad (TNB) which was fully privatised in May 1992 with the Government holding about 73% of the equity, Sarawak Electricity Supply Corporation (SESCO) which the Government plans to privatise soon, and Sabah Electricity Board (SEB). These have installed capacities of 7000 MW, 400 MW and 350 MW, respectively. Five independent power producers have been given licences to build, own and operate power plants with a total installed capacity of 4000 MW. Natural gas is expected to account for about 72% of Malaysia's power generating fuel by the year 2010, compared to about 50% at present. Malaysia currently has only one coal-fired plant, but its expansion is in the final stage of contract awards. A number of small capacity coal-fired plants are being planned for Sabah and Sarawak where the bulk of Malaysia's coal resources are located. 3 figs., 1 photo.

  6. Wind power

    International Nuclear Information System (INIS)

    2009-01-01

    At the end of 2008,the European wind power capacity had risen to 65,247 MW which is a 15,1% increase on 2007. The financial crisis does not appear to have any real consequences of the wind power sector's activity in 2008. At the end of 2008 the European Union accommodated 53,9% of the world's wind power capacity. The top ten countries in terms of installed wind capacities are: 1) Usa with 25,388 MW, 2) Germany with 23,903 MW, 3) Spain with 16,740 MW, 4) China with 12,200 MW, 5) India with 9,645 MW, 6) Italy with 3,736 MW, 7) France with 3,542 MW, 8) U.K. with 3,406 MW, 9) Denmark with 3,166 MW and 10) Portugal with 2,862 MW. (A.C.)

  7. Developing powers

    Science.gov (United States)

    Showstack, Randy

    Three new reports commissioned by the Pew Center on Global Climate Change examine the electric power sectors in Argentina, Brazil, and China, and the potential impact that energy use in each country has on climate change.In 1999, Argentina voluntarily agreed to lower its greenhouse gas emissions to 2 10% below projected emissions for 2012. The report looks at additional steps that could further reduce emissions, including adopting policies that favor renewable energy sources and nuclear power, and increasing energy efficiency by end-users.

  8. Tidal power

    International Nuclear Information System (INIS)

    Baker, A.C.

    1991-01-01

    This book describes how large tides develop in particular places and how the energy could be extracted by building suitable barrages. The principal features of a barrage and possible methods of operation are described in detail. Although a tidal power barrage would be non-polluting, the resulting changes in the tidal regime would have important environmental effects. These are discussed together with the economics of tidal power. Methods of assessing the likely cost of electricity from any site are set out and applied to possible sites around the world. (author)

  9. Power electronics

    Indian Academy of Sciences (India)

    Kishore Chatterjee

    This special issue of Sadhana is a compilation of papers selected from those presented at the 7th National Power. Electronics Conference (NPEC), held at the Indian Institute of Technology, Bombay, on 21–23 December 2015. From among the papers presented in NPEC-2017, selected papers were peer-reviewed for ...

  10. Wind power

    International Nuclear Information System (INIS)

    2006-06-01

    This road-map proposes by the Group Total aims to inform the public on the wind power. It presents the principles, the technology takes off, its applications and technology focus, the global market trends and the outlooks and Total commitments in the domain. (A.L.B.)

  11. Comic Power

    DEFF Research Database (Denmark)

    Tønder, Lars

    2014-01-01

    Inspired by the growing attention to the politics of comedy in the United States and elsewhere, this article asks what it would mean to think critically about relations of power mobilized through cheerfulness, humor, and laughter. The article shows that existing answers to this question are tainted...

  12. Plug Power

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, A. [Plug Power Inc., New York, NY (United States)

    2009-07-01

    This presentation described Plug Power's GenDrive hydrogen fuel cell unit that supplies the power needs for folk lift trucks used in high-throughput distribution and high-volume manufacturing operations. The system offers an alternative to lead acid batteries, providing maximum performance at all times during use. The system is particularly useful in the material handling industry, where the revenue generated is based on operator uptime and lift truck productivity. The use of the system allows customers to reduce operational costs and expand valuable floor space by eliminating batteries and associated recharging infrastructure. Fuel cell units also reduce the wear on truck motors. Truck operators can easily and safely refuel at hydrogen fueling stations in 1-5 minutes. GenDrive works with all major OEM lift trucks, making the transition seamless. Commercial customers are investing in this solution to improve their current operations. In 2008, Plug Power sold to Wal-Mart, Bridgestone Firestone and Nestle. Most notably, Central Grocers purchased 220 fuel cell units for a new greenfield distribution center. Plug Power currently has more than 380 systems in operation.

  13. Nuclear power

    Energy Technology Data Exchange (ETDEWEB)

    Hodgson, P.

    1985-01-01

    The question 'Do we really need nuclear power' is tackled within the context of Christian beliefs. First, an estimate is made of the energy requirements in the future and whether it can be got in conventional ways. The dangers of all the ways of supplying energy (eg coal mining, oil and gas production) are considered scientifically. Also the cost of each source and its environmental effects are debated. The consequences of developing a new energy source, as well as the consequences of not developing it, are considered. Decisions must also take into account a belief about the ultimate purpose of life, the relation of men to each other and to nature. Each issue is raised and questions for discussion are posed. On the whole the book comes down in favour of nuclear power.

  14. Pulsed power

    International Nuclear Information System (INIS)

    Anon.

    1978-01-01

    Options for EBFA-I were narrowed as data became available from Proto II, MITE and power flow research. The solid dielectric capacitors proposed for intermediate stores have been eliminated for EBFA because of low reliability. Water capacitors based on data from Proto II and Hydra will be used on EBFA. Improved SF-6 switching data from Proto II shows that present parameters are adequate for EBFA. A switch jitter of 3 ns with reliability exceeding 0.986 was demonstrated. Proto II has achieved the design output and is now a user oriented accelerator. Several desirable features of the disc accelerator were proven. Initial magnetic insulation experiments on a 1.5 m-long-triplate show small energy and power losses. Theoretical understanding of magnetic insulation was greatly enhanced and agreement between projections and experiment were obtained

  15. Power grids

    International Nuclear Information System (INIS)

    Viterbo, J.

    2012-01-01

    The implementation of renewable energies represents new challenges for electrical systems. The objective: making power grids smarter so they can handle intermittent production. The advent of smart grids will allow flexible operations like distributing energy in a multidirectional manner instead of just one way and it will make electrical systems capable of integrating actions by different users, consumers and producers in order to maintain efficient, sustainable, economical and secure power supplies. Practically speaking, they associate sensors, instrumentation and controls with information processing and communication systems in order to create massively automated networks. Smart grids require huge investments: for example more than 7 billion dollars have been invested in China and in the Usa in 2010 and France is ranked 9. worldwide with 265 million dollars invested. It is expected that smart grids will promote the development of new business models and a change in the value chain for energy. Decentralized production combined with the probable introduction of more or less flexible rates for sales or purchases and of new supplier-customer relationships will open the way to the creation of new businesses. (A.C.)

  16. Wind power

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-01

    This publication describes some of the technical, economic, safety and institutional considerations involved in the selection, installation and evaluation of a wind generation system. This information is presented, where possible, in practical, non-technical terms. The first four sections provide background information, theory, and general knowledge, while the remaining six sections are of a more specific nature to assist the prospective owner of a wind generator in his calculations and selections. Meteorological information is provided relating to the wind regime in Nova Scotia. The section on cost analysis discusses some of the factors and considerations which must be examined in order to provide a logical comparison between the alternatives of electricity produced from other sources. The final two sections are brief summaries of the regulations and hazards pertaining to the use of wind generators. The cost of wind-generated electricity is high compared to present Nova Scotia Power Corporation rates, even on Sable Island, Nova Scotia's highest wind area. However, it may be observed that Sable Island is one of the areas of Nova Scotia which is not presently supplied through the power grid and, particularly if there was a significant increase in the price of diesel oil, wind-generated electricity may well be the most economical alternative in that area. Generally speaking, however, where a consumer can purchase electricity at the normal domestic rate, wind generators are not economical, and they will not become economical unless there is a great reduction in their cost, an great increase in electricity rates, or both. Includes glossary. 23 figs., 11 tabs.

  17. Characteristics of the E - and F -region field-aligned irregularities in middle latitudes: Initial results obtained from the Daejeon 40.8 MHz VHF radar in South Korea

    Directory of Open Access Journals (Sweden)

    Young-Sil Kwak

    2014-03-01

    Full Text Available We present preliminary observations of the field-aligned-irregularities (FAIs in the E and F regions during the solar minimum (2009 - 2010 using the 40.8 MHz coherent backscatter radar at Daejeon (36.18°N, 127.14°E, 26.7°N dip latitude in South Korea. The radar, which consists of 24 Yagi antennas, observes the FAIs using a single beam with a peak power of 24 kW. The radar has been continuously operated since December 2009. Depending on the manner of occurrence of the backscatter echoes, the E-region echoes are largely divided into two types: quasi-periodic (QP and continuous echoes. Our observations show that the QP echoes occur frequently above an altitude of 105 km in the post-sunset period and continuous echoes occur preferentially around an altitude of 105 km in the post-sunrise period. QP echoes appear as striated discrete echoes for a period of about 10 - 20 min. The QP-type echoes occur more frequently than the continuoustype echoes do and the echo intensity of the QP type is stronger than that of the continuous type. In the F region, the FAIs occur at night at an altitude interval of 250 - 450 km. As time proceeds, the occurrence height of the FAIs gradually increases until early in the morning and then decreases. The duration of the F-region FAIs is typically a few hours at night, although, in rare cases, FAIs persist throughout the night or appear even after sunrise. We discuss the similarities and differences of the FAIs observed by the Daejeon radar in comparison with other radar observations.

  18. Power manager and method for managing power

    NARCIS (Netherlands)

    Burchard, A.T.; Kersten, G.; Molnos, A.M.; Milutinovic, A.; Goossens, K.G.W.; Steffens, E.F.M.

    2009-01-01

    A power manager (106) and method for managing the power supplied to an electronic device is provided. Furthermore, a system wherein the power supplied to an electronic device is managed is provided. The power manager (106) is operative to monitor a hardware monitor (104) during a monitoring time

  19. Water Power Research | Water Power | NREL

    Science.gov (United States)

    Water Power Research Water Power Research NREL conducts water power research; develops design tools ; and evaluates, validates, and supports the demonstration of innovative water power technologies. Photo of a buoy designed around the oscillating water column principle wherein the turbine captures the

  20. Power theories for improved power quality

    CERN Document Server

    Pasko, Marian

    2012-01-01

    Power quality describes a set of parameters of electric power and the load’s ability to function properly under specific conditions. It is estimated that problems relating to power quality costs the European industry hundreds of billions of Euros annually. In contrast, financing for the prevention of these problems amount to fragments of these costs. Power Theories for Improved Power Quality addresses this imbalance by presenting and assessing a range of methods and problems related to improving the quality of electric power supply. Focusing particularly on active compensators and the DSP based control algorithms, Power Theories for Improved Power Quality introduces the fundamental problems of electrical power. This introduction is followed by chapters which discuss: •‘Power theories’ including their historical development and application to practical problems, •operational principles of active compensator’s DSP control based algorithms using examples and results from laboratory research, and •t...

  1. Women, Power, and Libraries.

    Science.gov (United States)

    Schuman, Patricia Glass

    1984-01-01

    Discusses the concept of power in the context of women and the library profession, citing views of power by Max Weber, John Kenneth Galbraith, Letty Cottin Pogrebin, and Rosabeth Moss Kantor. Male power and female submission, defining power, organizing for power, and sharing power are highlighted. A 12-item bibliography is included. (EJS)

  2. Wind Power - A Power Source Enabled by Power Electronics

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Chen, Zhe

    2004-01-01

    . The deregulation of energy has lowered the investment in bigger power plants, which means the need for new electrical power sources may be very high in the near future. Two major technologies will play important roles to solve the future problems. One is to change the electrical power production sources from......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. The production, distribution and the use of the energy should be as technological efficient as possible and incentives to save energy at the end-user should be set up...... the conventional, fossil (and short term) based energy sources to renewable energy sources. The other is to use high efficient power electronics in power systems, power production and end-user application. This paper discuss the most emerging renewable energy source, wind energy, which by means of power...

  3. Radio tomography and scintillation studies of ionospheric electron density modification caused by a powerful HF-wave and magnetic zenith effect at mid-latitudes

    International Nuclear Information System (INIS)

    Tereshchenko, E.D.; Khudukon, B.Z.; Gurevich, A.V.; Zybin, K.P.; Frolov, V.L.; Myasnikov, E.N.; Muravieva, N.V.; Carlson, H.C.

    2004-01-01

    Observations of the ionospheric electron density modified by a powerful wave of the Sura HF heating facility were carried out in Russia at middle latitudes in August 2002. Amplitude scintillations and variations of the phase of VHF signals from Russian orbiting satellites passing over the heated region along the chain of three satellite receivers have been recorded. The experimental data were converted to electron density maps using a stochastic inversion. Tomographic measurements conducted during a low magnetic activity revealed that HF powerful waves can produce significant electron density disturbances up to heights significantly exceeding altitudes of the F layer peak. Both large-scale plasma enhancements and small-scale density irregularities can be generated by the HF radiation. Wavy density structures were also observed within a sector which is much wider than the area covered by the main lobe of the heating antenna. Small-scale density irregularities are mostly field-aligned although large-scale structures can be detected within a much larger area. A distinctive peculiarity of electron density changes occurred during heating is producing a zone of low density inside the area illuminated by the antenna beam. The results indicate that satellite radio tomography and scintillation measurements are effective diagnostic techniques giving a valuable information to studies of effects induced by HF modification. The complete system of plasma density disturbances describing by the theory of 'the magnetic zenith effect' has been for the first time studied in this Letter. A good agreement between the theory and experimental data has been obtained

  4. EMC Investigation of a Very High Frequency Self-oscillating Resonant Power Converter

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Knott, Arnold; Andersen, Michael A. E.

    2016-01-01

    This paper focuses on the electromagnetic compatibility (EMC) performance of a Very High Frequency (VHF) converter and how to lower the emissions. To test the EMC performance a VHF converter is implemented with a Class-E inverter and a Class-DE rectifier. The converter is designed to deliver 3 W...... the regulations. This converter shows to be well below the levels for conducted emission even without filtering. For the radiated emissions the converter is above the limits without input and output filters. Several designs with different ways to lower the emissions are implemented and the different layouts...

  5. Wind power - a power source now enabled by power electronics

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Iov, Florin

    2007-01-01

    energy at the end-user should be set up. Deregulation of energy has lowered the investment in larger power plants, which means the need for new electrical power sources may be increased in the near future. Two major technologies will play important roles to solve the future problems. One is to change......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. It is expected that it has to be doubled within 20 years. The production, distribution and use of the energy should be as technological efficient as possible and incentives to save...... the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. Another is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most emerging...

  6. Powering down

    International Nuclear Information System (INIS)

    Haas, Elisabeth de

    2002-01-01

    Full text: In 1997 and as a result of political developments in the Dutch government's energy policy, the Nuclear Power Plant (NPP) Dodewaard was forced to stop producing electricity for the national grid. As a consequence, plans for the decommissioning of the NPP were developed. For the Netherlands this is a first-of-a-kind project: so far no nuclear installation has been actually dismantled in this country. GKN, the operator of NPP Dodewaard, started a vast decommissioning project. Four years elapsed before a concept was ready for the licence required to carry out the plans. The scope of activities is as follows. Once all spent fuel has been removed from the site the installation will be brought into a state of so-called Safe Enclosure, which will ensure that all radioactivity remaining inside components and buildings, can be kept safely locked in for a period of 40 years. At the end of this 40 year waiting period, when radiation levels will have dropped considerably in a natural way, the NPP will be dismantled and the grounds on which the complex was built can return to be the green meadow-land they once were. The process of convincing the Dutch government and obtaining approval for these plans took a lot of time and effort from GKN's side. Now - almost five years later - we have reached the stage that the text of the concept licence has been made public to the Dutch citizens who, within a defined period of time, may submit any objections they have, prior to the licence becoming final. In the Netherlands a majority of the people are not exactly enthusiastic about nuclear. Therefore, PR matters related to the Dodewaard NPP are mostly been handled low-key and in a reactive way rather than pro-actively. But with respect to the plans for the future of the Dodewaard plant, operator GKN felt a distinct obligation to inform in a timely and active manner both our government as well as the man in the street. With that objective in mind, we decided to develop an in

  7. Power generation by nuclear power plants

    International Nuclear Information System (INIS)

    Bacher, P.

    2004-01-01

    Nuclear power plays an important role in the world, European (33%) and French (75%) power generation. This article aims at presenting in a synthetic way the main reactor types with their respective advantages with respect to the objectives foreseen (power generation, resources valorization, waste management). It makes a fast review of 50 years of nuclear development, thanks to which the nuclear industry has become one of the safest and less environmentally harmful industry which allows to produce low cost electricity: 1 - simplified description of a nuclear power generation plant: nuclear reactor, heat transfer system, power generation system, interface with the power distribution grid; 2 - first historical developments of nuclear power; 3 - industrial development and experience feedback (1965-1995): water reactors (PWR, BWR, Candu), RBMK, fast neutron reactors, high temperature demonstration reactors, costs of industrial reactors; 4 - service life of nuclear power plants and replacement: technical, regulatory and economical lifetime, problems linked with the replacement; 5 - conclusion. (J.S.)

  8. Reactor power control device

    International Nuclear Information System (INIS)

    Ishii, Yoshihiko; Arita, Setsuo; Miyamoto, Yoshiyuki; Fukazawa, Yukihisa; Ishii, Kazuhiko

    1998-01-01

    The present invention provides a reactor power control device capable of enhancing an operation efficiency while keeping high reliability and safety in a BWR type nuclear power plant. Namely, the device of the present invention comprises (1) a means for inputting a set value of a generator power and a set value of a reactor power, (2) a means for controlling the reactor power to either smaller one of the reactor power corresponding to the set value of the generator power and the set value of the reactor power. With such procedures, even if the nuclear power plant is set so as to operate it to make the reactor power 100%, when the generator power reaches the upper limit, the reactor power is controlled with a preference given to the upper limit value of the generator power. Accordingly, safety and reliability are not deteriorated. The operation efficiency of the plant can be improved. (I.S.)

  9. Switching power converters medium and high power

    CERN Document Server

    Neacsu, Dorin O

    2013-01-01

    An examination of all of the multidisciplinary aspects of medium- and high-power converter systems, including basic power electronics, digital control and hardware, sensors, analog preprocessing of signals, protection devices and fault management, and pulse-width-modulation (PWM) algorithms, Switching Power Converters: Medium and High Power, Second Edition discusses the actual use of industrial technology and its related subassemblies and components, covering facets of implementation otherwise overlooked by theoretical textbooks. The updated Second Edition contains many new figures, as well as

  10. Rethinking Family Power.

    Science.gov (United States)

    Kranichfeld, Marion L.

    1987-01-01

    Men's power is emphasized in the family power literature on marital decision making. Little attention has been paid to women's power, accrued through their deeper embeddedness in intrafamilial roles. Micro-level analysis of family power demonstrates that women's positions in the family power structure rest not on the horizontal marital tie but…

  11. Dicty_cDB: VHF408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MTYF9_FA... 33 7.5 CP000568_3082( CP000568 |pid:none) Clostridium thermocellum ATCC 2... 33 9.8 AY698035_1(... AY698035 |pid:none) Desmognathus marmoratus isolate 69... 33 9.8 protein update 2009. 3. 3 PSORT psg: 0.69

  12. Characteristics of ionospheric irregularities causing scintillations at VHF/UHF

    International Nuclear Information System (INIS)

    Vats, H.O.; Deshpande, M.R.; Rastogi, R.G.

    1978-01-01

    Some properties of ionization irregularities using amplitude scintillation records of radio beacons from ATS-6 (phase II) at Ootacamund, India have been investigated. For the estimation of scale-size and strength of the irregularities a simple diffraction model has been used which explains only weak and moderate equatorial scintillation observations. It was found that the scale sizes of day time E-region irregularities are smaller than those in the F-region during night time in addition, irregularities are generated initially at large scale sizes which later break up into smaller scale sizes

  13. Lightning initiation: Strong pulses of VHF radiation accompany preliminary breakdown

    Czech Academy of Sciences Publication Activity Database

    Kolmašová, Ivana; Santolík, Ondřej; Defer, E.; Rison, W.; Coquillat, S.; Pedeboy, S.; Lán, Radek; Uhlíř, Luděk; Lambert, D.; Pinty, J.P.; Prieur, S.; Pont, V.

    2018-01-01

    Roč. 8, č. 1 (2018), č. článku 3650. ISSN 2045-2322 R&D Projects: GA ČR GA17-07027S Grant - others:AV ČR(CZ) AP1401 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:68378289 Keywords : controlled study * article * electromagnetic radiation * magnetic field * waveform * lightning * mapping array * discharges * ionosphere * luminosity * flashes * leaders * system Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics ) Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-018-21972-z

  14. Dicty_cDB: VHF127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 72 3e-12 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower... Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 3e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  15. Dicty_cDB: VHF491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi

  16. Ionospheric Coherence Bandwidth Measurements in the Lower VHF Frequency Range

    Science.gov (United States)

    Suszcynsky, D. M.; Light, M. E.; Pigue, M. J.

    2015-12-01

    The United States Department of Energy's Radio Frequency Propagation (RFProp) experiment consists of a satellite-based radio receiver suite to study various aspects of trans-ionospheric signal propagation and detection in four frequency bands, 2 - 55 MHz, 125 - 175 MHz, 365 - 415 MHz and 820 - 1100 MHz. In this paper, we present simultaneous ionospheric coherence bandwidth and S4 scintillation index measurements in the 32 - 44 MHz frequency range collected during the ESCINT equatorial scintillation experiment. 40-MHz continuous wave (CW) and 32 - 44 MHz swept frequency signals were transmitted simultaneously to the RFProp receiver suite from the Reagan Test Site at Kwajalein Atoll in the Marshall Islands (8.7° N, 167.7° E) in three separate campaigns during the 2014 and 2015 equinoxes. Results show coherence bandwidths as small as ~ 1 kHz for strong scintillation (S4 > 0.7) and indicate a high degree of ionospheric variability and irregularity on 10-m spatial scales. Spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities are also observed and are dominant at low elevation angles. The results are compared to previous measurements and available scaling laws.

  17. VHF spectrum monitoring using Meraka cognitive radio platform

    CSIR Research Space (South Africa)

    Aderonmu, AI

    2012-11-01

    Full Text Available discuss the Meraka Cognitive Radio Platform (MCRP) developed using the second version of the Universal Serial Radio Peripheral (USRP2) hardware and the GNU Radio software. We also discussed how the spectrum monitoring system is being implemented...

  18. Simply folded band chaos in a VHF microstrip oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Blakely, Jonathan N. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States)]. E-mail: jonathan.blakely@us.army.mil; Holder, J. Darryl [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States); Corron, Ned J. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States); Pethel, Shawn D. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States)

    2005-10-10

    We present experimental observations of a microstrip circuit that produces Roessler-like chaos with center frequency of 175 MHz. A simply folded band chaotic attractor is created through a period doubling route. The circuit provides an experimental realization of a chaotic neutral delay differential equation, a largely unexplored type of nonlinear dynamical system.

  19. Dicty_cDB: VHF631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid

  20. Dicty_cDB: VHF111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

  1. VHF/UHF filters and multicouplers application of air resonators

    CERN Document Server

    Piette, Bernard

    2013-01-01

    This book describes the various devices used in radio communication and broadcasting to achieve high selectivity filtering and coupling. After providing a background in the basics of microwave theory and more detailed material - including a special chapter on precision and errors in measurement - the reader will find detailed descriptions, manufacturing processes, and, for the most useful instances, a number of worked-through formulas, which will allow engineers and technicians to design circuits or components for filtering or coupling applications. Content is covered in this format across a b

  2. VHF NEMS-CMOS piezoresistive resonators for advanced sensing applications

    Science.gov (United States)

    Arcamone, Julien; Dupré, Cécilia; Arndt, Grégory; Colinet, Eric; Hentz, Sébastien; Ollier, Eric; Duraffourg, Laurent

    2014-10-01

    This work reports on top-down nanoelectromechanical resonators, which are among the smallest resonators listed in the literature. To overcome the fact that their electromechanical transduction is intrinsically very challenging due to their very high frequency (100 MHz) and ultimate size (each resonator is a 1.2 μm long, 100 nm wide, 20 nm thick silicon beam with 100 nm long and 30 nm wide piezoresistive lateral nanowire gauges), they have been monolithically integrated with an advanced fully depleted SOI CMOS technology. By advantageously combining the unique benefits of nanomechanics and nanoelectronics, this hybrid NEMS-CMOS device paves the way for novel breakthrough applications, such as NEMS-based mass spectrometry or hybrid NEMS/CMOS logic, which cannot be fully implemented without this association.

  3. Dicty_cDB: VHF289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d sequence lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqam gdwqrklsdy*hstnafgfwvipnniadrgfifdks...siqagkkkrddianinrkasa Translated Amino Acid sequence (All Frames) Frame A: lvdpasshmlvskikpcmskykflydetadgsl

  4. Dicty_cDB: VHF123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 03667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP1...nsertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434.1 Forward stran...d read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 CR023...465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 BX990136 |BX990136.1 Forwar

  5. Power Burst Facility: power oscillation problem

    International Nuclear Information System (INIS)

    Lussie, W.G.; Wadkins, R.P.; Wells, R.A.

    1975-01-01

    In late 1973 PBF achieved a power level of 15 MW. During this period of operation fluctuations in reactor power were observed. Many possible causes of these fluctuations were considered and a number of nuclear and non-nuclear tests were conducted. Initial instrumentation installed in the core showed coolant outlet temperature variations of 10 0 F for several fuel cannisters and approximately 10 percent power variations at 15 MW. Power spectral density analysis showed a predominant frequency of 0.05 to 0.06 HZ. The testing program to determine the cause of the power oscillations is described

  6. Wind power in modern power systems

    DEFF Research Database (Denmark)

    Chen, Zhe

    2013-01-01

    In recent years, wind power is experiencing a rapid growth, and large-scale wind turbines/wind farms have been developed and connected to power systems. However, the traditional power system generation units are centralized located synchronous generators with different characteristics compared...... with wind turbines. This paper presents an overview of the issues about integrating large-scale wind power plants into modern power systems. Firstly, grid codes are introduced. Then, the main technical problems and challenges are presented. Finally, some possible technical solutions are discussed....

  7. Kansas Power Plants

    Data.gov (United States)

    Kansas Data Access and Support Center — The Kansas Power Plants database depicts, as point features, the locations of the various types of power plant locations in Kansas. The locations of the power plants...

  8. Green Power Partner Resources

    Science.gov (United States)

    EPA Green Power Partners can access tools and resources to help promote their green power commitments. Partners use these tools to communicate the benefits of their green power use to their customers, stakeholders, and the general public.

  9. Autonomous power networks based power system

    International Nuclear Information System (INIS)

    Jokic, A.; Van den Bosch, P.P.J.

    2006-01-01

    This paper presented the concept of autonomous networks to cope with this increased complexity in power systems while enhancing market-based operation. The operation of future power systems will be more challenging and demanding than present systems because of increased uncertainties, less inertia in the system, replacement of centralized coordinating activities by decentralized parties and the reliance on dynamic markets for both power balancing and system reliability. An autonomous network includes the aggregation of networked producers and consumers in a relatively small area with respect to the overall system. The operation of an autonomous network is coordinated and controlled with one central unit acting as an interface between internal producers/consumers and the rest of the power system. In this study, the power balance problem and system reliability through provision of ancillary services was formulated as an optimization problem for the overall autonomous networks based power system. This paper described the simulation of an optimal autonomous network dispatching in day ahead markets, based on predicted spot prices for real power, and two ancillary services. It was concluded that large changes occur in a power systems structure and operation, most of them adding to the uncertainty and complexity of the system. The introduced concept of an autonomous power network-based power system was shown to be a realistic and consistent approach to formulate and operate a market-based dispatch of both power and ancillary services. 9 refs., 4 figs

  10. Emergency power systems at nuclear power plants

    International Nuclear Information System (INIS)

    1982-01-01

    This Guide applies to nuclear power plants for which the total power supply comprises normal power supply (which is electric) and emergency power supply (which may be electric or a combination of electric and non-electric). In its present form the Guide provides general guidance for all types of emergency power systems (EPS) - electric and non-electric, and specific guidance (see Appendix A) on the design principles and the features of the emergency electric power system (EEPS). Future editions will include a second appendix giving specific guidance on non-electric power systems. Section 3 of this Safety Guide covers information on considerations that should be taken into account relative to the electric grid, the transmission lines, the on-site electrical supply system, and other alternative power sources, in order to provide high overall reliability of the power supply to the EPS. Since the nuclear power plant operator does not usually control off-site facilities, the discussion of methods of improving off-site reliability does not include requirements for facilities not under the operator's control. Sections 4 to 11 of this Guide provide information, recommendations and requirements that would apply to any emergency power system, be it electric or non-electric

  11. Nuclear power plants

    International Nuclear Information System (INIS)

    1985-01-01

    Data concerning the existing nuclear power plants in the world are presented. The data was retrieved from the SIEN (Nuclear and Energetic Information System) data bank. The information are organized in table forms as follows: nuclear plants, its status and type; installed nuclear power plants by country; nuclear power plants under construction by country; planned nuclear power plants by country; cancelled nuclear power plants by country; shut-down nuclear power plants by country. (E.G.) [pt

  12. Power Service Shops

    Data.gov (United States)

    Federal Laboratory Consortium — TVA's Power Service Shops provides expert repair and maintenance of power system components and large industrial equipment. With world-class maintenance facilities...

  13. AES Modular Power Systems

    Data.gov (United States)

    National Aeronautics and Space Administration — The AES Modular Power Systems (AMPS) project will demonstrate and infuse modular power electronics, batteries, fuel cells, and autonomous control for exploration...

  14. Military power requirements and backup power considerations

    International Nuclear Information System (INIS)

    Botts, T.E.

    1986-01-01

    All US Air Force (USAF) facilities have certain critical power requirements that must be met in order to carry out their mission successfully. Internal USAF studies have shown that the mission can degrade precipitously as the available power decreases below the mission critical level. Now, more than ever before, the military and private industry are finding that certain functions, such as automated data processing and automated process control, respond catastrophically to power reductions. Furthermore, increased reliance on electrical power means, in the case of the Air Force, that critical power requirements are anticipated to increase by half over the next 15 yr. For these reasons and others, the USAF is investigating several means of improving the availability of electric power under adverse conditions above that which can be provided by an off-base supplier. Among the approaches to this problem being pursued at this time are a program to improve all sorts of generator sets on a service-wide basis and the Multimegawatt Terrestrial Power (MTP) Program, which is pursuing the design and testing of a small dedicated nuclear power source to provide critical mission power. The purpose of this paper is to provide some insight into some of the issues associated with USAF power programs

  15. Electric power system / emergency power supply

    International Nuclear Information System (INIS)

    Dorn, P.G.

    1980-01-01

    One factor of reliability of reactor safety systems is the integrity of the power supply. The purpose of this paper is a review and a discussion of the safety objectives required for the planning, licensing, manufacture and erection of electrical power systems and components. The safety aspects and the technical background of the systems for - the electric auxiliary power supply system and - the emergency power supply system are outlined. These requirements result specially from the safety standards which are the framework for the studies of safety analysis. The overall and specific requirements for the electrical power supply of the safety systems are demonstrated on a 1300 MW standard nuclear power station with a pressurized water reactor. (orig.)

  16. Power conditioning unit for photovoltaic power systems

    Science.gov (United States)

    Beghin, G.; Nguyen Phuoc, V. T.

    Operational features and components of a power conditioning unit for interconnecting solar cell module powers with a utility grid are outlined. The two-stage unit first modifies the voltage to desired levels on an internal dc link, then inverts the current in 2 power transformers connected to a vector summation control to neutralize harmonic distortion up to the 11th harmonic. The system operates in parallel with the grid with extra inductors to absorb line-to-line voltage and phase differences, and permits peak power use from the PV array. Reactive power is gained internally, and a power system controller monitors voltages, frequencies, and currents. A booster preregulator adjusts the input voltage from the array to provide voltage regulation for the inverter, and can commutate 450 amps. A total harmonic distortion of less than 5 percent is claimed, with a rating of 5 kVA, 50/60 Hz, 3-phase, and 4-wire.

  17. Power in Households: Disentangling Bargaining Power

    OpenAIRE

    Mabsout, Ramzi; Staveren, Irene

    2009-01-01

    textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher female incomes lead to higher bargaining power, which in turn tends to increase women’s relative wellbeing (Quisumbing, 2003). For assets, the empirical literature comes up with similar results, indic...

  18. US Mains Stacked Very High Frequency Self-oscillating Resonant Power Converter with Unified Rectifier

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Madsen, Mickey Pierre; Mønster, Jakob Døllner

    2016-01-01

    This paper describes a Very High Frequency (VHF) converter made with three Class-E inverters and a single ClassDE rectifier. The converter is designed for the US mains (120 V, 60 Hz) and can deliver 9 W to a 60 V LED. The converter has a switching frequency of 37 MHz and achieves an efficiency...

  19. Online calibration of high-frequency partial discharge signals in three-phase belted power cables

    NARCIS (Netherlands)

    Wouters, P.A.A.F.

    2005-01-01

    Partial discharge (PD) magnitudes from classical detection techniques are expressed in terms of apparent charges. Signals from HF/VHF/UHF techniques on substation components are often hard to express in this quantity because of complex signal excitation and propagation channels. A method to

  20. Nuclear power in Asia

    Energy Technology Data Exchange (ETDEWEB)

    Hagen, Ronald E.

    1998-08-01

    Contains Executive Summary and Chapters on: Nuclear Energy in the Asian context; Types of nuclear power reactors used in Asia; A survey of nuclear power by country; The economics of nuclear power; Fuels, fuel cycles and reprocessing; Environmental issues and waste disposal; The weapons issues and nuclear power; Conclusions. (Author)

  1. Nuclear power in Canada

    International Nuclear Information System (INIS)

    1980-01-01

    The Canadian Nuclear Association believes that the CANDU nuclear power generation system can play a major role in achieving energy self-sufficiency in Canada. The benefits of nuclear power, factors affecting projections of electric power demand, risks and benefits relative to other conventional and non-conventional energy sources, power economics, and uranium supply are discussed from a Canadian perspective. (LL)

  2. Human Powered Centrifuge

    Science.gov (United States)

    Mulenburg, Gerald M. (Inventor); Vernikos, Joan (Inventor)

    1997-01-01

    A human powered centrifuge has independently established turntable angular velocity and human power input. A control system allows excess input power to be stored as electric energy in a battery or dissipated as heat through a resistors. In a mechanical embodiment, the excess power is dissipated in a friction brake.

  3. Wind Power Now!

    Science.gov (United States)

    Inglis, David Rittenhouse

    1975-01-01

    The government promotes and heavily subsidizes research in nuclear power plants. Federal development of wind power is slow in comparison even though much research with large wind-electric machines has already been conducted. Unless wind power programs are accelerated it will not become a major energy alternative to nuclear power. (MR)

  4. Distributed Power Flow Controller

    NARCIS (Netherlands)

    Yuan, Z.

    2010-01-01

    In modern power systems, there is a great demand to control the power flow actively. Power flow controlling devices (PFCDs) are required for such purpose, because the power flow over the lines is the nature result of the impedance of each line. Due to the control capabilities of different types of

  5. Power oscillation damping controller

    DEFF Research Database (Denmark)

    2012-01-01

    A power oscillation damping controller is provided for a power generation device such as a wind turbine device. The power oscillation damping controller receives an oscillation indicating signal indicative of a power oscillation in an electricity network and provides an oscillation damping control...

  6. Mortality of radio collared willow ptarmigan in Smoela wind-power plant

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, Hans Chr.; Broeseth, Henrik; Nilsen, Erlend B.; Sandercock, Brett K.; Bevanger, Kjetil

    2011-07-01

    Full text: In the project Pre- and post-construction studies of conflicts between birds and wind turbines in coastal Norway (BirdWind), Smoela willow ptarmigan (Lagopus lagopus variegatus) has been one of the species studied. This sub-species represent gallinaceous birds, known to be bad flyers susceptible to collide with artificial structures, e.g. power lines. However, the possible impact of a wind-power plant on survival and behaviour in a willow ptarmigan population was unknown. The objectives of the study were therefore rather wide; to study direct and indirect effects of wind turbines on willow ptarmigan behaviour, habitat selection, reproduction and survival in areas where wind-power plants are established. To collect data on habitat selection, movements, collision risks, avoidance behaviour, survival and general population dynamic parameters, willow ptarmigan were radio-tagged in 2008-2010, using traditional VHF-transmitters (Holohill) with mortality switch, necklace mount, 12 g, lasting for approximately 24 months. Due to low population density and only occasional snow cover, a method using strong lights, dipnet and car was used to catch birds. In total, 34 willow ptarmigan were caught (19 males and 15 females). All birds were caught inside the wind-power plant area (WPA). The birds were radio-tracked at irregular intervals and almost all birds, when found, was located within the WPA. All carcasses of dead birds were examined. When possible, cause of death was determined as; predation (raptor), collision, unknown, other. In total, 28 of the radio-tagged birds have died since January 2008. A Kaplan-Meier analysis of cumulative survival rates, show an exceptionally low survival (<30%). Unlike other willow ptarmigan populations most of the mortality takes place during winter, from December throughout March. Although a thorough analysis of mortality causes has yet not been carried out, a majority of the birds have probably been killed by avian predators and to

  7. Nuclear power and other thermal power

    International Nuclear Information System (INIS)

    Bakke, J.

    1978-01-01

    Some philosophical aspects of mortality statistics are first briefly mentioued, then the environmental problems of, first, nuclear power plants, then fossil fuelled power plants are summarised. The effects of releases of carbon dioxide, sulphur dioxide and nitrogen oxides are briefly discussed. The possible health effects of radiation from nuclear power plants and those of gaseous and particulate effluents from fossil fuel plants are also discussed. It is pointed out that in choosing between alternative evils the worst course is to make no choice at all, that is, failure to install thermal power plants will lead to isolated domestic burning of fossil fuels which is clearly the worst situation regarding pollution. (JIW)

  8. The electric power engineering handbook power systems

    CERN Document Server

    2012-01-01

    Power Systems, Third Edition (part of the five-volume set, The Electric Power Engineering Handbook) covers all aspects of power system protection, dynamics, stability, operation, and control. Under the editorial guidance of L.L. Grigsby, a respected and accomplished authority in power engineering, and section editors Andrew Hanson, Pritindra Chowdhuri, Gerry Sheble, and Mark Nelms, this carefully crafted reference includes substantial new and revised contributions from worldwide leaders in the field. This content provides convenient access to overviews and detailed information on a diverse arr

  9. Power generation costs. Coal - nuclear power

    International Nuclear Information System (INIS)

    1979-01-01

    This supplement volume contains 17 separate chapters investigating the parameters which determine power generation costs on the basis of coal and nuclear power and a comparison of these. A detailed calculation model is given. The complex nature of this type of cost comparison is shown by a review of selected parameter constellation for coal-fired and nuclear power plants. The most favourable method of power generation can only be determined if all parameters are viewed together. One quite important parameter is the load factor, or rather the hours of operation. (UA) 891 UA/UA 892 AMO [de

  10. D. C. power supply

    Energy Technology Data Exchange (ETDEWEB)

    Ohashi, N. Watanabe, Y.; Kitani, M

    1978-04-01

    DC power supplies are for ordinary and emergency use as power sources for various structures such as office buildings, department stores, hotels, and for facilities such as roads, tunnels, dams, power stations, etc. There is strong demand for these dc power supplies to be safe, automated, and maintenance free, and to have high reliability. A dc power supply which meets these demands is described; electric circuit construction is emphasized. (10 figures, 4 tables)

  11. High power fast ramping power supplies

    Energy Technology Data Exchange (ETDEWEB)

    Marneris,I.; Bajon, E.; Bonati, R.; Sandberg, J.; Roser, T.; Tsoupas, N.

    2009-05-04

    Hundred megawatt level fast ramping power converters to drive proton and heavy ion machines are under research and development at accelerator facilities in the world. This is a leading edge technology. There are several topologies to achieve this power level. Their advantages and related issues will be discussed.

  12. The power of PowerPoint.

    Science.gov (United States)

    Niamtu , J

    2001-08-01

    Carousel slide presentations have been used for academic and clinical presentations since the late 1950s. However, advances in computer technology have caused a paradigm shift, and digital presentations are quickly becoming standard for clinical presentations. The advantages of digital presentations include cost savings; portability; easy updating capability; Internet access; multimedia functions, such as animation, pictures, video, and sound; and customization to augment audience interest and attention. Microsoft PowerPoint has emerged as the most popular digital presentation software and is currently used by many practitioners with and without significant computer expertise. The user-friendly platform of PowerPoint enables even the novice presenter to incorporate digital presentations into his or her profession. PowerPoint offers many advanced options that, with a minimal investment of time, can be used to create more interactive and professional presentations for lectures, patient education, and marketing. Examples of advanced PowerPoint applications are presented in a stepwise manner to unveil the full power of PowerPoint. By incorporating these techniques, medical practitioners can easily personalize, customize, and enhance their PowerPoint presentations. Complications, pitfalls, and caveats are discussed to detour and prevent misadventures in digital presentations. Relevant Web sites are listed to further update, customize, and communicate PowerPoint techniques.

  13. Green Power Partnership 100 Green Power Users

    Science.gov (United States)

    EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. Partners on this list use green power to meet 100 of their U.S. organization-wide electricity use.

  14. Power, stability of power, and creativity

    NARCIS (Netherlands)

    Sligte, Daniel J.; de Dreu, Carsten K. W.; Nijstad, Bernard A.

    Power hierarchies are an essential aspect of social organization, create stability and social order, and provide individuals with incentives to climb the hierarchical ladder. Extending previous work on power and creativity, we put forward that this relationship critically depends on both the

  15. Power, stability of power, and creativity

    NARCIS (Netherlands)

    Sligte, D.J.; de Dreu, C.K.W.; Nijstad, B.A.

    2011-01-01

    Power hierarchies are an essential aspect of social organization, create stability and social order, and provide individuals with incentives to climb the hierarchical ladder. Extending previous work on power and creativity, we put forward that this relationship critically depends on both the

  16. Reactive Power Management in Electric Power Systems

    African Journals Online (AJOL)

    (Ferranti effect) would limit the power transfer and the transmission range in the absence of any compensation measures. Journal of EAEA, Vol 14, 1997. In this paper, the management of the reactive power is explored with the aim of improving the quality and the reliability of the supply in the EELPA's interconnected system ...

  17. Power in Households: Disentangling Bargaining Power

    NARCIS (Netherlands)

    R. Mabsout (Ramzi); I.P. van Staveren (Irene)

    2009-01-01

    textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher

  18. Emergency power systems at nuclear power plants

    International Nuclear Information System (INIS)

    1991-01-01

    This Safety Guide was prepared as part of the Nuclear Safety Standards programme for establishing Codes and Safety Guides relating to nuclear power plants (NPPs). The first edition of the present Safety Guide was developed in the early 1980s. The text has now been brought up-to-date, refined in several details and amended to include non-electrical diverse and independent power sources. This Guide applies to NPP for which the total power supply comprises a normal power supply and an emergency power supply (EPS), which may be electrical or a combination of electrical and non-electrical. The Guide provides general guidance for all types of EPS and specific guidance on the design safety requirements and the features of the electrical and non-electrical portions of the EPS. 9 figs, 2 tabs

  19. Power and revenge.

    Science.gov (United States)

    Strelan, Peter; Weick, Mario; Vasiljevic, Milica

    2014-09-01

    We took an individual differences approach to explain revenge tendencies in powerholders. Across four experimental studies, chronically powerless individuals sought more revenge than chronically powerful individuals following a high power episode (Studies 1 and 2), when striking a powerful pose (Study 3), and when making a powerful hand gesture (Study 4). This relationship vanished when participants were not exposed to incidental power. A meta-analysis revealed that, relative to a lack of power or a neutral context, exposure to incidental power increased vengeance among the chronically powerless and reduced vengeance among the chronically powerful. These findings add to previous research on relations between power and aggression, and underscore the role of individual differences as a determinant of powerholders' destructive responses. © 2013 The British Psychological Society.

  20. Space power subsystem sizing

    International Nuclear Information System (INIS)

    Geis, J.W.

    1992-01-01

    This paper discusses a Space Power Subsystem Sizing program which has been developed by the Aerospace Power Division of Wright Laboratory, Wright-Patterson Air Force Base, Ohio. The Space Power Subsystem program (SPSS) contains the necessary equations and algorithms to calculate photovoltaic array power performance, including end-of-life (EOL) and beginning-of-life (BOL) specific power (W/kg) and areal power density (W/m 2 ). Additional equations and algorithms are included in the spreadsheet for determining maximum eclipse time as a function of orbital altitude, and inclination. The Space Power Subsystem Sizing program (SPSS) has been used to determine the performance of several candidate power subsystems for both Air Force and SDIO potential applications. Trade-offs have been made between subsystem weight and areal power density (W/m 2 ) as influenced by orbital high energy particle flux and time in orbit

  1. Generalized Power Domination

    OpenAIRE

    Omerzel, Aleš

    2014-01-01

    The power domination problem is an optimization problem that has emerged together with the development of the power networks. It is important to control the voltage and current in all the nodes and links in a power network. Measuring devices are expensive, which is why there is a tendency to place a minimum number of devices in a power network so that the network remains fully supervised. The k-power domination is a generalization of the power domination. The thesis represents the rules of th...

  2. Electric power systems

    CERN Document Server

    Weedy, B M; Jenkins, N; Ekanayake, J B; Strbac, G

    2012-01-01

    The definitive textbook for Power Systems students, providing a grounding in essential power system theory while also focusing on practical power engineering applications. Electric Power Systems has been an essential book in power systems engineering for over thirty years. Bringing the content firmly up-to-date whilst still retaining the flavour of Weedy's extremely popular original, this Fifth Edition has been revised by experts Nick Jenkins, Janaka Ekanayake and Goran Strbac. This wide-ranging text still covers all of the fundamental power systems subjects but is now e

  3. Nuclear power economic database

    International Nuclear Information System (INIS)

    Ding Xiaoming; Li Lin; Zhao Shiping

    1996-01-01

    Nuclear power economic database (NPEDB), based on ORACLE V6.0, consists of three parts, i.e., economic data base of nuclear power station, economic data base of nuclear fuel cycle and economic database of nuclear power planning and nuclear environment. Economic database of nuclear power station includes data of general economics, technique, capital cost and benefit, etc. Economic database of nuclear fuel cycle includes data of technique and nuclear fuel price. Economic database of nuclear power planning and nuclear environment includes data of energy history, forecast, energy balance, electric power and energy facilities

  4. Power Electronics for Microgrids

    DEFF Research Database (Denmark)

    Dragicevic, Tomislav; Blaabjerg, Frede

    2016-01-01

    A microgrid (MG) is a stand-alone or grid-connected hybrid renewable system that uses distributed renewable and nonrenewable energy sources and energy storage systems (ESSs) to supply power to local loads. The system is ordinarily based on power electronics, with interface converters allowing...... a continuous supply of power in the presence of variable RES production. This chapter describes some specific features of DC MGs in terms of power architecture, control, and protection. It also reviews several uncommon power electronic interfaces. Regarding control, operation without critical communication...... are explained in this chapter. The chapter concludes with a review of power electronic intensive protection solutions for DC MGs....

  5. Small scale power production

    Energy Technology Data Exchange (ETDEWEB)

    Muoniovaara, M [IVO International Ltd, Vantaa (Finland)

    1997-12-31

    IVO International is a major constructor of biomass power plants in Finland and abroad. As a subsidiary of Imatran Voima Oy, the largest power utility in Finland, it has designed and constructed ten power plants owned by IVO Group or others capable of burning biomasses. Sizes of the plants vary from the world`s largest condensing peat-fired power plant of 155 MWe to a 6 MWe combined heat and power producing unit. This article describes the biomass power plants designed and constructed by IVO Group 3 refs.

  6. Nuclear power prospects

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1960-09-15

    A survey of the nuclear power needs of the less-developed countries and a study of the technology and economics of small and medium scale power reactors are envisioned by the General Conference. Agency makes its services available to Member States to assist them for their future nuclear power plans, and in particular in studying the technical and economic aspects of their power programs. The Agency also undertakes general studies on the economics of nuclear power, including the collection and analysis of cost data, in order to assist Member States in comparing and forecasting nuclear power costs in relation to their specific situations

  7. Shipboard electrical power systems

    CERN Document Server

    Patel, Mukund R

    2011-01-01

    Shipboard Electrical Power Systems addresses new developments in this growing field. Focused on the trend toward electrification to power commercial shipping, naval, and passenger vessels, this book helps new or experienced engineers master cutting-edge methods for power system design, control, protection, and economic use of power. Provides Basic Transferable Skills for Managing Electrical Power on Ships or on LandThis groundbreaking book is the first volume of its kind to illustrate optimization of all aspects of shipboard electrical power systems. Applying author Mukund Patel's rare combina

  8. Small scale power production

    Energy Technology Data Exchange (ETDEWEB)

    Muoniovaara, M. [IVO International Ltd, Vantaa (Finland)

    1996-12-31

    IVO International is a major constructor of biomass power plants in Finland and abroad. As a subsidiary of Imatran Voima Oy, the largest power utility in Finland, it has designed and constructed ten power plants owned by IVO Group or others capable of burning biomasses. Sizes of the plants vary from the world`s largest condensing peat-fired power plant of 155 MWe to a 6 MWe combined heat and power producing unit. This article describes the biomass power plants designed and constructed by IVO Group 3 refs.

  9. Power beaming providing a space power infrastructure

    International Nuclear Information System (INIS)

    Bamberger, J.A.; Coomes, E.P.

    1992-01-01

    This paper, based on two levels of technology maturity, applied the power beaming concept to four panned satellite constellations. The analysis shows that with currently available technology, power beaming can provide mass savings to constellations in orbits ranging from low-Earth orbit to geosynchronous orbit. Two constellations, space surveillance and tracking system and space-based radar, can be supported with current technology. The other two constellations, space-based laser array and boost surveillance and tracking system, will require power and transmission system improvements before their breakeven specific mass is achieved. A doubling of SP-100 conversion efficiency from 10 to 20% would meet or exceed breakeven for these constellations

  10. Land Warrior Power Management

    National Research Council Canada - National Science Library

    Sanders, David

    2003-01-01

    .... The improvement is incremental; yet the goal of power management for this system is to significantly increase the length of time a single source can supply the system with power without resupply...

  11. Minnesota Power Settlement

    Science.gov (United States)

    EPA and DOJ announced a Clean Air Act settlement with Minnesota Power, an ALLETE company based in Duluth, that will cover its three coal-fired power plants and one biomass-and-coal-fired steam and electricity cogeneration plan

  12. Green Power Partner List

    Science.gov (United States)

    The U.S. EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. There are thousands of Green Power Partners, all listed on this page.

  13. Green Power Communities

    Science.gov (United States)

    GPCs are towns, villages, cities, counties, or tribal governments in which the local government, businesses, and residents collectively use green power in amounts that meet or exceed EPA's Green Power Community purchase requirements.

  14. Industrial power distribution

    CERN Document Server

    Fehr, Ralph

    2016-01-01

    In this fully updated version of Industrial Power Distribution, the author addresses key areas of electric power distribution from an end-user perspective for both electrical engineers, as well as students who are training for a career in the electrical power engineering field. Industrial Power Distribution, Second Edition, begins by describing how industrial facilities are supplied from utility sources, which is supported with background information on the components of AC power, voltage drop calculations, and the sizing of conductors and transformers. Important concepts and discussions are featured throughout the book including those for sequence networks, ladder logic, motor application, fault calculations, and transformer connections. The book concludes with an introduction to power quality, how it affects industrial power systems, and an expansion of the concept of power factor, including a distortion term made necessary by the existence of harmonic.

  15. Laser power supply

    International Nuclear Information System (INIS)

    Bernstein, D.

    1975-01-01

    The laser power supply includes a regulator which has a high voltage control loop based on a linear approximation of a laser tube negative resistance characteristic. The regulator has independent control loops for laser current and power supply high voltage

  16. Reactor power distribution monitor

    International Nuclear Information System (INIS)

    Hoizumi, Atsushi.

    1986-01-01

    Purpose: To grasp the margin for the limit value of the power distribution peaking factor inside the reactor under operation by using the reactor power distribution monitor. Constitution: The monitor is composed of the 'constant' file, (to store in-reactor power distributions obtained from analysis), TIP and thermocouple, lateral output distribution calibrating apparatus, axial output distribution synthesizer and peaking factor synthesizer. The lateral output distribution calibrating apparatus is used to make calibration by comparing the power distribution obtained from the thermocouples to the power distribution obtained from the TIP, and then to provide the power distribution lateral peaking factors. The axial output distribution synthesizer provides the power distribution axial peaking factors in accordance with the signals from the out-pile neutron flux detector. These axial and lateral power peaking factors are synthesized with high precision in the three-dimensional format and can be monitored at any time. (Kamimura, M.)

  17. Power control device of an atomic power plant

    International Nuclear Information System (INIS)

    Ootsuka, Shiro; Ito, Takero.

    1980-01-01

    Purpose: To improve the power controllability of an atomic power plant by improving the controllability, response and stability of the recirculation flow rate. Constitution: The power control device comprises a power detector of the reactor, which detects and operates the reactor power from the thermal power, neutron flux or the process quantity controlling the same, and a deviation detector which seeks deviation between the power signal of the power detector and the power set value of the reactor or power station. By use of the power control device constituted in this manner, the core flow rate is regulated by the power signal of the deviation detector thereby to control the power. (Aizawa, K.)

  18. Wind Power Utilization Guide.

    Science.gov (United States)

    1981-09-01

    The expres- sions for the rotor torque for a Darrieus machine can be found in Reference 4.16. The Darrieus wind turbine offers the following... turbine generators, wind -driven turbines , power conditioning, wind power, energy conservation, windmills, economic ana \\sis. 20 ABS 1"ACT (Conti,on... turbines , power conditioning requirements, siting requirements, and the economics of wind power under different conditions. Three examples are given to

  19. Microwave power engineering applications

    CERN Document Server

    Okress, Ernest C

    2013-01-01

    Microwave Power Engineering, Volume 2: Applications introduces the electronics technology of microwave power and its applications. This technology emphasizes microwave electronics for direct power utilization and transmission purposes. This volume presents the accomplishments with respect to components, systems, and applications and their prevailing limitations in the light of knowledge of the microwave power technology. The applications discussed include the microwave heating and other processes of materials, which utilize the magnetron predominantly. Other applications include microwave ioni

  20. High power communication satellites power systems study

    International Nuclear Information System (INIS)

    Josloff, A.T.; Peterson, J.R.

    1994-01-01

    This paper discusses a DOE-funded study to evaluate the commercial attractiveness of high power communication satellites and assesses the attributes of both conventional photovoltaic and reactor power systems. This study brings together a preeminent US Industry/Russian team to cooperate on the role of high power communication satellites in the rapidly expanding communications revolution. These high power satellites play a vital role in assuring availability of universally accessible, wide bandwidth communications, for high definition TV, super computer networks and other services. Satellites are ideally suited to provide the wide bandwidths and data rates required and are unique in the ability to provide services directly to the users. As new or relocated markets arise, satellites offer a flexibility that conventional distribution services cannot match, and it is no longer necessary to be near population centers to take advantage of the telecommunication revolution. The geopolitical implications of these substantially enhanced communications capabilities will be significant

  1. The Pervasive Power of PowerPoint

    DEFF Research Database (Denmark)

    Schoeneborn, Dennis

    2013-01-01

    This paper examines the pervasive role of Microsoft’s presentation software PowerPoint as a genre of professional and organizational communication. Frequently, PowerPoint is not only used for the primary function it was initially designed for, i.e., facilitating live presentations, but also...... for alternative purposes such as project documentation. Its application in a neighboring domain, however, poses a functional dilemma: does the PowerPoint genre preserve the features of its primary function, i.e., presentation, or rather adapt to the new function, i.e., documentation? By drawing on a communication......-centered perspective, this paper examines PowerPoint’s role in the domain of project documentation as a clash between the constitutive affordances of professional and of organizational communication. To investigate this issue empirically, I conducted a case study at a multinational business consulting firm. The study...

  2. Combat Power Analysis is Combat Power Density

    Science.gov (United States)

    2012-05-17

    Lanchester equations, Weapon Effectiveness Index (WEI), Weighted Unit Value (WUV), Armored Division Equivalents (ADE), and Unit Frontages. The research...6 Lanchester Equations... Lanchester Equations ............................................................................................... 53 Appendix C: Relative Combat Power

  3. Silicon Power MOSFETs

    Science.gov (United States)

    Lauenstein, Jean-Marie; Casey, Megan; Campola, Michael; Ladbury, Raymond; Label, Kenneth; Wilcox, Ted; Phan, Anthony; Kim, Hak; Topper, Alyson

    2017-01-01

    Recent work for the NASA Electronic Parts and Packaging Program Power MOSFET task is presented. The Task technology focus, roadmap, and partners are given. Recent single-event effect test results on commercial, automotive, and radiation hardened trench power MOSFETs are summarized with an emphasis on risk of using commercial and automotive trench-gate power MOSFETs in space applications.

  4. Power transformer reliability modelling

    NARCIS (Netherlands)

    Schijndel, van A.

    2010-01-01

    Problem description Electrical power grids serve to transport and distribute electrical power with high reliability and availability at acceptable costs and risks. These grids play a crucial though preferably invisible role in supplying sufficient power in a convenient form. Today’s society has

  5. Italian steam power plants

    Energy Technology Data Exchange (ETDEWEB)

    von Rautenkranz, J

    1939-01-01

    A brief history of geothermal power production in Italy is presented. Boric acid has been produced on an industrial scale since 1818. The first electrical power was generated in 1904, and by 1939 the output of geothermal power plants had reached 500 GWh, with major expansion of facilities planned.

  6. Wind power soars

    Energy Technology Data Exchange (ETDEWEB)

    Flavin, C. [Worldwatch Inst., Washington, DC (United States)

    1996-12-31

    Opinions on the world market for wind power are presented in this paper. Some data for global wind power generating capacity are provided. European and other markets are discussed individually. Estimated potential for wind power is given for a number of countries. 3 figs.

  7. Effectivity and Power

    NARCIS (Netherlands)

    Karos, Dominik; Peters, Hans

    2016-01-01

    We axiomatically develop a class of power indices for effectivity functions, both for the case where the set of alternatives is finite and where it is infinite. Such power indices make it possible to take the issues under consideration into account, in contrast to power indices defined just for

  8. Optical cycle power meter

    DEFF Research Database (Denmark)

    2014-01-01

    A bicycle power meter for measuring power generated when riding a bicycle, the power meter comprising a position-sensitive radiation detector (409) attachable to a component of a crank set (404) of bicycle, and a radiation source (408) attachable to the component of the crank set and configured t...

  9. Optimization in power systems

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Geraldo R.M. da [Sao Paulo Univ., Sao Carlos, SP (Brazil). Escola de Engenharia

    1994-12-31

    This paper discusses, partially, the advantages and the disadvantages of the optimal power flow. It shows some of the difficulties of implementation and proposes solutions. An analysis is made comparing the power flow, BIGPOWER/CESP, and the optimal power flow, FPO/SEL, developed by the author, when applied to the CEPEL-ELETRONORTE and CESP systems. (author) 8 refs., 5 tabs.

  10. Trim coil power supplies

    International Nuclear Information System (INIS)

    Haisler, R.; Peeler, H.; Zajicek, W.

    1985-01-01

    The 18 trim coil power supplies have been constructed and are now in place in the K500 pit and pit mezzanine. Final wiring of the primary power and control power is proceeding along with installation of cooling water supplies. The supplies are expected to be ready for final testing into resistive loads at the beginning of June, 1985

  11. Russia power engineering and power safety

    International Nuclear Information System (INIS)

    D'yakov, A.F.

    1995-01-01

    Results of work of the International consultative meeting: Russian-Europe: strategy of energy safety is described. The purpose of the meeting consisted in discussion of energy situation in Russia and Europe, prospects for provision of reliability, efficiency and safety of fuel and power supply in Russia and the role of the Russian fuel and power resonances in energy supply of Europe. The reporters at the meeting dealt with various aspects related to energy safety

  12. Transient hardened power FETs

    International Nuclear Information System (INIS)

    Dawes, W.R. Jr.; Fischer, T.A.; Huang, C.C.C.; Meyer, W.J.; Smith, C.S.; Blanchard, R.A.; Fortier, T.J.

    1986-01-01

    N-channel power FETs offer significant advantages in power conditioning circuits. Similiarily to all MOS technologies, power FET devices are vulnerable to ionizing radiation, and are particularily susceptible to burn-out in high dose rate irradiations (>1E10 rads(Si)/sec.), which precludes their use in many military environments. This paper will summarize the physical mechanisms responsible for burn-out, and discuss various fabrication techniques designed to improve the transient hardness of power FETs. Power FET devices were fabricated with several of these techniques, and data will be presented which demonstrates that transient hardness levels in excess of 1E12 rads(Si)/sec. are easily achievable

  13. Power system relaying

    CERN Document Server

    Horowitz, Stanley H; Niemira, James K

    2013-01-01

    The previous three editions of Power System Relaying offer comprehensive and accessible coverage of the theory and fundamentals of relaying and have been widely adopted on university and industry courses worldwide. With the third edition, the authors have added new and detailed descriptions of power system phenomena such as stability, system-wide protection concepts and discussion of historic outages. Power System Relaying, 4th Edition continues its role as an outstanding textbook on power system protection for senior and graduate students in the field of electric power engineering and a refer

  14. Power without Glory

    DEFF Research Database (Denmark)

    Jørgensen, Kenneth Mølbjerg

    This book is about power and language in organizations. Its purpose is, more specifically, to develop and apply a method for exploring power in organizations where organizations are conceptualized by drawing on Wittgenstein’s concept of language games. The method is genealogy and is closely linked...... to Foucault’s conception of power. The book is written with one main purpose—to highlight some aspects of Foucault’s conception of power that, in my opinion, are not sufficiently explored in extant organization studies: Genealogy and the practices of power....

  15. Power source facility

    Energy Technology Data Exchange (ETDEWEB)

    Yoshikawa, Kazuhiro; Kinoshita, Shoichiro

    1998-09-29

    The present invention concerns a power plant, in which power is supplied from an ordinary system battery to an ordinary DC bus system when all of the AC power sources should be lost and a generator is driven by a steam turbine. A generator is connected with an ordinary system battery charger by way of a channel. If all of power sources should be lost, the ordinary system battery charger is driven by using emergency steam turbine generator facilities, and reactor steams are supplied thereby enabling to supply power to the ordinary system DC bus system for a long period of time. (N.H.)

  16. N-power needed

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    SA will have to build more nuclear power stations over the next 30 years if the change over from coal-fired stations is to be made successfully. There will have to be substantial growth in nuclear power. If new nuclear power stations are to be built it is likely they are to be on the coast. Studies of the existing and projected population density of the area and the infrastructure have to be done. The next nuclear power stations is likely to use the light water mounted and cooled fission reactor. The present situation with the Koeberg nuclear power plant is also discussed

  17. Powering biomedical devices

    CERN Document Server

    Romero, Edwar

    2013-01-01

    From exoskeletons to neural implants, biomedical devices are no less than life-changing. Compact and constant power sources are necessary to keep these devices running efficiently. Edwar Romero's Powering Biomedical Devices reviews the background, current technologies, and possible future developments of these power sources, examining not only the types of biomedical power sources available (macro, mini, MEMS, and nano), but also what they power (such as prostheses, insulin pumps, and muscular and neural stimulators), and how they work (covering batteries, biofluids, kinetic and ther

  18. Philosophy of power generation

    International Nuclear Information System (INIS)

    Amein, H.; Joyia, Y.; Qureshi, M.N.; Asif, M.

    1995-01-01

    In view of the huge power demand in future, the capital investment requirements for the development of power projects to meet the future energy requirements are so alarming that public sector alone cannot manage to raise funds and participation of the private sector in power generation development has become imperative. This paper discusses a power generation philosophy based on preference to the exploitation of indigenous resources and participation of private sector. In order to have diversification in generation resources, due consideration has been given to the development of nuclear power and even non-conventional but promising technologies of solar, wind, biomass and geothermal etc. (author)

  19. Public power costs less

    International Nuclear Information System (INIS)

    Moody, D.

    1993-01-01

    The reasons why residential customers of public power utilities paid less for power than private sector customers is discussed. Residential customers of investor-owned utilities (IOU's) paid average rates that were 28% above those paid by customers by possibly owned systems during 1990. The reasons for this disparity are that management costs faced by public power systems are below those of private power companies, indicating a greater efficiency of management among public power systems, and customer accounts expenses averaged $33.00 per customer for publicly owned electric utilities compared to $39.00 per customer for private utilities

  20. Multimode power processor

    Science.gov (United States)

    O'Sullivan, George A.; O'Sullivan, Joseph A.

    1999-01-01

    In one embodiment, a power processor which operates in three modes: an inverter mode wherein power is delivered from a battery to an AC power grid or load; a battery charger mode wherein the battery is charged by a generator; and a parallel mode wherein the generator supplies power to the AC power grid or load in parallel with the battery. In the parallel mode, the system adapts to arbitrary non-linear loads. The power processor may operate on a per-phase basis wherein the load may be synthetically transferred from one phase to another by way of a bumpless transfer which causes no interruption of power to the load when transferring energy sources. Voltage transients and frequency transients delivered to the load when switching between the generator and battery sources are minimized, thereby providing an uninterruptible power supply. The power processor may be used as part of a hybrid electrical power source system which may contain, in one embodiment, a photovoltaic array, diesel engine, and battery power sources.

  1. China's power policy

    International Nuclear Information System (INIS)

    Mayer, M.

    2006-01-01

    Whether the People's Republic of China may develop to an economical super-government in future depends on the amount of power and resources of this land. The security of power supply is in an extremely prominent position in the Agenda of the Chinese government. Under this aspect the author of the contribution under consideration reports on the power policy of China. The main aspects of this contribution are: (a) Trends of power consumption, productions and imports of power; (b) Power political targets, measures and instruments of China; (c) Characteristics, national and international impacts of the power policy of China. Due to the economical activities of the chinese oil industry worldwide as well as due to the increasing dependence from imports of petroleum and natural oil, China becomes a global player. Thus, one may expect an intensification of Beijing's economical activities with an increased military component. Nevertheless, the power policy of China is an important factor in the global competition according to fossil resources. In order to understand the future behaviour of China's power policy, one may have to take notice of the strategies relating the power policy and relating to foreign affairs. Furthermore, trends and problematic areas concerning the securitization of the power supply in the national area have to be observed

  2. Fusion-power demonstration

    International Nuclear Information System (INIS)

    Henning, C.D.; Logan, B.G.; Carlson, G.A.; Neef, W.S.; Moir, R.W.; Campbell, R.B.; Botwin, R.; Clarkson, I.R.; Carpenter, T.J.

    1983-01-01

    As a satellite to the MARS (Mirror Advanced Reactor Study) a smaller, near-term device has been scoped, called the FPD (Fusion Power Demonstration). Envisioned as the next logical step toward a power reactor, it would advance the mirror fusion program beyond MFTF-B and provide an intermediate step toward commercial fusion power. Breakeven net electric power capability would be the goal such that no net utility power would be required to sustain the operation. A phased implementation is envisioned, with a deuterium checkout first to verify the plasma systems before significant neutron activation has occurred. Major tritium-related facilities would be installed with the second phase to produce sufficient fusion power to supply the recirculating power to maintain the neutral beams, ECRH, magnets and other auxiliary equipment

  3. Wind power takes over

    International Nuclear Information System (INIS)

    2002-01-01

    All over the industrialized world concentrated efforts are being made to make wind turbines cover some of the energy demand in the coming years. There is still a long way to go, however, towards a 'green revolution' as far as energy is concerned, for it is quite futile to use wind power for electric heating. The article deals with some of the advantages and disadvantages of developing wind power. In Norway, for instance, environmentalists fear that wind power plants along the coast may have serious consequences for the stocks of white-tailed eagle and golden eagle. An other factor that delays the large-scale application of wind power in Norway is the low price of electricity. Some experts, however, maintain that wind power may already compete with new hydroelectric power of intermediate cost. The investment costs are expected to go down with one third by 2020, when wind power may be the most competitive energy source to utilize

  4. Fusion power demonstration

    International Nuclear Information System (INIS)

    Henning, C.D.; Logan, B.G.

    1983-01-01

    As a satellite to the MARS (Mirror Advanced Reactor Study) a smaller, near-term device has been scoped, called the FPD (Fusion Power Demonstration). Envisioned as the next logical step toward a power reactor, it would advance the mirror fusion program beyond MFTF-B and provide an intermediate step toward commercial fusion power. Breakeven net electric power capability would be the goal such that no net utility power would be required to sustain the operation. A phased implementation is envisioned, with a deuterium checkout first to verify the plasma systems before significant neutron activation has occurred. Major tritium-related facilities would be installed with the second phase to produce sufficient fusion power to supply the recirculating power to maintain the neutral beams, ECRH, magnets and other auxiliary equipment

  5. Hydroelectric Power Plants Dobsina

    International Nuclear Information System (INIS)

    Majercak, V.; Srenkelova, Z.; Kristak, J.G.

    1997-01-01

    In this brochure the Hydroelectric Power Plants Dobsina, (VED), subsidiary of the utility Slovenske Elektrarne, a.s. (Slovak Electric, plc. Bratislava) are presented. VED is mainly aimed at generating peak-load electrical energy and maintenance of operational equipment. Reaching its goals, company is first of all focused on reliability of production, economy and effectiveness, keeping principles of work safety and industry safety standards and also ecology. VED operates eight hydroelectric power plants, from which PVE Ruzin I and PVE Dobsina I are pump storage ones and they are controlled directly by the Slovak Energy Dispatch Centre located in Zilina thought the system LS 3200. Those power plants participate in secondary regulation of electrical network of Slovakia. They are used to compensate balance in reference to foreign electrical networks and they are put into operation independently from VED. Activity of the branch is focused mainly on support of fulfilment of such an important aim as electric network regulation. Beginnings of the subsidiary Hydroelectric Power Plants Dobsina are related to the year of 1948. After commissioning of the pump storage Hydroelectric Power Plants Dobsina in 1953, the plant started to carry out its mission. Since that time the subsidiary has been enlarged by other seven power plants, through which it is fulfilling its missions nowadays. The characteristics of these hydroelectric power plants (The pump-storage power plant Dobsina, Small hydroelectric power plant Dobsina II, Small hydroelectric power plant Rakovec, Small hydroelectric power plant Svedlar, Hydroelectric power plant Domasa, The pump-storage power plant Ruzin, and Small hydroelectric power plant Krompachy) are described in detail. Employees welfare and public relations are presented

  6. Human Power Empirically Explored

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, A.J.

    2011-01-18

    Harvesting energy from the users' muscular power to convert this into electricity is a relatively unknown way to power consumer products. It nevertheless offers surprising opportunities for product designers; human-powered products function independently from regular power infrastructure, are convenient and can be environmentally and economically beneficial. This work provides insight into the knowledge required to design human-powered energy systems in consumer products from a scientific perspective. It shows the developments of human-powered products from the first introduction of the BayGen Freeplay radio in 1995 till current products and provides an overview and analysis of 211 human-powered products currently on the market. Although human power is generally perceived as beneficial for the environment, this thesis shows that achieving environmental benefit is only feasible when the environmental impact of additional materials in the energy conversion system is well balanced with the energy demands of the products functionality. User testing with existing products showed a preference for speeds in the range of 70 to 190 rpm for crank lengths from 32 to 95 mm. The muscular input power varied from 5 to 21 W. The analysis of twenty graduation projects from the Faculty of Industrial Design Engineering in the field of human-powered products, offers an interesting set of additional practice based design recommendations. The knowledge based approach of human power is very powerful to support the design of human-powered products. There is substantial potential for improvements in the domains energy conversion, ergonomics and environment. This makes that human power, when applied properly, is environmentally and economically competitive over a wider range of applications than thought previously.

  7. Power quality assessment

    International Nuclear Information System (INIS)

    Fathi, H.M.E.

    2012-01-01

    The electrical power systems are exposed to different types of power quality disturbances problems. Assessment of power quality is necessary for maintaining accurate operation of sensitive equipment's especially for nuclear installations, it also ensures that unnecessary energy losses in a power system are kept at a minimum which lead to more profits. With advanced in technology growing of industrial / commercial facilities in many region. Power quality problems have been a major concern among engineers; particularly in an industrial environment, where there are many large-scale type of equipment. Thus, it would be useful to investigate and mitigate the power quality problems. Assessment of Power quality requires the identification of any anomalous behavior on a power system, which adversely affects the normal operation of electrical or electronic equipment. The choice of monitoring equipment in a survey is also important to ascertain a solution to these power quality problems. A power quality assessment involves gathering data resources; analyzing the data (with reference to power quality standards); then, if problems exist, recommendation of mitigation techniques must be considered. The main objective of the present work is to investigate and mitigate of power quality problems in nuclear installations. Normally electrical power is supplied to the installations via two sources to keep good reliability. Each source is designed to carry the full load. The Assessment of power quality was performed at the nuclear installations for both sources at different operation conditions. The thesis begins with a discussion of power quality definitions and the results of previous studies in power quality monitoring. The assessment determines that one source of electricity was deemed to have relatively good power quality; there were several disturbances, which exceeded the thresholds. Among of them are fifth harmonic, voltage swell, overvoltage and flicker. While the second

  8. Power generation statistics

    International Nuclear Information System (INIS)

    Kangas, H.

    2001-01-01

    The frost in February increased the power demand in Finland significantly. The total power consumption in Finland during January-February 2001 was about 4% higher than a year before. In January 2001 the average temperature in Finland was only about - 4 deg C, which is nearly 2 degrees higher than in 2000 and about 6 degrees higher than long term average. Power demand in January was slightly less than 7.9 TWh, being about 0.5% less than in 2000. The power consumption in Finland during the past 12 months exceeded 79.3 TWh, which is less than 2% higher than during the previous 12 months. In February 2001 the average temperature was - 10 deg C, which was about 5 degrees lower than in February 2000. Because of this the power consumption in February 2001 increased by 5%. Power consumption in February was 7.5 TWh. The maximum hourly output of power plants in Finland was 13310 MW. Power consumption of Finnish households in February 2001 was about 10% higher than in February 2000, and in industry the increase was nearly zero. The utilization rate in forest industry in February 2001 decreased from the value of February 2000 by 5%, being only about 89%. The power consumption of the past 12 months (Feb. 2000 - Feb. 2001) was 79.6 TWh. Generation of hydroelectric power in Finland during January - February 2001 was 10% higher than a year before. The generation of hydroelectric power in Jan. - Feb. 2001 was nearly 2.7 TWh, corresponding to 17% of the power demand in Finland. The output of hydroelectric power in Finland during the past 12 months was 14.7 TWh. The increase from the previous 12 months was 17% corresponding to over 18% of the power demand in Finland. Wind power generation in Jan. - Feb. 2001 was exceeded slightly 10 GWh, while in 2000 the corresponding output was 20 GWh. The degree of utilization of Finnish nuclear power plants in Jan. - Feb. 2001 was high. The output of these plants was 3.8 TWh, being about 1% less than in Jan. - Feb. 2000. The main cause for the

  9. On power and empowerment.

    Science.gov (United States)

    Pratto, Felicia

    2016-03-01

    This study presents a conceptual analysis of social power. The most common theories of power are social-relational, an approach instantiated in a range of contemporary experiments that give participants the chance to control other people's outcomes. The relational approach is also reflected in various analyses of international relations. In comparing and contrasting relational theories of power, I identify logical inconsistencies and shortcomings in their ability to address empowerment and reductions in inequality. In turn, I propose a new ecological conceptualization of empowerment as the state of being able to achieve one's goals and of power as stemming from a combination of the capacity of the party and the affordances of the environment. I explain how this new conceptualization can describe the main kinds of power social relations, avoid logical contradictions, and moreover, distinguish power from agency and from control. This new conceptualization of power as the possibility of meeting goals, coupled with recognizing survival as the fundamental goal of all living things, implies an absolute and not relative or relational standard for power, namely well-being. It also allows us to conceive of power in ways that help address the many social concerns that have motivated research on power. © 2015 The British Psychological Society.

  10. Personal power systems

    Energy Technology Data Exchange (ETDEWEB)

    Dunn-Rankin, Derek; Leal, Elisangela Martins; Walther, David C. [Mechanical and Aerospace Engineering Department, University of California, Irvine, CA 92697 (United States)

    2005-07-01

    The lack of compact, efficient, human compatible, lightweight power sources impedes the realization of machine-enhanced human endeavor. Electronic and communication devices, as well as mobile robotic devices, need new power sources that will allow them to operate autonomously for periods of hours. In this work, a personal power system implies an application of interest to an individual person. The human-compatible gravimetric energy density spans the range from 500 to 5000Wh/kg, with gravimetric power density requirements from 10 to 1000W/kg. These requirements are the primary goals for the systems presented here. The review examines the interesting and promising concepts in electrochemical, thermochemical, and biochemical approaches to small-scale power, as well as their technological and physical challenges and limitations. Often it is the limitations that dominate, so that while the technology to create personal autonomy for communications, information processing and mobility has accelerated, similar breakthroughs for the systems powering these devices have not yet occurred. Fuel cells, model airplane engines, and hummingbird metabolism, are three promising examples, respectively, of electrochemical, thermochemical, and biochemical power production strategies that are close to achieving personal power systems' power demands. Fuel cells show great promise as an energy source when relatively low power density is demanded, but they cannot yet deliver high peak powers nor respond quickly to variable loads. Current small-scale engines, while achieving extraordinary power densities, are too inefficient to achieve the energy density needed for long-duration autonomous operation. Metabolic processes of flying insects and hummingbirds are remarkable biological energy converters, but duplicating, accelerating, and harnessing such power for mobility applications is virtually unexplored. These challenges are significant, and they provide a fertile environment for

  11. High power communication satellites power systems study

    Science.gov (United States)

    Josloff, Allan T.; Peterson, Jerry R.

    1995-01-01

    This paper discusses a planned study to evaluate the commercial attractiveness of high power communication satellites and assesses the attributes of both conventional photovoltaic and reactor power systems. These high power satellites can play a vital role in assuring availability of universally accessible, wide bandwidth communications, for high definition TV, super computer networks and other services. Satellites are ideally suited to provide the wide bandwidths and data rates required and are unique in the ability to provide services directly to the users. As new or relocated markets arise, satellites offer a flexibility that conventional distribution services cannot match, and it is no longer necessary to be near population centers to take advantage of the telecommunication revolution. The geopolitical implications of these substantially enhanced communications capabilities can be significant.

  12. Balancing modern Power System with large scale of wind power

    DEFF Research Database (Denmark)

    Basit, Abdul; Altin, Müfit; Hansen, Anca Daniela

    2014-01-01

    Power system operators must ensure robust, secure and reliable power system operation even with a large scale integration of wind power. Electricity generated from the intermittent wind in large propor-tion may impact on the control of power system balance and thus deviations in the power system...... frequency in small or islanded power systems or tie line power flows in interconnected power systems. Therefore, the large scale integration of wind power into the power system strongly concerns the secure and stable grid operation. To ensure the stable power system operation, the evolving power system has...... to be analysed with improved analytical tools and techniques. This paper proposes techniques for the active power balance control in future power systems with the large scale wind power integration, where power balancing model provides the hour-ahead dispatch plan with reduced planning horizon and the real time...

  13. A Review of Power Electronics for Wind Power

    DEFF Research Database (Denmark)

    Chen, Zhe

    2011-01-01

    The paper reviews the power electronic applications for wind energy systems. Main wind turbine systems with different generators and power electronic converters are described. The electrical topologies of wind farms with power electronic conversion are discussed. Power electronic applications...

  14. Series active power filter in power conditioning

    Energy Technology Data Exchange (ETDEWEB)

    Turunen, J.

    2009-07-01

    Power quality has become an important issue nowadays for several reasons, e.g. modern society's growing dependence on electricity and the fact that poor power quality may generate significant economic losses in few moments. Probable power quality problems are, e.g. harmonics, flicker, voltage dips and supply interruptions. The power quality may be improved by using filters and compensators.The purpose of this thesis is to research the operation of the series active power filter (SAPF) in power conditioning. Therefore, this thesis presents a comparison of three series hybrid active power filters (SHAPFs) in current harmonics filtering. In addition to this, it is shown how the voltage dip compensation performance of the SAPF is improved in a unified power quality conditioner (UPQC) application.The three SHAPFs included in the comparison are series connected topology (SCT), filter connected topology (FCT) and electrically tuned LC shunt circuit (ETLC). The operating principle of these filters is to direct the harmonic currents produced by the load to flow in the LC shunt circuits instead of the supply. In the case of the SCT this phenomenon is boosted by applying so-called active resistance in the supply branch using the SAPF. In the case of the FCT a similar action is achieved by applying the compensation voltage in series with the LC shunt circuits using the SAPF. In the case of the ETLC the performance of the LC shunt circuit is enhanced by applying so-called active inductances in series with the LC shunt circuit using the SAPF. The SHAPFs are compared by searching for their best current filtering performance using various main circuit and control system configurations and loads. The operation of the SHAPFs is first analysed mathematically. After this, the current filtering performance of the SHAPFs is inspected using simulations and experimental tests. The experimental tests are carried out using SHAPF prototypes. As a result, it is shown that the current

  15. Nuclear power generation modern power station practice

    CERN Document Server

    1971-01-01

    Nuclear Power Generation focuses on the use of nuclear reactors as heat sources for electricity generation. This volume explains how nuclear energy can be harnessed to produce power by discussing the fundamental physical facts and the properties of matter underlying the operation of a reactor. This book is comprised of five chapters and opens with an overview of nuclear physics, first by considering the structure of matter and basic physical concepts such as atomic structure and nuclear reactions. The second chapter deals with the requirements of a reactor as a heat source, along with the diff

  16. Solar Power Sources

    DEFF Research Database (Denmark)

    Kim, Katherine A.; Mentesidi, Konstantina; Yang, Yongheng

    2017-01-01

    a significant change. Beyond this energy transition, the still declining cost of the solar technology has become an important driving force for more solar-powered systems. However, high penetration of solar-powered systems also brings technical challenges to the entire energy systems. In order to fully address......Solar power is highly abundant, relatively reliable, and not limited to a geographic region, making it one of the most important renewable energy sources. Catering for a clean and green energy system, solar energy will be an active player in the future mixed power grid that is also undergoing...... those issues, the technological properties of solar power should be investigated. Thus, the basics of solar power technology will be introduced and discussed in this chapter....

  17. Reactor power control device

    International Nuclear Information System (INIS)

    Doi, Kazuyori.

    1981-01-01

    Purpose: To automatically control the BWR type reactor power by simple and short-time searching the load pattern nearest to the required pattern at a nuclear power plant side. Constitution: The reactor power is automatically regulated by periodical modifying of coefficients fitting to a reactor core model, according as a required load pattern. When a load requirement pattern is given, a simulator estimates the total power change and the axial power distribution change from a xenon density change output calculated by a xenon dynamic characteristic estimating device, and a load pattern capable of being realized is searched. The amount to be recirculated is controlled on the basis of the load patteren thus searched, and the operation of the BWR type reactor is automatically controlled at the side of the nuclear power plant. (Kamimura, M.)

  18. Peak power ratio generator

    Science.gov (United States)

    Moyer, R.D.

    A peak power ratio generator is described for measuring, in combination with a conventional power meter, the peak power level of extremely narrow pulses in the gigahertz radio frequency bands. The present invention in a preferred embodiment utilizes a tunnel diode and a back diode combination in a detector circuit as the only high speed elements. The high speed tunnel diode provides a bistable signal and serves as a memory device of the input pulses for the remaining, slower components. A hybrid digital and analog loop maintains the peak power level of a reference channel at a known amount. Thus, by measuring the average power levels of the reference signal and the source signal, the peak power level of the source signal can be determined.

  19. Power and welfare

    DEFF Research Database (Denmark)

    Mik-Meyer, Nanna; Villadsen, Kasper

    readily evident that power is at stake when institutions educate, counsel or ‘empower’ citizens. This book offers a framework for understanding and analyzing these complex and implicit forms of power at play in the encounters between citizens and welfare institutions. Taking as its starting point the idea......In the welfare provision of today, power takes both the shape of juridical sanctions and of attractive offers for self-development. When state institutions punish criminals, remove children at risk, or enforce sanctions upon welfare recipients the question of power is immediately urgent. It is less...... that power takes many different shapes, and that different approaches to power may be necessary in the diverse contexts where citizens encounter welfare professionals, the book demonstrates how significant social theorists, spanning from Goffman to Foucault, can be used for inquiries into these encounters...

  20. Power and Welfare

    DEFF Research Database (Denmark)

    Mik-Meyer, Nanna; Villadsen, Kaspar

    readily evident that power is at stake when institutions educate, counsel or 'empower' citizens. This book offers a framework for understanding and analyzing these complex and implicit forms of power at play in the encounters between citizens and welfare institutions. Taking as its starting point the idea......In the welfare provision of today, power takes both the shape of juridical sanctions and of attractive offers for self-development. When state institutions punish criminals, remove children at risk, or enforce sanctions upon welfare recipients the question of power is immediately urgent. It is less...... that power takes many different shapes, and that different approaches to power may be necessary in the diverse contexts where citizens encounter welfare professionals, the book demonstrates how significant social theorists, spanning from Goffman to Foucault, can be used for inquiries into these encounters...

  1. Power distribution arrangement

    DEFF Research Database (Denmark)

    2010-01-01

    An arrangement and a method for distributing power supplied by a power source to two or more of loads (e.g., electrical vehicular systems) is disclosed, where a representation of the power taken by a particular one of the loads from the source is measured. The measured representation of the amount...... of power taken from the source by the particular one of the loads is compared to a threshold to provide an overload signal in the event the representation exceeds the threshold. Control signals dependant on the occurring of the overload signal are provided such that the control signal decreases the output...... power of the power circuit in case the overload signal occurs...

  2. Power grid complexity

    Energy Technology Data Exchange (ETDEWEB)

    Mei, Shengwei; Zhang, Xuemin [Tsinghua Univ., Beijing, BJ (China). Dept. of Electrical Engineering; Cao, Ming [Groningen Univ. (Netherlands). Faculty of Mathematics and Natural Sciences

    2011-07-01

    ''Power Grid Complexity'' introduces the complex system theory known as self-organized criticality (SOC) theory and complex network theory, and their applications to power systems. It studies the network characteristics of power systems, such as their small-world properties, structural vulnerability, decomposition and coordination strategies, and simplification and equivalence methods. The book also establishes four blackout models based on SOC theory through which the SOC of power systems is studied at both the macroscopic and microscopic levels. Additionally, applications of complex system theory in power system planning and emergency management platforms are also discussed in depth. This book can serve as a useful reference for engineers and researchers working with power systems. (orig.)

  3. Electric power generation

    International Nuclear Information System (INIS)

    Pinske, J.D.

    1981-01-01

    Apart from discussing some principles of power industry the present text deals with the different ways of electric power generation. Both the conventional methods of energy conversion in heating and water power stations and the facilities for utilizing regenerative energy sources (sun, wind, ground heat, tidal power) are considered. The script represents the essentials of the lecture of the same name which is offered to the students of the special subject 'electric power engineering' at the Fachhochschule Hamburg. It does not require any special preliminary knowledge except for the general principles of electrical engineering. It is addressing students of electrical engineering who have passed their preliminary examination at technical colleges and universities. Moreover, it shall also be of use for engineers who want to obtain a quick survey of the structure and the operating characteristics of the extremely different technical methods of power generation. (orig.) [de

  4. Power Subscription Strategy

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1998-12-21

    This document lays out the Bonneville Power Administration`s Power Subscription Strategy, a process that will enable the people of the Pacific Northwest to share the benefits of the Federal Columbia river Power System after 2001 while retaining those benefits within the region for future generations. The strategy also addresses how those who receive the benefits of the region`s low-cost federal power should share a corresponding measure of the risks. This strategy seeks to implement the subscription concept created by the Comprehensive Review in 1996 through contracts for the sale of power and the distribution of federal power benefits in the deregulated wholesale electricity market. The success of the subscription process is fundamental to BPA`s overall business purpose to provide public benefits to the Northwest through commercially successful businesses.

  5. 15 theses on power

    Directory of Open Access Journals (Sweden)

    Susen Simon

    2014-01-01

    Full Text Available This article seeks to contribute to a critical understanding of the multifaceted nature of power, emphasizing its capacity to shape the development of society by permeating constitutive aspects of human reality. To this end, the article proposes an outline of a multidimensional approach to power. It does so by identifying and examining several - arguably universal - features and functions of power. On the basis of 15 theses, it is argued that, within the social world, the power of power derives from the fact that it is (1 ubiquitous, (2 productive, (3 relational, (4 intangible, (5 habitual, (6 discursive, (7 corporeal, (8 polycentric, (9 performative, (10 normative, (11 spatial, (12 temporal, (13 disciplinary, (14 circular, and (15 transcendental. By way of conclusion, the article provides a comprehensive summary of the main insights gained and challenges arising from such a multidimensional approach to power.

  6. Nuclear power in perspective

    International Nuclear Information System (INIS)

    Addinall, E.; Ellington, H.

    1982-01-01

    The subject is covered in chapters: (the nature of nuclear power) the atomic nucleus - a potential source of energy; how nuclear reactors work; the nuclear fuel cycle; radioactivity - its nature and biological effects; (why we need nuclear power) use of energy in the non-communist world -the changing pattern since 1950; use of energy - possible future scenarios; how our future energy needs might be met; (a possible long term nuclear strategy) the history of nuclear power; a possible nuclear power strategy for the Western World; (social and environmental considerations) the hazards to workers in the nuclear power industry; the hazards to the general public (nuclear power industry; reactor operation; transport of radioactive materials; fuel reprocessing; radioactive waste disposal; genetic hazards); the threat to democratic freedom and world peace. (U.K.)

  7. A power measuring device

    International Nuclear Information System (INIS)

    As, R. van.

    1985-01-01

    As a part of the klystron test facility of the Dutch NIKHEF-K accelerator, a sensitive power measuring device has been built. The high-frequency power of a klystron is stored in a water-cooled dummy load. Using a microcomputer, the increase of the water temperature and the water flow rate are transformed to a digital indication of the klystron power. (Auth.)

  8. Power system health analysis

    International Nuclear Information System (INIS)

    Billinton, Roy; Fotuhi-Firuzabad, Mahmud; Aboreshaid, Saleh

    1997-01-01

    This paper presents a technique which combines both probabilistic indices and deterministic criteria to reflect the well-being of a power system. This technique permits power system planners, engineers and operators to maximize the probability of healthy operation as well as minimizing the probability of risky operation. The concept of system well-being is illustrated in this paper by application to the areas of operating reserve assessment and composite power system security evaluation

  9. Balance of power

    OpenAIRE

    Lucas, James Raymond

    2012-01-01

    This Paper argues that the efficiency distribution of players in a game determines how aggressively these players interact. We formalize the idea of balance of power: players fight very inefficient players but play softly versus equally (or more) efficient players. This theory of conduct predicts that entry by new firms leads to a less aggressive outcome if it creates a balance of power. A balance of power is created if more players get technologies that are close to the most efficient techno...

  10. Corrosion in power engineering

    International Nuclear Information System (INIS)

    1988-03-01

    The proceedings contain the full texts of 25 papers of which 10 fall under the INIS Subject Scope. They concern the problems of corrosion in WWER type nuclear power plants. The topics include structural materials and equipment of the primary and the secondary circuits of nuclear power plants, components used in disposal of spent nuclear fuel, sodium valves for fast reactors and basic study of the properties of materials used in nuclear power. (Z.M.). 12 figs., 6 tabs., 46 refs

  11. Solar power in Finland

    International Nuclear Information System (INIS)

    Vesa, A.M.

    2004-01-01

    Solar cells, or photovoltaic units, have provided a useful supply of energy for low-power, non-gridconnected applications in Finland for some years. Applications have included navigational buoys, base stations for mobile phone networks, and appliances in holiday homes. Solar-powered systems have also been used in connection with grid power for over a decade, in Finland and elsewhere, and have proved generally successful - and solar energy is emerging as an increasingly interesting alternative for distributed electricity generation

  12. Nuclear power flies high

    International Nuclear Information System (INIS)

    Friedman, S.T.

    1983-01-01

    Nuclear power in aircraft, rockets and satellites is discussed. No nuclear-powered rockets or aircraft have ever flown, but ground tests were successful. Nuclear reactors are used in the Soviet Cosmos serles of satellites, but only one American satellite, the SNAP-10A, contained a reactor. Radioisotope thermoelectric generators, many of which use plutonium 238, have powered more than 20 satellites launched into deep space by the U.S.A

  13. Impact of advanced wind power ancillary services on power system

    DEFF Research Database (Denmark)

    Hansen, Anca Daniela; Altin, Müfit

    The objective of this report is to illustrate and analyse, by means of simulation test cases, the impact of wind power advanced ancillary services, like inertial response (IR), power oscillation damping (POD) and synchronising power (SP) on the power system. Generic models for wind turbine, wind...... power plant and power system are used in the investigation....

  14. Governance of nuclear power

    International Nuclear Information System (INIS)

    Allison, G.; Carnesale, A.; Zigman, P.; DeRosa, F.

    1981-01-01

    Utility decisions on whether to invest in nuclear power plants are complicated by uncertainties over future power demand, regulatory changes, public perceptions of nuclear power, and capital costs. A review of the issues and obstacles confronting nuclear power also covers the factors affecting national policies, focusing on three institutional questions: regulating the industry, regulating the regulators, and regulatory procedures. The specific recommendations made to improve safety, cost, and public acceptance will still not eliminate uncertainties unless the suggested fundamental changes are made. 29 references

  15. Nuclear power: European report

    International Nuclear Information System (INIS)

    Anon.

    2005-01-01

    In 2004, nuclear power plants were operated and/or built in eighteen European countries. Thirteen of these countries are members of EU-25. Five of the ten countries joining the European Union on May 1, 2004 operate nuclear power stations. A total of 206 power reactors with a gross power of 181,941 MWe and a net power of 172,699 MWe were in operation at the end of the year. In 2004, one nuclear power plant was commissioned in Russia (Kalinin 3), two (Kmelnitzki 2 and Rowno 4) in Ukraine. Five nuclear power plants were decommissioned in Europe in the course of 2004. As announced in 2000, the Chapelcross 1 to Chapelcross 4 plants in Britain were shut down for economic reasons. In Lithuania, the Ignalina 1 unit was disconnected from the power grid, as had been demanded by the EU Commission within the framework of the negotiations about the country's accession to the EU. As a result of ongoing technical optimization in some plants, involving increases in reactor power or generator power as well as commissioning of plants of higher capacity, nuclear generating capacity increased by approx. 1.5 GW. In late 2004, four nuclear generating units were under construction in Finland (1), Romania (1), and Russia (2). 150 nuclear power plants were operated in thirteen states of the European Union (EU-25), which is sixteen more than the year before as a consequence of the accession of new countries. They had an aggregate gross power of 137,943 MWe and a net power of 131,267 MWe, generating approx. 983 billion gross kWh of electricity in 2003, thus again contributing some 32% to the public electricity supply in the EU-25. In largest share of nuclear power in electricity generation is found in Lithuania (80%), followed by 78% in France, 57% in the Slovak Republic, 56% in Belgium, and 46% in Ukraine. In several countries not operating nuclear power plants of their own, such as Italy, Portugal, and Austria, nuclear power makes considerable contributions to public electricity supply as

  16. Nuclear power in Korea

    International Nuclear Information System (INIS)

    Rim, C.S.

    1990-01-01

    Before addressing the issue of public and utility acceptance of nuclear power in Korea, let me briefly explain the Korean nuclear power program and development plan for a passively safe nuclear power plant in Korea. At present, there are eight PWRs and one CANDU in operation; two PWRs are under construction, and contract negotiations are underway for one more CANDU and two more PWRs, which are scheduled to be completed by 1997,1998 and 1999, respectively. According to a recent forecast for electricity demand in Korea, about fifty additional nuclear power plants with a generating capacity of 1000MWe are required by the year 2030. Until around 2006, Korean standardized nuclear power plants with evolutionary features such as those in the ALWR program are to be built, and a new type of nuclear power plant with passive safety features is expected to be constructed after 2006. The Korean government is making a serious effort to increase public understanding of the safety of nuclear power plants and radioactive waste storage and disposal. In addition, the Korean government has recently introduced a program of benefits for residents near nuclear power plants. By this program, common facilities such as community centers and new roads are constructed, and scholarships are given to the local students. Nuclear power is accepted positively by the utility and reasonably well by the public in Korea

  17. Role of nuclear power

    International Nuclear Information System (INIS)

    Eklund, S.

    1982-01-01

    A survey of world nuclear installations, the operating experiences of power reactors, and estimates of future nuclear growth leads to the conclusion that nuclear power's share of world electric power supply will grow slowly, but steadily during this decade. This growth will lead advanced countries to use the commercial breeder by the end of the century. Nuclear power is economically viable for most industrialized and many developing countries if public acceptance problems can be resolved. A restructuring of operational safety and regulations must occur first, as well as a resolution of the safeguards and technology transfer issue. 7 figures, 7 tables

  18. Wind power in Norway

    International Nuclear Information System (INIS)

    1998-01-01

    This report analyses business costs and socio-economic costs in the development of wind power in Norway and policy instruments to encourage such a development. It is founded on an analysis of the development of wind power in other countries, notably U.S.A, Denmark, Germany, the Netherlands and Britain. The report describes the institutional background in each country, the policy instruments that have been used and still are and the results achieved. The various cost components in Norwegian wind power development and the expected market price of wind power are also discussed. The discussion of instruments distinguishes between investment oriented and production oriented instruments. 8 refs., 9 figs., 3 tabs

  19. Memory of Power Transformed

    Directory of Open Access Journals (Sweden)

    Kalina Maleska

    2014-11-01

    Full Text Available This essay is focused on the phenomenon of power. Special attention is paid to the past understanding, research and explanation of what power is, and how it has been understood throughout history. Traditionally, power has referred to authority, influence, control. The research of literary works, however, has led me to the realization that the notion of power is understood in different terms in literature in comparison to how it is explained in philosophy and the social sciences. In order to contribute to the broader understanding of power from a literary point of view, this essay examines many questions concerning this phenomenon, such as: how does the past understanding of power determine how it is accepted and interpreted in the present? How are the success of the present efforts and initiatives affected by the memory of power? The essay attempts to show that the memory of the notion of power is not and cannot be fixed and given once and for all. Therefore, the literary examples provided demonstrate how the definitions of power given in the past are transformed and transfigured by present literary works, which show how we may “forget” what we know about this phenomenon, and define it from a new perspective.

  20. Nuclear power in Asia

    International Nuclear Information System (INIS)

    2007-01-01

    The Australian Uranium Association reports that Asia is the only region in the world where electricity generating capacity and specifically nuclear power is growing significantly. In East and South Asia, there are over 109 nuclear power reactors in operation, 18 under construction and plans to build about a further 100. The greatest growth in nuclear generation is expected in China, Japan, South Korea and India. As a member of the SE Asian community, Australia cannot afford to ignore the existence and growth of nuclear power generation on its door step, even if it has not, up to now, needed to utilise this power source

  1. Nuclear power development

    International Nuclear Information System (INIS)

    Nealey, S.

    1990-01-01

    The objective of this study is to examine factors and prospects for a resumption in growth of nuclear power in the United States over the next decade. The focus of analysis on the likelihood that current efforts in the United States to develop improved and safer nuclear power reactors will provide a sound technical basis for improved acceptance of nuclear power, and contribute to a social/political climate more conducive to a resumption of nuclear power growth. The acceptability of nuclear power and advanced reactors to five social/political sectors in the U.S. is examined. Three sectors highly relevant to the prospects for a restart of nuclear power plant construction are the financial sector involved in financing nuclear power plant construction, the federal nuclear regulatory sector, and the national political sector. For this analysis, the general public are divided into two groups: those who are knowledgeable about and involved in nuclear power issues, the involved public, and the much larger body of the general public that is relatively uninvolved in the controversy over nuclear power

  2. Guide to power reactors

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1959-07-15

    The IAEA's major first scientific publication is the Directory of Power Reactors now in operation or under construction in various parts of the world. The purpose of the directory is to present important details of various power projects in such a way as to provide a source of easy reference for anyone interested in the development of the peaceful uses of atomic energy, either at the technical or management level. Six pages have been devoted to each reactor the first of which contains general information, reactor physics data and information about the core. The second and third contain sketches of the fuel element or of the fuel element assembly, and of the horizontal and vertical sections of the reactor. On the fourth page information is grouped under the following heads: fuel element, core heat transfer, control, reactor vessel and over-all dimensions, and fluid flow. The fifth page shows a simplified flow diagram, while the sixth provides information on reflector and shielding, containment and turbo generator. Some information has also been given, when available, on cost estimates and operating staff requirements. Remarks and a bibliography constitute the last part of the description of each reactor. Reactor projects included in this directory are pressurized light water cooled power reactors. Boiling light water cooled power reactors, heavy water cooled power reactors, gas cooled power reactors, organic cooled power reactors liquid metal cooled power reactors and liquid metal cooled power reactors

  3. Nuclear power in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Rim, C S [Radioactive Waste Management Centre, Korea Atomic Energy Research Institute, Taejon, Choong-Nam (Korea, Republic of)

    1990-07-01

    Before addressing the issue of public and utility acceptance of nuclear power in Korea, let me briefly explain the Korean nuclear power program and development plan for a passively safe nuclear power plant in Korea. At present, there are eight PWRs and one CANDU in operation; two PWRs are under construction, and contract negotiations are underway for one more CANDU and two more PWRs, which are scheduled to be completed by 1997,1998 and 1999, respectively. According to a recent forecast for electricity demand in Korea, about fifty additional nuclear power plants with a generating capacity of 1000MWe are required by the year 2030. Until around 2006, Korean standardized nuclear power plants with evolutionary features such as those in the ALWR program are to be built, and a new type of nuclear power plant with passive safety features is expected to be constructed after 2006. The Korean government is making a serious effort to increase public understanding of the safety of nuclear power plants and radioactive waste storage and disposal. In addition, the Korean government has recently introduced a program of benefits for residents near nuclear power plants. By this program, common facilities such as community centers and new roads are constructed, and scholarships are given to the local students. Nuclear power is accepted positively by the utility and reasonably well by the public in Korea.

  4. CSTI High Capacity Power

    International Nuclear Information System (INIS)

    Winter, J.M.

    1989-01-01

    The SP-100 program was established in 1983 by DOD, DOE, and NASA as a joint program to develop the technology necessary for space nuclear power systems for military and civil application. During FY-86 and 87, the NASA SP-100 Advanced Technology Program was devised to maintain the momentum of promising technology advancement efforts started during Phase 1 of SP-100 and to strengthen, in key areas, the chances for successful development and growth capability of space nuclear reactor power systems for future space applications. In FY-88, the Advanced Technology Program was incorporated into NASA's new Civil Space Technology Initiative (CSTI). The CSTI Program was established to provide the foundation for technology development in automation and robotics, information, propulsion, and power. The CSTI High Capacity Power Program builds on the technology efforts of the SP-100 program, incorporates the previous NASA SP-100 Advanced Technology project, and provides a bridge to NASA Project Pathfinder. The elements of CSTI High Capacity Power development include Conversion Systems, Thermal Management, Power Management, System Diagnostics, and Environmental Interactions. Technology advancement in all areas, including materials, is required to assure the high reliability and 7 to 10 year lifetime demanded for future space nuclear power systems. The overall program will develop and demonstrate the technology base required to provide a wide range of modular power systems as well as allowing mission independence from solar and orbital attitude requirements. Several recent advancements in CSTI High Capacity power development will be discussed

  5. Commercial microwave space power

    International Nuclear Information System (INIS)

    Siambis, J.; Gregorwich, W.; Walmsley, S.; Shockey, K.; Chang, K.

    1991-01-01

    This paper reports on central commercial space power, generating power via large scale solar arrays, and distributing power to satellites via docking, tethering or beamed power such as microwave or laser beams, that is being investigated as a potentially advantageous alternative to present day technology where each satellite carries its own power generating capability. The cost, size and weight for electrical power service, together with overall mission requirements and flexibility are the principal selection criteria, with the case of standard solar array panels based on the satellite, as the reference point. This paper presents and investigates a current technology design point for beamed microwave commercial space power. The design point requires that 25 kW be delivered to the user load with 30% overall system efficiency. The key elements of the design point are: An efficient rectenna at the user end; a high gain, low beam width, efficient antenna at the central space power station end, a reliable and efficient cw microwave tube. Design trades to optimize the proposed near term design point and to explore characteristics of future systems were performed. Future development for making the beamed microwave space power approach more competitive against docking and tethering are discussed

  6. Potentials of wind power

    International Nuclear Information System (INIS)

    Bezrukikh, P.P.; Bezrukikh, P.P.

    2000-01-01

    The ecological advantages of the wind power facilities (WPF) are considered. The possibilities of small WPF, generating the capacity from 40 W up to 10 kW, are discussed. The basic technical data on the national and foreign small WPF are presented. The combined wind power systems are considered. Special attention is paid to the most perspective wind-diesel systems, which provide for all possible versions of the electro-power supply. Useful recommendations and information on the wind power engineering are given for those, who decided to build up a wind facility [ru

  7. Power generation technologies

    CERN Document Server

    Breeze, Paul

    2014-01-01

    The new edition of Power Generation Technologies is a concise and readable guide that provides an introduction to the full spectrum of currently available power generation options, from traditional fossil fuels and the better established alternatives such as wind and solar power, to emerging renewables such as biomass and geothermal energy. Technology solutions such as combined heat and power and distributed generation are also explored. However, this book is more than just an account of the technologies - for each method the author explores the economic and environmental costs and risk factor

  8. Electrical power cable engineering

    CERN Document Server

    Thue, William A

    2011-01-01

    Fully updated, Electrical Power Cable Engineering, Third Edition again concentrates on the remarkably complex design, application, and preparation methods required to terminate and splice cables. This latest addition to the CRC Press Power Engineering series covers cutting-edge methods for design, manufacture, installation, operation, and maintenance of reliable power cable systems. It is based largely on feedback from experienced university lecturers who have taught courses on these very concepts.The book emphasizes methods to optimize vital design and installation of power cables used in the

  9. Power System Analysis

    Science.gov (United States)

    Taniguchi, Haruhito

    Electric power generation that relies on various sources as the primary sources of energy is expected to bring down CO2 emissions levels to support the overall strategy to curb global warming. Accordingly, utilities are moving towards integrating more renewable sources for generation, mostly dispersed, and adopting Smart Grid Technologies for system control. In order to construct, operate, and maintain power systems stably and economically in such background, thorough understanding about the characteristics of power systems and their components is essential. This paper presents modeling and simulation techniques available for the analysis of critical aspects such as thermal capacity, stability, voltage stability, and frequency dynamics, vital for the stable operation of power systems.

  10. Less power plants

    International Nuclear Information System (INIS)

    TASR

    2003-01-01

    In the Slovak Republic the number of company power plants decreased as against 2001 by two sources. In present time only 35 companies have their own power plants. The companies Slovnaft, Kappa Sturovo, Slovensky hodvab Senica, Matador Puchov, Maytex Liptovsky MikuIas, Kovohuty Krompachy, Chemko Strazske and some Slovak sugar factories belong to the largest company power plants in force of distributing companies. Installed output of present 35 company sources is 531 MW. The largest of separate power plants as Paroplynovy cyklus Bratislava (218 MW) and VD Zilina (72 MW) belong to independent sources. Total installed output of Slovak sources was 8306 MW in the end of last year

  11. Passive Power Filters

    CERN Document Server

    Künzi, R.

    2015-06-15

    Power converters require passive low-pass filters which are capable of reducing voltage ripples effectively. In contrast to signal filters, the components of power filters must carry large currents or withstand large voltages, respectively. In this paper, three different suitable filter struc tures for d.c./d.c. power converters with inductive load are introduced. The formulas needed to calculate the filter components are derived step by step and practical examples are given. The behaviour of the three discussed filters is compared by means of the examples. P ractical aspects for the realization of power filters are also discussed.

  12. Power Markets. Creating a regional power market

    International Nuclear Information System (INIS)

    Beckman, K.; Belin, H.

    2009-01-01

    One article and one column in the section 'Power markets'. In the article attention is paid to the leading role of the Netherlands in the pursuit of a fully integrated North West European electricity market. the column 'View from Brussels' focuses on the 'Sustainable Energy Europe' campaign and the related EU Sustainable Energy Week in February 2009

  13. Separation of Powers and the Legislative Power.

    Science.gov (United States)

    Rossum, Ralph A.

    1986-01-01

    Addresses the contribution of separation of powers and checks and balances in resolving the rival defects of democratic ineptitude and majority tyranny as the Founders framed the Constitution. Contends the Founders structured the government so that the three branches could keep each other in their proper places. Discusses Anti- Federalist…

  14. Peak Power Markets for Satellite Solar Power

    Science.gov (United States)

    Landis, Geoffrey A.

    2002-01-01

    This paper introduces first Indonesia, comprises 15,000 islands, has land area of two millions square kilometers. Extending from 95 to 141 degrees East longitude and from 6 degrees North to 11 degrees South latitude. Further the market of the Space Solar Power/SPS must be worldwide, including Indonesia. As we know, it can provide electricity anywhere in the world from the Earth's orbit, mostly Indonesia an equator country. We have to perform case studies of various countries to understand their benefits and disadvantages provided by the SSP, because each country has much different condition on energy from other countries. We are at the moment starting the international collaboration between Indonesia and Japan to carry out the case study for Indonesia. We understand that in Indonesia itself each province has much different micro-climate between one province compared to the other. In Japan, METI (Ministry of Economy, Trade and Industry) has already organized a committee to investigate the feasibility of Space Solar Power and to make a plan to launch a space demonstration of the SPS. While, Indonesia is quickly developing economy and increasing their energy demand. We are investigating the detailed energy conditions of Indonesia, the benefits and disadvantages of the Space Solar Power for Indonesia. Especially, we will perform the investigation on the receiving system for the Japanese pilot Space Power Satellite.

  15. Wind power: Italian wind power industry

    International Nuclear Information System (INIS)

    Botta, G.; Casale, C.

    2008-01-01

    Trends in the world point a growing wind power sector in the future taking into account the safety of energy supply and environmental issues. Will determine the future scenario of price and availability of conventional energy sources. The current level reached by the price of oil create a win-win situation [it

  16. Cost of nuclear power generation judged by power rate

    International Nuclear Information System (INIS)

    Hirai, Takaharu

    1981-01-01

    According to estimation guidance, power rates in general are the proper cost plus the specific compensation and adjustment addition. However, the current system of power rates is of power-source development promotion type involving its tax. The structure of power rate determination must be restudied now especially in connection of nuclear power generation. The cost of nuclear power generation as viewed from power rate is discussed as follows: the fear of military application of power plants, rising plant construction costs, the loophole in fuel cost calculation, unreasonable unit power cost, depreciation and repair cost, business compensation, undue business compensation in nuclear power, the costs of nuclear waste management, doubt concerning nuclear power cost, personnel, pumping-up and power transmission costs in nuclear power, energy balance analysis, nuclear power viewed in entropy, the suppression of power consumption. (J.P.N.)

  17. Power programmes review: Nuclear power for India

    International Nuclear Information System (INIS)

    1959-01-01

    India will require a substantial increase in the generation of electrical power to meet the demands of her developing economy. A survey of available resources has been made in the context of development envisaged under the country's five-year plans and it is felt that atomic energy will have to be used in increasing quantities to supplement conventional fuel resources in order to attain the anticipated power targets in the next two decades. It has, therefore, been decided that a small beginning will be made with the erection and commissioning of anatomic power station of 250 MW (electric) capacity by the end of 1964. The installation of a further 750 MW of nuclear power by the end of the third five-year plan period, i.e. by March 1966, is under consideration. Present Pattern and future demand of energy is discussed, as well as available resources and immediate needs. Concerning nuclear fuel cycle and cost estimates it is stated that India's uranium reserves are not large enough to sustain a very long-term programme of power generation, but the reserves for thorium are. Therefore India's nuclear power production will have to be based primarily on thorium with a rather complicated fuel cycles and first, second and third generation atomic power stations. The Atomic Energy Establishment Trombay is India's national centre for research in the peaceful uses of atomic energy. India's first reactor, Apsara, which is of the swimming pool type, has been in operation for more than three years now and two other research reactors are under construction. These are the Canada-India Reactor, which is being built under the Colombo Plan in collaboration with Canada, and Zerlina, which is being designed and built by Indian scientists and engineers. The Canada-India Reactor will be a versatile high flux research reactor and will have facilities in which various power reactor concepts can be tried out in the so-called loop experiments. In addition, it will produce considerable

  18. Power programmes review: Nuclear power for India

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1959-10-15

    India will require a substantial increase in the generation of electrical power to meet the demands of her developing economy. A survey of available resources has been made in the context of development envisaged under the country's five-year plans and it is felt that atomic energy will have to be used in increasing quantities to supplement conventional fuel resources in order to attain the anticipated power targets in the next two decades. It has, therefore, been decided that a small beginning will be made with the erection and commissioning of anatomic power station of 250 MW (electric) capacity by the end of 1964. The installation of a further 750 MW of nuclear power by the end of the third five-year plan period, i.e. by March 1966, is under consideration. Present Pattern and future demand of energy is discussed, as well as available resources and immediate needs. Concerning nuclear fuel cycle and cost estimates it is stated that India's uranium reserves are not large enough to sustain a very long-term programme of power generation, but the reserves for thorium are. Therefore India's nuclear power production will have to be based primarily on thorium with a rather complicated fuel cycles and first, second and third generation atomic power stations. The Atomic Energy Establishment Trombay is India's national centre for research in the peaceful uses of atomic energy. India's first reactor, Apsara, which is of the swimming pool type, has been in operation for more than three years now and two other research reactors are under construction. These are the Canada-India Reactor, which is being built under the Colombo Plan in collaboration with Canada, and Zerlina, which is being designed and built by Indian scientists and engineers. The Canada-India Reactor will be a versatile high flux research reactor and will have facilities in which various power reactor concepts can be tried out in the so-called loop experiments. In addition, it will produce considerable

  19. Power with heliostats

    International Nuclear Information System (INIS)

    Hildebrandt, A.F.; Vant-Hull, L.L.

    1993-01-01

    The authors describe the concept of the central receiver and consider the following topics: the plan of their solar thermal power system or ''solar power tower'' based on optical transmission; the history of the solar tower; the receiver subsystem; the design of the heliostats and their placement in a field; thermal storage; environmental concerns; and economics

  20. Play and Power

    DEFF Research Database (Denmark)

    The power of play, so central to psychoanalytic theory and practice, is conjoined to the social psychological or socio-politically coloured concept of power, giving rise to many fruitful discussions of how these concepts manifest themselves in clinical work with children, groups and adults...

  1. Playing with Powers

    Science.gov (United States)

    Sriraman, Bharath; Strzelecki, Pawel

    2004-01-01

    This paper explores the wide range of pure mathematics that becomes accessible through the use of problems involving powers. In particular we stress the need to balance an applied and context based pedagogical and curricular approach to mathematics with the powerful pure mathematics beneath the simplicity of easily stated and understandable…

  2. Dictionary of nuclear power

    International Nuclear Information System (INIS)

    Koelzer, W.

    2012-04-01

    The actualized version (April 2012) of the dictionary on nuclear power includes all actualizations and new inputs since the last version of 2001. The original publication dates from 1980. The dictionary includes definitions, terms, measuring units and helpful information on the actual knowledge concerning nuclear power, nuclear facilities, and radiation protection.

  3. Solar Powered Refrigeration System

    Science.gov (United States)

    Ewert, Michael K. (Inventor); Bergeron, David J., III (Inventor)

    2002-01-01

    A solar powered vapor compression refrigeration system is made practicable with thermal storage and novel control techniques. In one embodiment, the refrigeration system includes a photovoltaic panel, a variable speed compressor, an insulated enclosure, and a thermal reservoir. The photovoltaic (PV) panel converts sunlight into DC (direct current) electrical power. The DC electrical power drives a compressor that circulates refrigerant through a vapor compression refrigeration loop to extract heat from the insulated enclosure. The thermal reservoir is situated inside the insulated enclosure and includes a phase change material. As heat is extracted from the insulated enclosure, the phase change material is frozen, and thereafter is able to act as a heat sink to maintain the temperature of the insulated enclosure in the absence of sunlight. The conversion of solar power into stored thermal energy is optimized by a compressor control method that effectively maximizes the compressor's usage of available energy. A capacitor is provided to smooth the power voltage and to provide additional current during compressor start-up. A controller monitors the rate of change of the smoothed power voltage to determine if the compressor is operating below or above the available power maximum, and adjusts the compressor speed accordingly. In this manner, the compressor operation is adjusted to convert substantially all available solar power into stored thermal energy.

  4. Solar thermal power plants

    International Nuclear Information System (INIS)

    Schnatbaum, L.

    2009-01-01

    The solar thermal power plant technology, the opportunities it presents and the developments in the market are outlined. The focus is on the technology of parabolic trough power plants, a proven technology for solar power generation on a large scale. In a parabolic trough power plant, trough-shaped mirrors concentrate the solar irradiation onto a pipe in the focal line of the collector. The thermal energy thus generated is used for electricity generation in a steam turbine. Parabolic trough plants can be combined with thermal storage and fossil or biomass fired heat exchangers to generate electricity even when the sun is not shining. Solar Millennium AG in Erlangen has developed the first power plant of this kind in Europe. After two years of construction the plant started operation in Southern Spain in 2008. This one and its sister projects are important steps leading the way for the whole market. The paper also covers the technological challenges, the key components used and the research and development activities concerning this technology. Solar thermal power plants are ideal for covering peak and medium loads in power grids. In hybrid operation they can also cover base-load. The Solar Chimney power plant, another striking technology for the conversion of solar into electric energy, is described briefly. The paper concludes with a look at the future - the import of solar energy from the deserts of North Africa to central Europe. (author)

  5. Claim Your Powers.

    Science.gov (United States)

    Update on Law-Related Education, 1986

    1986-01-01

    Presents a game which has students interpret Articles I, II, and III of the U.S. Constitution to understand the allocation of powers among the 3 branches of government. The game helps students understand the interaction between the 3 branches of government, stressing the separation of powers and the system of checks and balances. (JDH)

  6. Separation of Powers.

    Science.gov (United States)

    Bill of Rights in Action, 1987

    1987-01-01

    The dimensions of the separation of powers principle are explored through three lessons in the subject areas of U.S. history, U.S. government, and world history. In 1748, a French nobleman, Baron de Montesquieu, wrote a book called "The Spirit of the Laws," in which he argued that there could be no liberty when all government power was…

  7. Small hydroelectric power plants

    International Nuclear Information System (INIS)

    Helgesen, Boerre

    2002-01-01

    Small hydroelectric power plants are power plants of 1 - 10 MW. For a supplier, this is an unnatural limit. A more natural limit involves compact engine design and simplified control system. The article discusses most of the engine and electrotechnical aspects in the development, construction and operation of such a plant

  8. Nuclear power debate

    International Nuclear Information System (INIS)

    Hunwick, Richard

    2005-01-01

    A recent resurgence of interest in Australia in the nuclear power option has been largely attributed to growing concerns over climate change. But what are the real pros and cons of nuclear power? Have advances in technology solved the sector's key challenges? Do the economics stack up for Australia where there is so much coal, gas and renewable resources? Is the greenhouse footprint' of nuclear power low enough to justify its use? During May and June, the AIE hosted a series of Branch events on nuclear power across Sydney, Adelaide and Perth. In the interest of balance, and at risk of being a little bit repetitive, here we draw together four items that resulted from these events and that reflect the opposing views on nuclear power in Australia. Nuclear Power for Australia: Irrelevant or Inevitable? - a summary of the presentations to the symposium held by Sydney Branch on 8 June 2005. Nuclear Reactors Waste the Planet - text from the flyer distributed by The Greens at their protest gathering outside the symposium venue on 8 June 2005. The Case For Nuclear Power - an edited transcript of Ian Hore-Lacy's presentation to Adelaide Branch on 19 May 2005 and to Perth Branch on 28 June 2005. The Case Against Nuclear Power - an article submitted to Energy News by Robin Chappie subsequent to Mr Hore-Lacy's presentation to Perth Branch

  9. BWR power uprate

    International Nuclear Information System (INIS)

    Berry, K.K.

    2004-01-01

    This paper discusses the program developed by GE Nuclear Energy (GE) to increase the power output of Boiling Water Reactors (BWRs). For the implementation of power uprate, this unique approach reduces the cost, the uncertainty and the level of effort for both the utility and the licensing authority. (author)

  10. Power market competition

    International Nuclear Information System (INIS)

    Kelly, J.

    1998-01-01

    In the Unites States the prospect of greater competition in wholesale power market was immediately eclipsed by talk of retail competition. Attempts to move to retail competition have been costly and complex. Prudent public policy and economic analyses suggest that retail competition not be implemented until it can first be demonstrated that effective competition exists in wholesale power markets [it

  11. Power and leadership

    DEFF Research Database (Denmark)

    Fogsgaard, Morten Kusk; Elmholdt, Claus Westergård

    2016-01-01

    of this contribution is to emphasize the dynamics of power and leadership relations in organizations. Power is traditionally defined as forms of influence based on the execution of control and sanctions (Hatch 2011; Fogsgaard and Elmholdt 2014). However, in relation to leadership, this definition is insufficient...

  12. Power Curve Measurements, FGW

    DEFF Research Database (Denmark)

    Vesth, Allan; Kock, Carsten Weber

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine....

  13. Power Curve Measurements

    DEFF Research Database (Denmark)

    Federici, Paolo; Vesth, Allan

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine....

  14. Power Curve Measurements

    DEFF Research Database (Denmark)

    Villanueva, Héctor; Gómez Arranz, Paula

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine...

  15. Magnetohydrodynamic (MHD) power generation

    International Nuclear Information System (INIS)

    Chandra, Avinash

    1980-01-01

    The concept of MHD power generation, principles of operation of the MHD generator, its design, types, MHD generator cycles, technological problems to be overcome, the current state of the art in USA and USSR are described. Progress of India's experimental 5 Mw water-gas fired open cycle MHD power generator project is reported in brief. (M.G.B.)

  16. Reactor power measuring device

    International Nuclear Information System (INIS)

    Izumi, Mikio; Sano, Yuji; Seki, Eiji; Yoshida, Toshifumi; Ito, Toshiaki.

    1993-01-01

    The present invention provides a self-powered long detector having a sensitivity over the entire length of a reactor core as an entire control rod withdrawal range of a BWR type reactor, and a reactor power measuring device using a gamma ray thermometer which scarcely causes sensitivity degradation. That is, a hollow protection pipe is disposed passing through the reactor core from the outside of a reactor pressure vessel. The self-powered long detectors and the gamma ray thermometers are inserted and installed in the protection pipe. An average reactor power in an axial direction of the reactor relative to a certain position in the horizontal cross section of the reactor core is determined based on the power of the self-powered long detector over the entire length of the reactor core. Since the response of the self-powered detector relative to a local power change is rapid, the output is used as an input signal to a safety protection device of the reactor core. Further, a gamma ray thermometer secured in the reactor and having scarce sensitivity degradation is used instead of an incore travelling neutron monitor used for relative calibration of an existent neutron monitor secured in the reactor. (I.S.)

  17. Definition of Power Converters

    CERN Document Server

    Bordry, F

    2015-01-01

    The paper is intended to introduce power conversion principles and to define common terms in the domain. The concept s of sources and switches are defined and classified. From the basic laws of source interconnections, a generic method of power converter synthesis is presented. Some examples illustrate this systematic method. Finally, the commutation cell and soft commuta tion are introduced and discussedd.

  18. Stagings of Divine Power

    DEFF Research Database (Denmark)

    Holm, Bent

    2011-01-01

    Based on a combination of performativity and historicity royal Danish ceremonilality is analysed with a special regard to coronation ceremonies as a manifestation of the idea of godgiven royal power. Point of departure is the coronation of Christian 4. in 1596 and the theme of stagings of power...

  19. Power plant chemical technology

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    17 contributions covering topies of fossil fuel combustion, flue gas cleaning, power plant materials, corrosion, water/steam cycle chemistry, monitoring and control were presented at the annual meeting devoted to Power Plant Chemical Technology 1996 at Kolding (Denmark) 4-6 September 1996. (EG)

  20. China and nuclear power

    International Nuclear Information System (INIS)

    Fouquoire-Brillet, E.

    1999-01-01

    This book presents the history of nuclear power development in China from the first research works started in the 1950's for the manufacturing of nuclear weapons to the recent development of nuclear power plants. This study tries to answer the main questions raised by the attitude of China with respect to the civil and military nuclear programs. (J.S.)

  1. Nuclear power status 1999

    International Nuclear Information System (INIS)

    2000-01-01

    The document gives statistical information on nuclear power plants status in the world in 1999, including the number of reactors in operation or under construction, the electricity supplied by nuclear power reactors and the respective percentage of electricity produced by nuclear energy in 1999, and the total operating experience to 31 December 1999, by country

  2. Power plant at sea

    International Nuclear Information System (INIS)

    Roggen, M.

    2000-01-01

    Drilling platforms are rather inefficient when it comes to their own power supply. In view of ecotax and their environmental image, the offshore industry particularly the Norwegians is highly committed to changing this situation. An efficient power plant, specially designed for the offshore industry, might just prove to be the answer to their prayers

  3. Interconnected power systems

    International Nuclear Information System (INIS)

    Fassina, E.

    2001-01-01

    The import of electric power from foreign countries at profitable prices is today a determinant factor to prime the competition in a national free trade. It is important to define the power transmission capacity and economic regulations for import forms in 2001 [it

  4. Power from Ocean Waves.

    Science.gov (United States)

    Newman, J. N.

    1979-01-01

    Discussed is the utilization of surface ocean waves as a potential source of power. Simple and large-scale wave power devices and conversion systems are described. Alternative utilizations, environmental impacts, and future prospects of this alternative energy source are detailed. (BT)

  5. Nuclear Power Plants. Revised.

    Science.gov (United States)

    Lyerly, Ray L.; Mitchell, Walter, III

    This publication is one of a series of information booklets for the general public published by the United States Atomic Energy Commission. Among the topics discussed are: Why Use Nuclear Power?; From Atoms to Electricity; Reactor Types; Typical Plant Design Features; The Cost of Nuclear Power; Plants in the United States; Developments in Foreign…

  6. NUCLEAR POWER PLANT

    Science.gov (United States)

    Carter, J.C.; Armstrong, R.H.; Janicke, M.J.

    1963-05-14

    A nuclear power plant for use in an airless environment or other environment in which cooling is difficult is described. The power plant includes a boiling mercury reactor, a mercury--vapor turbine in direct cycle therewith, and a radiator for condensing mercury vapor. (AEC)

  7. Power and environmental assessment

    DEFF Research Database (Denmark)

    Cashmore, Matthew Asa; Richardson, Tim

    2013-01-01

    The significance of politics and power dynamics has long been recognised in environmental assessment (EA) research, but there has not been sustained attention to power, either theoretically or empirically. The aim of this special issue is to encourage the EA community to engage more consistently...

  8. Fusion Power Deployment

    International Nuclear Information System (INIS)

    Schmidt, J.A.; Ogden, J.M.

    2002-01-01

    Fusion power plants could be part of a future portfolio of non-carbon dioxide producing energy supplies such as wind, solar, biomass, advanced fission power, and fossil energy with carbon dioxide sequestration. In this paper, we discuss key issues that could impact fusion energy deployment during the last half of this century. These include geographic issues such as resource availability, scale issues, energy storage requirements, and waste issues. The resource needs and waste production associated with fusion deployment in the U.S. should not pose serious problems. One important feature of fusion power is the fact that a fusion power plant should be locatable within most local or regional electrical distribution systems. For this reason, fusion power plants should not increase the burden of long distance power transmission to our distribution system. In contrast to fusion power, regional factors could play an important role in the deployment of renewable resources such as wind, solar and biomass or fossil energy with CO2 sequestration. We examine the role of these regional factors and their implications for fusion power deployment

  9. Balakovo nuclear power station

    International Nuclear Information System (INIS)

    1996-01-01

    A key means of improving the safety and reliability of nuclear power plants is through effective training of plant personnel. The goal of this paper is to show the progress of the training at the Balakovo Nuclear Power Plant, and the important role that international cooperation programs have played in that progress

  10. N-power

    International Nuclear Information System (INIS)

    Anon.

    1982-01-01

    A recent study by the Markinor market research firm shows the more experience you have with nuclear power stations, the less likely you are to want more. A survey of people's attitudes and levels of awareness of nuclear power was done

  11. Power, plutonium and politics

    International Nuclear Information System (INIS)

    Simpson, J.

    1982-01-01

    Distinctions between civil and military nuclear energy activities in the context of the Anglo-American trading relationship are described. Origins of the civil-military divide, the beginning of the nuclear power industry, and the use of British nuclear power stations for military purposes are discussed together with IAEA safeguards and US policies initiated by the Carter and Reagan administrations. (U.K.)

  12. Nuclear power economics

    International Nuclear Information System (INIS)

    Moynet, G.

    1987-01-01

    The economical comparison of nuclear power plants with coal-fired plants in some countries or areas are analyzed. It is not difficult to show that nuclear power will have a significant and expanding role to play in providing economic electricity in the coming decades. (Liu)

  13. Nuclear power revisited

    International Nuclear Information System (INIS)

    Grear, B.

    2008-01-01

    Modern development of nuclear power technology and the established framework of international agreements and conventions are responding to the major political, economic and environmental issues - high capital costs, the risks posed by nuclear wastes and accidents, and the proliferation of nuclear weaponry - that until recently hindered the expansion of nuclear power.

  14. Reactor power control device

    International Nuclear Information System (INIS)

    Watanabe, Mitsutaka

    1997-01-01

    Hardware of an analog nuclear instrumentation system is reformed, a function generator is added to a setting calculation circuit of the nuclear instrumentation system, and each of setting lines of the nuclear instrumentation system is set in parallel with an upper limit curve in an operation region defined by a second order or third order equation. Upon transient change of abnormal power elevation during operation, scram signals are generated by power change in the same state as 100% rated operation due to elevation of reactor thermal power. Since the operation limit value relative to transient change due to power elevation can be made substantially equal with the same as that upon rated operation, the operation limit value for partial power operation state can be kept substantially the same level as that upon rated operation. When transition change caused by abnormal control rod withdrawal occurs during operation, a control rod withdrawal inhibition signal can ensure the power elevation width equal with that upon rated power operation, and since the withdrawal inhibition signal is generated in substantially the same withdrawing state, the operation limit value relative to a partial power operation state can be kept at the same level as that during rated operation. (N.H.)

  15. Nuclear power: Pt. 3

    International Nuclear Information System (INIS)

    Van Wyk, A.

    1985-01-01

    The use of nuclear power in warfare is viewed from the point of use usefullness, essentiality and demolition. The effects of a H-bomb explosion are discussed as well as the use of nuclear power in warfare, with a Christian ethical background

  16. Private power in China

    International Nuclear Information System (INIS)

    Daniel, Martin

    1999-10-01

    Contains Executive Summary and Chapters on: Introduction; Political and economic background; Energy supply; The Chinese electricity sector; Private power in China; Issues for private investors; Fuel choice in private projects; Private investors in China; Listed Chinese generators; Private power prospects; Implemented private generation projects; Planned private Generation Projects; Plants owned by listed Chinese generators. (Author)

  17. PowerCLI cookbook

    CERN Document Server

    Sellers, Philip

    2015-01-01

    If you are a virtualization professional who wants to unleash the power of automation and combat the complexity of sprawling virtual environments, this book is ideal for you. This book will enhance your skills of administering VMware vSphere and vCloud Director with PowerCLI.

  18. Liberal power Europe

    NARCIS (Netherlands)

    Wagner, W.M.

    2017-01-01

    The European Union is best understood as a liberal power – as an actor that is composed of liberal democracies whose interests, identities and institutions motivate and constrain its policy. The conceptualization of the EU as a liberal power helps to overcome three shortcomings of alternative

  19. Power Curve Measurements FGW

    DEFF Research Database (Denmark)

    Federici, Paolo; Kock, Carsten Weber

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine...

  20. Power Technologies Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, L.

    2002-09-01

    This report, prepared by NREL's Energy Analysis Office, includes up-to-date information on power technologies, including complete technology profiles. The data book also contains charts on electricity restructuring, power technology forecasts and comparisons, electricity supply, electricity capability, electricity generation, electricity demand, prices, economic indicators, environmental indicators, conversion factors, and selected congressional questions and answers.

  1. Nuclear power prospects

    International Nuclear Information System (INIS)

    Staebler, K.

    1994-01-01

    The technical, economic and political prospects of nuclear power are described with regard to ecological aspects. The consensus talks, which failed in spite of the fact that they were stripped of emotional elements and in spite of major concessions on the part of the power industry, are discussed with a view to the political and social conditions. (orig.) [de

  2. Nuclear Power Prospects

    International Nuclear Information System (INIS)

    Cintra do Prado, L.

    1966-01-01

    The present trend is to construct larger plants: the average power of the plants under construction at present, including prototypes, is 300 MW(e), i.e. three times higher than in the case of plants already in operation. Examples of new large-scale plants ares (a) Wylfa, Anglesey, United Kingdom - scheduled power of 1180 MW(e) (800 MW to be installed by 1967), to be completed in 1968; (b) ''Dungeness B'', United Kingdom - scheduled power of 1200 MW(e); (c) second unit for United States Dresden power plant - scheduled power of 715 MW(e) minimum to almost 800 MW(e). Nuclear plants on the whole serve the same purpose as conventional thermal plants

  3. Resonant High Power Combiners

    CERN Document Server

    Langlois, Michel; Peillex-Delphe, Guy

    2005-01-01

    Particle accelerators need radio frequency sources. Above 300 MHz, the amplifiers mostly used high power klystrons developed for this sole purpose. As for military equipment, users are drawn to buy "off the shelf" components rather than dedicated devices. IOTs have replaced most klystrons in TV transmitters and find their way in particle accelerators. They are less bulky, easier to replace, more efficient at reduced power. They are also far less powerful. What is the benefit of very compact sources if huge 3 dB couplers are needed to combine the power? To alleviate this drawback, we investigated a resonant combiner, operating in TM010 mode, able to combine 3 to 5 IOTs. Our IOTs being able to deliver 80 kW C.W. apiece, combined power would reach 400 kW minus the minor insertion loss. Values for matching and insertion loss are given. The behavior of the system in case of IOT failure is analyzed.

  4. Managing Functional Power

    DEFF Research Database (Denmark)

    Rosenstand, Claus Andreas Foss; Laursen, Per Kyed

    2013-01-01

    How does one manage functional power relations between leading functions in vision driven digital media creation, and this from idea to master during the creation cycle? Functional power is informal, and it is understood as roles, e.g. project manager, that provide opportunities to contribute...... to the product quality. The area of interest is the vision driven digital media industry in general; however, the point of departure is the game industry due to its aesthetic complexity. The article's contribution to the area is a power graph, which shows the functional power of the leading functions according...... to a general digital media creation cycle. This is used to point out potential power conflicts and their consequences. It is concluded that there is normally more conflict potential in vision driven digital media creation than in digital media creation in general or in software development. The method...

  5. Reactor power monitoring device

    International Nuclear Information System (INIS)

    Kono, Shigehiro.

    1990-01-01

    Among a plurality of power monitoring programs in a reactor power monitoring device, rapid response is required for a scram judging program for the power judging processing of scram signals. Therefore, the scram judging program is stored independently from other power monitoring programs, applied with a priority order, and executed in parallel with other programs, to output scram signals when the detected data exceeds a predetermined value. As a result, the capacity required for the scram judging program is reduced and the processing can be conducted in a short period of time. In addition, since high priority is applied to the scram judging program which is divided into a small capacity, it is executed at higher frequency than other programs when they are executed in parallel. That is, since the entire processings for the power monitoring program are repeated in a short cycle, the response speed of the scram signals required for high responsivity can be increased. (N.H.)

  6. Nuclear power in India

    International Nuclear Information System (INIS)

    Bose, D.K.

    1980-01-01

    India has now nine years of experience with her in nuclear power generation. The system has been acclaimed on various grounds by the authority concerned with its organization in the country. The present paper intends to examine critically the claim for economic superiority of the nuclear power over the thermal power which is asserted often by the spokesmen for the former. Information about the cost of nuclear power that is available to researchers in India is very meagre. Whatever appears in official publications is hardly adequate for working out reasonable estimates for scrutiny. One is therefore left to depend on the public statements made by dignitaries from time to time to form an idea about the economics of nuclear power. Due to gaps in information we are constrained to rely on the foreign literature and make careful guesses about possible costs applicable to India

  7. Tariffs on power trading

    International Nuclear Information System (INIS)

    Van de Water, C.J.

    1995-01-01

    For optimal use of power systems, transmission services must be independent from production. Moreover the costs of electrical energy transmission should be well known and be paid according to a tariff system approximating to the real network costs. These two conditions for power trading will lead to an optimal power system. In a competitive power production market, the transmission and distribution companies will remain monopolistic because they are the only facilitators of power trading. The pricing signals of the transmission and distribution costs determine the playing field for the competitors. These are production offers and bidders. The transmission pricing must for that reason be simple, correct and based on marginal costs to make optimal use of the system

  8. Antares laser power amplifier

    International Nuclear Information System (INIS)

    Stine, R.D.; Ross, G.F.; Silvernail, C.

    1979-01-01

    The overall design of the Antares laser power amplifier is discussed. The power amplifier is the last stage of amplification in the 100-kJ Antares laser. In the power amplifier a single, cylindrical, grid-controlle, cold-cathode electron gun is surrounded by 12 large-aperture CO 2 electron-beam sustained laser discharge sectors. Each power amplifier will deliver 18 kJ and the six modules used in Antares will produce the required 100 kJ for delivery to the target. A large-scale interaction between optical, mechanical, and electrical disciplines is required to meet the design objectives. Significant component advances required by the power amplifier design are discussed

  9. Power in Practice

    DEFF Research Database (Denmark)

    Adler-Nissen, Rebecca; Pouliot, Vincent

    2014-01-01

    , in practice, state representatives translate their skills into actual influence and generate a power politics that eschews structural analysis. We argue that seemingly trivial struggles over diplomatic competence within these three multilateral organizations played a crucial role in the intervention in Libya......How does power work in practice? Much of the “stuff” that state agents and other international actors do, on an everyday basis, remains impenetrable to existing IR theory. This is unfortunate, as the everyday performance of international practices actually helps shape world policy outcomes....... In this article we develop a framework to grasp the concrete workings of power in international politics. The notion of “emergent power” bridges two different understandings of power: as capability or relation. Emergent power refers to the generation and deployment of endogenous resources – social skills...

  10. Improving Power Converter Reliability

    DEFF Research Database (Denmark)

    Ghimire, Pramod; de Vega, Angel Ruiz; Beczkowski, Szymon

    2014-01-01

    of a high-power IGBT module during converter operation, which may play a vital role in improving the reliability of the power converters. The measured voltage is used to estimate the module average junction temperature of the high and low-voltage side of a half-bridge IGBT separately in every fundamental......The real-time junction temperature monitoring of a high-power insulated-gate bipolar transistor (IGBT) module is important to increase the overall reliability of power converters for industrial applications. This article proposes a new method to measure the on-state collector?emitter voltage...... is measured in a wind power converter at a low fundamental frequency. To illustrate more, the test method as well as the performance of the measurement circuit are also presented. This measurement is also useful to indicate failure mechanisms such as bond wire lift-off and solder layer degradation...

  11. Power module assembly

    Science.gov (United States)

    Campbell, Jeremy B [Torrance, CA; Newson, Steve [Redondo Beach, CA

    2011-11-15

    A power module assembly of the type suitable for deployment in a vehicular power inverter, wherein the power inverter has a grounded chassis, is provided. The power module assembly comprises a conductive base layer electrically coupled to the chassis, an insulating layer disposed on the conductive base layer, a first conductive node disposed on the insulating layer, a second conductive node disposed on the insulating layer, wherein the first and second conductive nodes are electrically isolated from each other. The power module assembly also comprises a first capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the first conductive node, and further comprises a second capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the second conductive node.

  12. Nuclear power for beginners

    International Nuclear Information System (INIS)

    Croall, S.; Sempler, K.

    1979-01-01

    Witty, critically, and with expert knowledge, 'Atomic power for beginners' describes the development of nuclear power for military purposes and its 'peaceful uses' against the will of the population. Atomic power, the civil baby of the bomb is not only a danger to our lives - it is enemy to all life as all hard technologies are on which economic systems preoccupied with growth put their hopes. Therefore, 'Atomic power for beginners' does not stop at nuclear engineering but proceeds to investigate its consequences, nationally and with a view to the Third World. And since the consequences are so fatal and it is not enough to say no to nuclear power, it gives some thoughts to a better future - with soft technology and alternative production. (orig.) 891 HP/orig. 892 MKO [de

  13. Tuning magnet power supply

    International Nuclear Information System (INIS)

    Han, B.M.; Karady, G.G.; Thiessen, H.A.

    1989-01-01

    The particles in a Rapid Cycling Accelerator are accelerated by rf cavities, which are tuned by dc biased ferrite cores. The tuning is achieved by the regulation of bias current, which is produced by a power supply. The tuning magnet power supply utilizes a bridge circuit, supplied by a three phase rectifier. During the rise of the current, when the particles are accelerated, the current is controlled with precision by the bridge which operates a power amplifier. During the fall of the current, the bridge operates in a switching mode and recovers the energy stored in the ferrites. The recovered energy is stored in a capacitor bank. The bridge circuit is built with 150 power transistors. The drive, protection and control circuit were designed and built from commercial component. The system will be used for a rf cavity experiment in Los Alamos and will serve as a prototype tuning power supply for future accelerators. 1 ref., 7 figs

  14. Mobile nuclear power systems

    International Nuclear Information System (INIS)

    Andersson, B.

    1988-11-01

    This report is meant to present a general survey of the mobile nuclear power systems and not a detailed review of their technical accomplishments. It is based in published material mainly up to 1987. Mobile nuclear power systems are of two fundamentally different kinds: nuclear reactors and isotopic generators. In the reactors the energy comes from nuclear fission and in the isotopic generators from the radioactive decay of suitable isotopes. The reactors are primarily used as power sourves on board nuclear submarines and other warships but have also been used in the space and in remote places. Their thermal power has ranged from 30 kWth (in a satellite) to 175 MWth (on board an aircraft carrier). Isotopic generators are suitable only for small power demands and have been used on board satellites and spaceprobes, automatic weatherstations, lighthouses and marine installations for navigation and observation. (author)

  15. Biomass power in transition

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, D.K. [Zurn/NEPCO, Redmond, WA (United States)

    1996-12-31

    Electricity production from biomass fuel has been hailed in recent years as an environmentally acceptable energy source that delivers on its promise of economically viable renewable energy. A Wall Street Journal article from three years ago proclaimed wood to be {open_quotes}moving ahead of costly solar panels and wind turbines as the leading renewable energy alternative to air-fouling fossils fuels and scary nuclear plants.{close_quotes} Biomass fuel largely means wood; about 90% of biomass generated electricity comes from burning waste wood, the remainder from agricultural wastes. Biomass power now faces an uncertain future. The maturing of the cogeneration and independent power plant market, restructuring of the electric industry, and technological advances with power equipment firing other fuels have placed biomass power in a competitive disadvantage with other power sources.

  16. Development of nuclear power

    International Nuclear Information System (INIS)

    1960-01-01

    The discussion on the development of nuclear power took place on 28 September 1960 in Vienna. In his opening remarks, Director General Cole referred to the widespread opinion that 'the prospect of cheap electricity derived from nuclear energy offers the most exciting prospect for improving the lot of mankind of all of the opportunities for uses of atomic energy'. He then introduced the four speakers and the moderator of the discussion, Mr. H. de Laboulaye, IAEA Deputy Director General for Technical Operations. n the first part of the discussion the experts addressed themselves in turn to four topics put forward by the moderator. These were: the present technical status of nuclear power, the present costs of nuclear power, prospects for future reductions in the cost of nuclear power, and applications of nuclear power in less-developed areas

  17. Competitive power development

    Energy Technology Data Exchange (ETDEWEB)

    Garrity, T.F.; Stoll, H.G. [GE Power Systems Engineering, Schenectady, NY (United States)

    1994-12-31

    Electric power is essential to economic growth and the improvement in the standard of living in modern societies. Maximizing the overall economic efficiency of electric power production can lead to even stronger economic growth. Overall electricity efficiency can be driven by utilization of the newest and most economically efficient technologies, utilization of the most efficient financial structuring, and efficient integration of coproduction of electricity and process energy. The challenge is to drive the power generation strategy toward maximum economic efficiency while improving the overall country environment emissions. This paper reviews the key power generation technologies available today and in the near future. Of key importance is the capital cost, efficiency, environmental impacts, and reliability of each technology and how these technologies can be integrated with efficient financial structurings to maximize the country power generation economic efficiency. Examples of several countries are used to show recent successes in maximizing economic efficiency.

  18. Optimal Power Flow Pursuit

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Anese, Emiliano; Simonetto, Andrea

    2018-03-01

    This paper considers distribution networks featuring inverter-interfaced distributed energy resources, and develops distributed feedback controllers that continuously drive the inverter output powers to solutions of AC optimal power flow (OPF) problems. Particularly, the controllers update the power setpoints based on voltage measurements as well as given (time-varying) OPF targets, and entail elementary operations implementable onto low-cost microcontrollers that accompany power-electronics interfaces of gateways and inverters. The design of the control framework is based on suitable linear approximations of the AC power-flow equations as well as Lagrangian regularization methods. Convergence and OPF-target tracking capabilities of the controllers are analytically established. Overall, the proposed method allows to bypass traditional hierarchical setups where feedback control and optimization operate at distinct time scales, and to enable real-time optimization of distribution systems.

  19. Financing nuclear power

    International Nuclear Information System (INIS)

    Sheriffah Noor Khamseah Al-Idid Syed Ahmad Idid

    2009-01-01

    Global energy security and climate change concerns sparked by escalating oil prices, high population growth and the rapid pace of industrialization are fueling the current interest and investments in nuclear power. Globally, a significant number policy makers and energy industry leaders have identified nuclear power as a favorable alternative energy option, and are presently evaluating either a new or an expanded role for nuclear power. The International Atomic Energy Agency (IAEA) has reported that as of October 2008, 14 countries have plans to construct 38 new nuclear reactors and about 100 more nuclear power plants have been written into the development plans of governments for the next three decades. Hence as new build is expected to escalate, issues of financing will become increasingly significant. Energy supply, including nuclear power, considered as a premium by government from the socio-economic and strategic perspective has traditionally been a sector financed and owned by the government. In the case for nuclear power, the conventional methods of financing include financing by the government or energy entity (utility or oil company) providing part of the funds from its own resources with support from the government. As national financing is, as in many cases, insufficient to fully finance the nuclear power plants, additional financing is sourced from international sources of financing including, amongst others, Export Credit Agencies (ECAs) and Multilateral Development Institutions. However, arising from the changing dynamics of economics, financing and business model as well as increasing concerns regarding environmental degradation , transformations in methods of financing this energy sector has been observed. This paper aims to briefly present on financing aspects of nuclear power as well as offer some examples of the changing dynamics of financing nuclear power which is reflected by the evolution of ownership and management of nuclear power plants

  20. The development of Chinese power industry and its nuclear power

    International Nuclear Information System (INIS)

    Zhou Dabin

    2002-01-01

    The achievements and disparity of Chinese power industry development is introduced. The position and function of nuclear power in Chinese power industry is described. Nuclear power will play a role in ensuring the reliable and safe supply of primary energy in a long-term and economic way. The development prospects of power source construction in Chinese power industry is presented. Challenge and opportunity in developing nuclear power in China are discussed

  1. Power from biomass: the power utility perspective

    International Nuclear Information System (INIS)

    Serafimova, K.; Angele, H.-C.

    2008-01-01

    This article takes a look at possible strategies that electricity utilities in Switzerland could follow in order to be able to make use of biomass as a source of energy. Increasing interest in damp biomass as a relatively cheap, renewable and climate-friendly source of energy is commented on. Strategic choices that energy utilities have to make when they decide to enter into the biomass market are examined. The potentials involved are examined, including biogenic materials from domestic wastes and from agriculture. Figures on potential waste tonnage are quoted. Questions on subsidies and the free market are examined. The setting up of 'virtual power stations' - networks of installations using photovoltaic, wind and biomass - is discussed, as are various strategies that utilities can follow in this area. Examples of such 'virtual power stations' are listed.

  2. TEP Power Partners Project [Tucson Electric Power

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-02-06

    The Arizona Governor’s Office of Energy Policy, in partnership with Tucson Electric Power (TEP), Tendril, and Next Phase Energy (NPE), formed the TEP Power Partners pilot project to demonstrate how residential customers could access their energy usage data and third party applications using data obtained from an Automatic Meter Reading (AMR) network. The project applied for and was awarded a Smart Grid Data Access grant through the U.S. Department of Energy. The project participants’ goal for Phase I is to actively engage 1,700 residential customers to demonstrate sustained participation, reduction in energy usage (kWh) and cost ($), and measure related aspects of customer satisfaction. This Demonstration report presents a summary of the findings, effectiveness, and customer satisfaction with the 15-month TEP Power Partners pilot project. The objective of the program is to provide residential customers with energy consumption data from AMR metering and empower these participants to better manage their electricity use. The pilot recruitment goals included migrating 700 existing customers from the completed Power Partners Demand Response Load Control Project (DRLC), and enrolling 1,000 new participants. Upon conclusion of the project on November 19, 2013; 1,390 Home Area Networks (HANs) were registered; 797 new participants installed a HAN; Survey respondents’ are satisfied with the program and found value with a variety of specific program components; Survey respondents report feeling greater control over their energy usage and report taking energy savings actions in their homes after participating in the program; On average, 43 % of the participants returned to the web portal monthly and 15% returned weekly; and An impact evaluation was completed by Opinion Dynamics and found average participant savings for the treatment period1 to be 2.3% of their household use during this period.2 In total, the program saved 163 MWh in the treatment period of 2013.

  3. Nuclear power and other energy

    International Nuclear Information System (INIS)

    Doederlein, J.M.

    1975-01-01

    A comparison is made between nuclear power plants, gas-fuelled thermal power plants and oil-fired thermal power plants with respect to health factors, economy, environment and resource exploitation, with special reference to the choice of power source to supplement Norwegian hydroelectric power. Resource considerations point clearly to nuclear power, but, while nuclear power has an overall economic advantage, the present economic situation makes its heavy capital investment a disadvantage. It is maintained that nuclear power represents a smaller environmental threat than oil or gas power. Finally, statistics are given showing that nuclear power involves smaller fatality risks for the population than many other hazards accepted without question. (JIW)

  4. Inductive power transfer: Powering our future

    International Nuclear Information System (INIS)

    Covic, Grant A

    2013-01-01

    The ability to provide power without wires was imagined over a century ago, but assumed commercially impractical and impossible to realise. However for more than two decades the University of Auckland has been at the forefront of developing and commercialising this technology alongside its industrial partners. This research has proven that significant wireless power can be transferred over relatively large air-gaps efficiently and robustly. Early solutions were applied in industrial applications to power moving vehicles in clean room systems, industrial plants, and in theme parks, but more recently this research has helped develop technology that has the ability to impact us directly at home. The seminar will describe some of the early motivations behind this research, and introduce some of the solutions which have been developed by the team of researchers at Auckland over two decades, many of which have found their way into the market. It will also describe how the technology has recently been re-developed to enable battery charging of electric vehicles without the need to plug in, and alongside this how it has the potential to change the way we drive in the future

  5. PowerPal: power up your creek

    International Nuclear Information System (INIS)

    2006-01-01

    PowerPal micro-hydro equipment was developed in Vietnam by Asian Phoenix Resources Ltd. of Victoria, BC; a company who aims to help disadvantaged people in less developed countries by making renewable energy devices available to them. The idea for the micro-hydro system was conceived after mineral exploration parties in Vietnam noted that large numbers of poor quality propeller turbines were being used to supply AC power to individual homes. A plan was developed to improve the quality and reliability of low head turbines with better castings, magnets, superior bearings and electronic load controllers. Funding for the program was initially difficult to obtain. However, PowerPal micro-hydro equipment eventually came to the attention of the World Bank as well as other government and non-governmental organizations. Financing for the purchase and installation of larger numbers of units has now been achieved, and missionary groups in various parts of the world have ordered units. European markets have also opened up, and distributors of the micro-hydro equipment have been appointed in various countries. Sales are now strong in Central America, South America, the Caribbean, Australasia, Oceania, Africa and Europe. It was concluded that the surge of interest has coincided with a steep upturn in oil prices. 8 figs

  6. Nuclear power generation

    International Nuclear Information System (INIS)

    Hirao, Katumi; Sato, Akira; Kaimori, Kimihiro; Kumano, Tetsuji

    2001-01-01

    Nuclear power generation for commercial use in Japan has passed 35 years since beginning of operation in the Tokai Nuclear Power Station in 1966, and has 51 machines of reactor and about 44.92 MW of total output of equipment scale in the 21st century. However, an environment around nuclear energy becomes severer at present, and then so many subjects to be overcome are remained such as increased unreliability of the public on nuclear energy at a chance of critical accident of the JCO uranium processing facility, delay of pull-thermal plan, requirement for power generation cost down against liberalization of electric power, highly aging countermeasure of power plant begun its operation as its Genesis, and so on. Under such conditions, in order that nuclear power generation in Japan survives as one of basic electric source in future, it is necessary not only to pursue safety and reliability of the plant reliable to the public, but also to intend to upgrade its operation and maintenance by positively adopting good examples on operational management method on abroad and to endeavor further upgrading of application ratio of equipments and reduction of generation cost. Here were outlined on operation conditions of nuclear power stations in Japan, and introduced on upgrading of their operational management and maintenance management. (G.K.)

  7. Development of nuclear power

    International Nuclear Information System (INIS)

    1962-01-01

    An extensive discussion of problems concerning the development of nuclear power took place at the fifth regular session of the IAEA General Conference in September-October 1961. Not only were there many references in plenary meetings to the nuclear power plans of Member States, but there was also a more specific and detailed debate on the subject, especially on nuclear power costs, in the Program, Technical and Budget Committee of the Conference. The Conference had before it a report from the Board of Governors on the studies made by the Agency on the economics of nuclear power. In addition, it had been presented with two detailed documents, one containing a review of present-day costs of nuclear power and the other containing technical and economic information on several small and medium-sized power reactors in the United States. The Conference was also informed of the report on methods of estimating nuclear power costs, prepared with the assistance of a panel of experts convened by the Agency, which was reviewed in the July 1961 issue of this Bulletin

  8. Development of nuclear power

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1962-01-15

    An extensive discussion of problems concerning the development of nuclear power took place at the fifth regular session of the IAEA General Conference in September-October 1961. Not only were there many references in plenary meetings to the nuclear power plans of Member States, but there was also a more specific and detailed debate on the subject, especially on nuclear power costs, in the Program, Technical and Budget Committee of the Conference. The Conference had before it a report from the Board of Governors on the studies made by the Agency on the economics of nuclear power. In addition, it had been presented with two detailed documents, one containing a review of present-day costs of nuclear power and the other containing technical and economic information on several small and medium-sized power reactors in the United States. The Conference was also informed of the report on methods of estimating nuclear power costs, prepared with the assistance of a panel of experts convened by the Agency, which was reviewed in the July 1961 issue of this Bulletin

  9. 11 World power conference

    International Nuclear Information System (INIS)

    Masters, R.

    1981-01-01

    Papers presented to the 11 World power conference ''Power for our peace'' held in Munich in September, 1980 are shortly surveyed. A few papers were devoted to nuclear power, that represents its present- state-of-the-art in the world. Except for the paper presented by experts of the International Energy Agency (IEA) and a number of others, there is carefulness and realism with respect to nuclear power in the most part of the papers; its forecasted growth rates are rather moderate. Even in the IEA paper the total world nuclear installed capacity in 1985 is evaluated about 550 GW, that is substantially smaller earlier evaluations. It is acknowledged that the primary energy production almost in all countries will increase mainly due to nuclear power and coal. But there are no answers to the problems related to management of the nuclear power development and to the public opinion in many countries. It is underlined that the problems of world power supply can be solved only on an international basis [ru

  10. Delayed power analysis

    International Nuclear Information System (INIS)

    Adamovich, L.A.; Azarov, V.V.

    1999-01-01

    Time dependent core power behavior in a nuclear reactor is described with well-known neutron kinetics equations. At the same time, two portions are distinguished in energy released from uranium nuclei fission; one released directly at fission and another delayed (residual) portion produced during radioactive decay of fission products. While prompt power is definitely described with kinetics equations, the delayed power presentation still remains outstanding. Since in operation the delayed power part is relatively small (about 6%) operation, it can be neglected for small reactivity disturbances assuming that entire power obeys neutron kinetics equations. In case of a high negative reactivity rapidly inserted in core (e.g. reactor scram initiation) the prompt and delayed components can be calculated separately with practically no impact on each other, employing kinetics equations for prompt power and known approximation formulas for delayed portion, named residual in this specific case. Under substantial disturbances the prompt component in the dynamic process becomes commensurable with delayed portion, thus making necessary to take into account their cross impact. A system of differential equations to describe time-dependent behavior of delayed power is presented. Specific NPP analysis shows a way to significantly simplify the task formulation. (author)

  11. Nuclear power controversy

    International Nuclear Information System (INIS)

    Murphy, A.W.

    1976-01-01

    Arthur W. Murphy in the introductory chapter cites the issues, pro and con, concerning nuclear power. In assessing the present stance, he first looks back to the last American Assembly on nuclear power, held October 1957 and notes its accomplishments. He summarizes the six papers of this book, which focus on nuclear power to the end of this century. Chapter I, Safety Aspects of Nuclear Energy, by David Bodansky and Fred Schmidt, deals with the technical aspects of reactor safety as well as waste storage and plutonium diversion. Chapter 2, The Economics of Electric Power Generation--1975-2000, by R. Michael Murray, Jr., focuses specifically on coal-fired and nuclear plants. Chapter 3, How Can We Get the Nuclear Job Done, by Fritz Heimann, identifies actions that must take place to develop nuclear power in the U.S. and who should build the reprocessing plants. Chapter 4, by Arthur Murphy, Nuclear Power Plant Regulation, discusses the USNRC operation and the Price-Anderson Act specifically. Chapter 5, Nuclear Exports and Nonproliferation Strategy, by John G. Palfrey, treats the international aspects of the problem with primary emphasis upon the situation of the U.S. as an exporter of technology. Chapter 6, by George Kistiakowsky, Nuclear Power: How Much Is Too Much, expresses doubt about the nuclear effort, at least in the short run

  12. Electric power annual 1992

    Energy Technology Data Exchange (ETDEWEB)

    1994-01-06

    The Electric Power Annual presents a summary of electric utility statistics at national, regional and State levels. The objective of the publication is to provide industry decisionmakers, government policymakers, analysts and the general public with historical data that may be used in understanding US electricity markets. The Electric Power Annual is prepared by the Survey Management Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. ``The US Electric Power Industry at a Glance`` section presents a profile of the electric power industry ownership and performance, and a review of key statistics for the year. Subsequent sections present data on generating capability, including proposed capability additions; net generation; fossil-fuel statistics; retail sales; revenue; financial statistics; environmental statistics; electric power transactions; demand-side management; and nonutility power producers. In addition, the appendices provide supplemental data on major disturbances and unusual occurrences in US electricity power systems. Each section contains related text and tables and refers the reader to the appropriate publication that contains more detailed data on the subject matter. Monetary values in this publication are expressed in nominal terms.

  13. Power generating device

    Energy Technology Data Exchange (ETDEWEB)

    Onodera, Toshihiro

    1989-05-02

    The existing power generating device consisting of static components only lacks effective measures to utilize solar energy and maintain power generation, hence it is inevitable to make the device much larger and more complicated in order to utilize it as the primary power source for artificial satellites. In view of the above, in order to offer a power generating device useful for the primary power source for satellites which is simple and can keep power generation by solar energy, this invention proposes a power generating device composed of the following elements: (1) a rectangular parallelopiped No. II superconductor plate; (2) a measure to apply a magnetic field to one face of the above superconductor plate; (3) a measure to provide a temperature difference within the range between the starting temperature and the critical temperature of superconductivity to a pair of faces meeting at right angles with the face to which the magnetic field was applied by the above measure; (4) a measure to provide an electrode on each of the other pair of faces meeting at right angles with the face to which the magnetic field was applied by the above measure and form a closed circuit by connecting the each electrode above to each of a pair of electrodes of the load respectively; and (5) a switching measure which is installed in the closed circuit prepared by the above measure and shuts off the closed circuit when the direction of the electric current running the above closed circuit is reversed. 6 figs.

  14. Wind power barometer

    International Nuclear Information System (INIS)

    2014-01-01

    The worldwide wind power increased by 12.4% in 2013 to reach 318.6 GW but the world market globally decreased by losing 10 GW: only 35.6 GW have been installed in 2013 which is even less than was installed in 2009. This activity contraction is mainly due to the collapse of the American market, American authorities having been late to decide to maintain federal incentives. The European wind power market also contracted in 2013 because of the lack of trust of the investors in the new energy policies of the European governments. In the rest of the world wind energy has kept on growing particularly in China and Canada. At the end of 2013 the cumulated wind power reached 117,73 GW in Europe. About 1.5 MW out of 10 MW of wind power installed in Europe in 2013 come from off-shore wind farms, United-Kingdom and Denmark being the most important players by totalling more than 70% of the off-shore wind power installed at the end of 2013. Various charts and tables give the figures of the wind power cumulated and installed in 2013 in different parts of the world: Europe, North America and Asia, the time evolution of the worldwide wind power since 1995, the wind power cumulated and installed in 2013 for the different countries of Europe and the ratio between the cumulated wind power and the country population. A table lists the main manufacturers of wind turbines and gives their turnover and number of employees at the end of 2013

  15. Society and Social Power

    Directory of Open Access Journals (Sweden)

    Janani Harish

    2014-10-01

    Full Text Available Society is the source of immense power. Over the past few centuries humanity has record­ed phenomenal growth in its collective capacity for accomplishment, as reflected in the 12-fold growth in global per capita income since 1800. The remarkable achievements in living standards, longevity, science, technology, industry, education, democracy, human rights, peace and global governance are the result of the exponential development of the capacity of society to harness human energies and convert them into social power for productive purposes. Today, humanity possesses the power and capabilities needed to fully meet the multi-dimensional challenges confronting global society. The source of this energy is people. Human energy is transformed into social power by the increasing reach, frequency and complexity of human relationships. Society is a complex living network of organized relationships between people. Its power issues from channelizing our collective energies in productive ways by means of organizing principles such as coordination, systems, specialization of function, hierarchy of authority, and integration. This immense social power remains largely underutilized. Social science needs to evolve a comprehensive, trans-disciplinary understanding of the roots of social power and the process by which it is generated, distributed and applied. This knowledge is the essential foundation for formulating effective social policies capable of eradicating forever persistent poverty, unemployment and social inequality. This article is based on a series of lectures delivered by the author in the WAAS-WUC course on “Toward a Trans-disciplinary Science of Society” at Dubrovnik on September 1-3, 2014. It traces the development of social power in different fields to show that human and social capital are inexhaustible in potential. The more we harness them, the more they grow. Unleashing, directing, channeling and converting human potential into social

  16. Thermoelectric power generator for variable thermal power source

    Science.gov (United States)

    Bell, Lon E; Crane, Douglas Todd

    2015-04-14

    Traditional power generation systems using thermoelectric power generators are designed to operate most efficiently for a single operating condition. The present invention provides a power generation system in which the characteristics of the thermoelectrics, the flow of the thermal power, and the operational characteristics of the power generator are monitored and controlled such that higher operation efficiencies and/or higher output powers can be maintained with variably thermal power input. Such a system is particularly beneficial in variable thermal power source systems, such as recovering power from the waste heat generated in the exhaust of combustion engines.

  17. Consideration of nuclear power

    International Nuclear Information System (INIS)

    Smart, I.

    1982-01-01

    Mr. Smart notes that the optimistic promise of nuclear energy for developing countries has not been met, but feels that nuclear power can still provide a growing share of energy during the transition from oil dependence. He observes that cost-benefit analyses vary for each country, but good planning and management can give nuclear power a positive future for those developing countries which can establish a need for it; have access to the economic, technological, and human resources necessary to develop and operate it; and can make nuclear power compatible with the social, economic, and cultural structure. 11 references

  18. Corrosion in power industry

    International Nuclear Information System (INIS)

    Ventakeshwarlu, K.S.

    1979-01-01

    A brief account of the problem areas encountered as a result of corrosion in the electrical power industry including nuclear power industry is given and some of the measures contemplated and/or implemented to control corrosion are outlined. The corrosion problems in the steam generators and cladding tubes of the nuclear power plant have an added dimension of radioactivation which leads to contamination and radiation field. Importance of monitoring water quality and controlling water chemistry by addition of chemicals is emphasised. (M.G.B.)

  19. Powering Ideas through Expertise

    DEFF Research Database (Denmark)

    Seabrooke, Leonard; Wigan, Duncan

    2016-01-01

    This contribution discusses how ideas are powered through expertise and moral authority. Professionals compete with each other to power ideas by linking claims to expertise, how things best work, to moral claims about how things should be. To show how, we draw on a case of battles over global tax...... reporting multinational corporations should provide to ensure they pay their fair share of tax. Ideas powered by expertise contain shared causal beliefs, as well as principled beliefs about value systems. We demonstrate that professionals can contest the established order when demonstrations of expertise...

  20. Nuclear power generating costs

    International Nuclear Information System (INIS)

    Srinivasan, M.R.; Kati, S.L.; Raman, R.; Nanjundeswaran, K.; Nadkarny, G.V.; Verma, R.S.; Mahadeva Rao, K.V.

    1983-01-01

    Indian experience pertaining to investment and generation costs of nuclear power stations is reviewed. The causes of investment cost increases are analysed and the increases are apportioned to escalation, design improvements and safety related adders. The paper brings out the fact that PHWR investment costs in India compare favourably with those experienced in developed countries in spite of the fact that the programme and the unit size are relatively much smaller in India. It brings out that in India at current prices a nuclear power station located over 800 km from coal reserves and operating at 75% capacity factor is competitive with thermal power at 60% capacity factor. (author)

  1. Reactor power control system

    International Nuclear Information System (INIS)

    Tomisawa, Teruaki.

    1981-01-01

    Purpose: To restore reactor-power condition in a minimum time after a termination of turbine bypass by reducing the throttling of the reactor power at the time of load-failure as low as possible. Constitution: The transient change of the internal pressure of condenser is continuously monitored. When a turbine is bypassed, a speed-control-command signal for a coolant recirculating pump is generated according as the internal pressure of the condenser. When the signal relating to the internal pressure of the condenser indicates insufficient power, a reactor-control-rod-drive signal is generated. (J.P.N.)

  2. Wind power prediction models

    Science.gov (United States)

    Levy, R.; Mcginness, H.

    1976-01-01

    Investigations were performed to predict the power available from the wind at the Goldstone, California, antenna site complex. The background for power prediction was derived from a statistical evaluation of available wind speed data records at this location and at nearby locations similarly situated within the Mojave desert. In addition to a model for power prediction over relatively long periods of time, an interim simulation model that produces sample wind speeds is described. The interim model furnishes uncorrelated sample speeds at hourly intervals that reproduce the statistical wind distribution at Goldstone. A stochastic simulation model to provide speed samples representative of both the statistical speed distributions and correlations is also discussed.

  3. The Kuroshio power plant

    CERN Document Server

    Chen, Falin

    2013-01-01

    By outlining a new design or the Kuroshio power plant, new approaches to turbine design, anchorage system planning, deep sea marine engineering and power plant operations and maintenance are explored and suggested. The impact on the local environment, particularly in the face of natural disasters, is also considered to provide a well rounded introduction to plan and build a 30MW pilot power plant. Following a literature review, the six chapters of this book propose a conceptual design by focusing on the plant's core technologies and establish the separate analysis logics for turbine design and

  4. Electric power substations engineering

    CERN Document Server

    McDonald, John D

    2012-01-01

    The use of electric power substations in generation, transmission, and distribution remains one of the most challenging and exciting areas of electric power engineering. Recent technological developments have had a tremendous impact on all aspects of substation design and operation. With 80% of its chapters completely revised and two brand-new chapters on energy storage and Smart Grids, Electric Power Substations Engineering, Third Edition provides an extensive updated overview of substations, serving as a reference and guide for both industry and academia. Contributors have written each chapt

  5. Worldwide nuclear power

    International Nuclear Information System (INIS)

    Royen, J.

    1981-01-01

    Worldwide nuclear power (WNP) is a companion volume to UPDATE. Our objective in the publication of WNP is to provide factual information on nuclear power programs and policies in foreign countries to U.S. policymakers in the Federal Government who are instrumental in defining the direction of nuclear power in the U.S. WNP is prepared by the Office of the Assistant Secretary for Nuclear Energy from reports obtained from foreign Embassies in Washington, U.S. Embassies overseas, foreign and domestic publications, participation in international studies, and personal communications. Domestic nuclear data is included only where its presence is needed to provide easy and immediate comparisons with foreign data

  6. Climate Wind Power Resources

    Directory of Open Access Journals (Sweden)

    Nana M. Berdzenishvili

    2013-01-01

    Full Text Available Georgia as a whole is characterized by rather rich solar energy resources, which allows to construct alternative power stations in the close proximity to traditional power plants. In this case the use of solar energy is meant. Georgia is divided into 5 zones based on the assessment of wind power resources. The selection of these zones is based on the index of average annual wind speed in the examined area, V> 3 m / s and V> 5 m / s wind speed by the summing duration in the course of the year and V = 0. . . 2 m / s of passive wind by total and continuous duration of these indices per hour.

  7. Switch mode power supply

    International Nuclear Information System (INIS)

    Kim, Hui Jun

    1993-06-01

    This book concentrates on switch mode power supply. It has four parts, which are introduction of switch mode power supply with DC-DC converter such as Buck converter boost converter, Buck-boost converter and PWM control circuit, explanation for SMPS with DC-DC converter modeling and power mode control, resonance converter like resonance switch, converter, multi resonance converter and series resonance and parallel resonance converters, basic test of SMPS with PWM control circuit, Buck converter, Boost converter, flyback converter, forward converter and IC for control circuit.

  8. Power quality load management for large spacecraft electrical power systems

    Science.gov (United States)

    Lollar, Louis F.

    1988-01-01

    In December, 1986, a Center Director's Discretionary Fund (CDDF) proposal was granted to study power system control techniques in large space electrical power systems. Presented are the accomplishments in the area of power system control by power quality load management. In addition, information concerning the distortion problems in a 20 kHz ac power system is presented.

  9. A Review of Power Electronics for Wind Power

    Institute of Scientific and Technical Information of China (English)

    Zhe CHEN

    2011-01-01

    The paper reviews the power electronic applications for wind energy systems.Main wind turbine systems with different generators and power electronic converters are described.The electrical topologies of wind farms with power electronic conversion are discussed.Power electronic applications for improving the performance of wind turbines and wind farms in power systems have been illustrated.

  10. Impacts of Wind Power on Power System Stability

    NARCIS (Netherlands)

    Vittal, E.; Keane, A.; Slootweg, J.G.; Kling, W.L.; Ackermann, T.

    2012-01-01

    This chapter examines how wind power will impact the stability of power systems. It focuses on the three aspects of power system stability: voltage stability, rotor angle stability and frequency stability. It completes a detailed analysis as to how wind power in power systems will impact the

  11. Power programmes review: Nuclear power in Italy

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1959-07-15

    Several concrete measures have been initiated in Italy for the generation of nuclear power on a substantial scale. Two plants are already under construction and work will start soon on a third. Plans have also been announced for more stations. If the work already initiated is completed on schedule the installed capacity of nuclear power in Italy is likely to exceed 500 mw (electric) in the course of the next four years. This will constitute a sizeable proportion of the total electrical capacity in the country. After the Italian National Committee for Nuclear Research (Comitato Nazionale per le Ricerche Nucleari) was reorganized late in 1956, it prepared what can be described as a nuclear five-year plan for Italy. The plan, designed to cover the period 1957-1962, includes detailed schemes for a comprehensive development of the peaceful uses of nuclear energy, including a programme for the generation of power. The Comitato Nazionale per le Ricerche Nucleari (CNRN) promotes and co-ordinates the various activities in the field, and within the framework of its general programme certain industrial groups in Italy have formulated specific projects for nuclear power. At a Geneva conference (1958) it was disclosed that several companies were planning to build nuclear power stations in Italy. (1) SELNI (Societa Elettronucleare Italiana), pertaining to the Edison-Volta group, which plans to build a pressurized water reactor. (2) So.R.I.N. (Societa Ricerche Impianti Nucleari), a company founded by the Fiat and Montecatini groups, which is constructing a research centre, with a swimming pool reactor, and various laboratories for chemistry, physics and metallurgy. This centre will also be used for the training of specialized personnel, in view of the company's programme which envisages two 150 mw (e) plants: one operating with enriched uranium, the other with natural uranium. Such a programme will become effective only when the cost of power produced by these plants may actually

  12. The Power of Small

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 12. The Power of Small: Championing the Underdogs of Modern Medicine. Suvasini Ramaswamy Anirban Mitra. General Article Volume 20 Issue 12 December 2015 pp 1136-1153 ...

  13. Philippines revises power plans

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, D.

    1988-02-01

    Following an unexpected surge in electricity demand the Philippines has revised its medium term power development programme. The sharp increase in electricity consumption follows three years of slack demand due to civil disturbances before the end of the Macros administration and the election of Corazon Aquino as President in 1986. Originally, the Aquino government's medium term power development plans called for about 500MW of generating capacity to be installed between 1986 and 1992. The three proposed plants were scheduled for commissioning in 1991 and 1992. However, a spurt in power demand growth during the past nine months has caused concern among industrialists that power shortages could occur by the end of the decade. So additional capacity will be installed to prevent an anticipated shortfall in electricity supplies by the early 1990s.

  14. Nuclear power training courses

    International Nuclear Information System (INIS)

    1977-01-01

    The training of technical manpower for nuclear power projects in developing countries is now a significant part of the IAEA Technical Assistance Programme. Two basic courses are the cornerstones of the Agency's training programme for nuclear power: a course in planning and implementation, and a course in construction and operation management. These two courses are independent of each other. They are designed to train personnel for two distinct phases of project implementation. The nuclear power project training programme has proven to be successful. A considerable number of highly qualified professionals from developing countries have been given the opportunity to learn through direct contact with experts who have had first-hand experience. It is recognized that the courses are not a substitute for on-the-job training, but their purpose is achieved if they have resulted in the transfer of practical, reliable information and have helped developing countries to prepare themselves for the planning, construction and operation management of nuclear power stations

  15. Nuclear power plants

    International Nuclear Information System (INIS)

    Margulova, T.Ch.

    1976-01-01

    The textbook focuses on the technology and the operating characteristics of nuclear power plants equiped with pressurized water or boiling water reactors, which are in operation all over the world at present. The following topics are dealt with in relation to the complete plant and to economics: distribution and consumption of electric and thermal energy, types and equipment of nuclear power plants, chemical processes and material balance, economical characteristics concerning heat and energy, regenerative preheating of feed water, degassing and condenser systems, water supply, evaporators, district heating systems, steam generating systems and turbines, coolant loops and pipes, plant siting, ventilation and decontamination systems, reactor operation and management, heat transfer including its calculation, design of reactor buildings, and nuclear power plants with gas or sodium cooled reactors. Numerous technical data of modern Soviet nuclear power plants are included. The book is of interest to graduate and post-graduate students in the field of nuclear engineering as well as to nuclear engineers

  16. Power to the people

    International Nuclear Information System (INIS)

    Fife, Sandy.

    1991-01-01

    Canada's new energy pioneers have many ways to generate power-from glacial creeks to urban trash. The problem is, they only have one way to generate profits: Get miserly provincial hydro companies to pay what their output is worth

  17. Electric power annual, 1990

    International Nuclear Information System (INIS)

    1992-01-01

    The Electric Power Annual presents a summary of electric utility statistics at the national, regional and State levels. The objective of the publication is to provide industry decisionmakers, government policy-makers, analysts and the general public with historical data that may be used in understanding US electricity markets. ''The Industry at a Glance'' section presents a profile of the electric power industry ownership and performance; a review of key statistics for the year; and projections for various aspects of the electric power industry through 2010. Subsequent sections present data on generating capability, including proposed capability additions; net generation; fossil-fuel statistics; electricity sales, revenue, and average revenue per kilowatthour sold; financial statistics; environmental statistics; and electric power transactions. In addition, appendices provide supplemental data on major disturbances and unusual occurrences. Each section contains related text and tables and refers the reader to the appropriate publication that contains more detailed data on the subject matter

  18. Wireless transmission of power

    International Nuclear Information System (INIS)

    Grotz, T.

    1991-01-01

    This paper reports that it has been proven by researchers that electrical energy can be propagated around the world between the surface of the Earth and the ionosphere at extremely low frequencies in what is known as the Schumann Cavity. Experiments to data have shown that electromagnetic waves with frequencies in the range of 8 Hz, the fundamental Schumann Resonance frequency, propagate with litter attenuation around the planet within the Schumann Cavity. It is the intent of this research to determine if the Schumann Cavity can be resonated, if the power that is delivered to the cavity propagated with very low losses, and if power can be extracted at other locations within the cavity. Experimental data collected and calculations made in recent years support the hypothesis that wireless power transmission is a viable and practical alternative to the present systems of power transmission

  19. Power Aware Distributed Systems

    National Research Council Canada - National Science Library

    Schott, Brian

    2004-01-01

    The goal of PADS was to study power aware management techniques for wireless unattended ground sensor applications to extend their operational lifetime and overall capabilities in this battery-constrained environment...

  20. Nuclear power system

    International Nuclear Information System (INIS)

    Yampolsky, J.S.; Cavallaro, L.; Paulovich, K.F.; Schleicher, R.W.

    1989-01-01

    This patent describes an inherently safe modular nuclear power system for producing electrical power at acceptable efficiency levels using working fluids at relatively low temperatures and pressures. The system comprising: a reactor module for heating a first fluid; a heat exchanger module for transferring heat from the first fluid to a second fluid; a first piping system effecting flow of the first fluid in a first fluid circuit successively through the reactor module and the heat exchanger module; a power conversion module comprising a turbogenerator driven by the second fluid, and means for cooling the second fluid upon emergence thereof from the turbogenerator; a second piping system comprising means for effecting flow of the second fluid in a second fluid circuit successively through the heat exchanger module and the power conversion module; and a plurality of pits for receiving the modules

  1. Solar Power Use Claims

    Science.gov (United States)

    The U.S. EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. EPA evaluates partnership metrics annually to determine progress toward programmatic goals.

  2. Bee Power 21

    National Research Council Canada - National Science Library

    Lamberson, Jeffrey

    2003-01-01

    .... Naval Facilities Engineering Command (NAVFAC) has much to offer the current Naval strategy, and in keeping with its tradition of contribution and service to the fleet, will want to align its strategic plan with the Sea Power 21 vision...

  3. Wind power in France

    International Nuclear Information System (INIS)

    Tuille, F.; Courtel, J.

    2015-01-01

    After 3 years of steady decreasing, wind power has resumed growth in 2014 in France and the preliminary figures of 2015 confirm this trend. About 1100 MW were installed in 2014 which was almost twice as much as it was installed the year before. This renaissance is mostly due to the implementation of Brottes' law that eases the installations of wind farms by suppressing the wind power development areas (that were interfering with regional wind power schemes) and by suppressing the minimum number of 5 turbines for any new wind farms. Another important incentive measure was the announcement in January 2015 of a new financial support scheme in replacement of the policy of guaranteed purchase price for the electricity produced. In 2014 the total wind power produced in mainland France reached 17 TW which represented 3.1% of the production of electricity. (A.C.)

  4. Power deregulation in Alberta

    International Nuclear Information System (INIS)

    MacMurchy, N.E.

    1999-01-01

    The impacts of deregulation of the electric power industry in Alberta from the perspective of the natural gas industry was presented with special focus on how the power market can be brought back into balance. The issue of what impacts the deregulated power market will have on natural gas consumption or prices was also reviewed. It was noted that deregulation of the electric power industry will have a definite impact on natural gas consumption but no significant impact on prices. It is estimated that in 1999/2000 gas demand will be 90 million cf/day for incremental electricity generation. However, as long as pipe capacity out of the province exits, this increase in natural gas demand in Alberta is not expected to affect gas prices

  5. Structural power flow measurement

    Energy Technology Data Exchange (ETDEWEB)

    Falter, K.J.; Keltie, R.F.

    1988-12-01

    Previous investigations of structural power flow through beam-like structures resulted in some unexplained anomalies in the calculated data. In order to develop structural power flow measurement as a viable technique for machine tool design, the causes of these anomalies needed to be found. Once found, techniques for eliminating the errors could be developed. Error sources were found in the experimental apparatus itself as well as in the instrumentation. Although flexural waves are the carriers of power in the experimental apparatus, at some frequencies longitudinal waves were excited which were picked up by the accelerometers and altered power measurements. Errors were found in the phase and gain response of the sensors and amplifiers used for measurement. A transfer function correction technique was employed to compensate for these instrumentation errors.

  6. The power tool

    International Nuclear Information System (INIS)

    HAYFIELD, J.P.

    1999-01-01

    POWER Tool--Planning, Optimization, Waste Estimating and Resourcing tool, a hand-held field estimating unit and relational database software tool for optimizing disassembly and final waste form of contaminated systems and equipment

  7. Nuclear power plant construction

    International Nuclear Information System (INIS)

    Lima Moreira, Y.M. de.

    1979-01-01

    The legal aspects of nuclear power plant construction in Brazil, derived from governamental political guidelines, are presented. Their evolution, as a consequence of tecnology development is related. (A.L.S.L.) [pt

  8. Economical Radioisotope Power

    Data.gov (United States)

    National Aeronautics and Space Administration — Almost all robotic space exploration missions and all Apollo missions to the moon used Radioisotopic Thermoelectric Generators (RTGs) to provide electrical power to...

  9. Danish Wind Power

    DEFF Research Database (Denmark)

    Lund, Henrik; Hvelplund, Frede; Østergaard, Poul Alberg

    In a normal wind year, Danish wind turbines generate the equivalent of approx. 20 percent of the Danish electricity demand. This paper argues that only approx. 1 percent of the wind power production is exported. The rest is used to meet domestic Danish electricity demands. The cost of wind power...... misleading. The cost of CO2 reduction by use of wind power in the period 2004-2008 was only 20 EUR/ton. Furthermore, the Danish wind turbines are not paid for by energy taxes. Danish wind turbines are given a subsidy via the electricity price which is paid by the electricity consumers. In the recent years...... is paid solely by the electricity consumers and the net influence on consumer prices was as low as 1-3 percent on average in the period 2004-2008. In 2008, the net influence even decreased the average consumer price, although only slightly. In Denmark, 20 percent wind power is integrated by using both...

  10. Nuclear power plant siting

    International Nuclear Information System (INIS)

    Sulkiewicz, M.; Navratil, J.

    The construction of a nuclear power plant is conditioned on territorial requirements and is accompanied by the disturbance of the environment, land occupation, population migration, the emission of radioactive wastes, thermal pollution, etc. On the other hand, a nuclear power plant makes possible the introduction of district heating and increases the economic and civilization activity of the population. Due to the construction of a nuclear power plant the set limits of negative impacts must not be exceeded. The locality should be selected such as to reduce the unfavourable effects of the plant and to fully use its benefits. The decision on the siting of the nuclear power plant is preceded by the processing of a number of surveys and a wide range of documentation to which the given criteria are strictly applied. (B.H.)

  11. Space Power Facility (SPF)

    Data.gov (United States)

    Federal Laboratory Consortium — The Space Power Facility (SPF) houses the world's largest space environment simulation chamber, measuring 100 ft. in diameter by 122 ft. high. In this chamber, large...

  12. Nuclear power plant decommissioning

    International Nuclear Information System (INIS)

    Yaziz Yunus

    1986-01-01

    A number of issues have to be taken into account before the introduction of any nuclear power plant in any country. These issues include reactor safety (site and operational), waste disposal and, lastly, the decommissioning of the reactor inself. Because of the radioactive nature of the components, nuclear power plants require a different approach to decommission compared to other plants. Until recently, issues on reactor safety and waste disposal were the main topics discussed. As for reactor decommissioning, the debates have been academic until now. Although reactors have operated for 25 years, decommissioning of retired reactors has simply not been fully planned. But the Shippingport Atomic Power Plant in Pennysylvania, the first large scale power reactor to be retired, is now being decommissioned. The work has rekindled the debate in the light of reality. Outside the United States, decommissioning is also being confronted on a new plane. (author)

  13. Focusing America's National Powers

    National Research Council Canada - National Science Library

    Kabana, Dana P

    2006-01-01

    .... The National Security Counsel (NSC) should modify its efforts to take full advantage of all sources of power to ensure national security by first establishing the NSC/Deputies Committee as the element mandated to manage the interagency process...

  14. Advanced stellarator power plants

    International Nuclear Information System (INIS)

    Miller, R.L.

    1994-01-01

    The stellarator is a class of helical/toroidal magnetic fusion devices. Recent international progress in stellarator power plant conceptual design is reviewed and comparisons in the areas of physics, engineering, and economics are made with recent tokamak design studies

  15. Nuclear power statistics 1985

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1986-06-01

    In this report an attempt is made to collect literature data on nuclear power production and to present it on graphical form. Data is given not only for 1985, but for a number of years so that the trends in the development of nuclear power can be seen. The global capacity of nuclear power plants in operation and those in operation, under construction, or on order is considered. Further the average capacity factor for nuclear plants of a specific type and for various geographical areas is given. The contribution of nuclear power to the total electricity production is considered for a number of countries and areas. Finally, the accumulated years of commercial operation for the various reactor types up to the end of 1985 is presented. (author)

  16. Middle Eastern power systems

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    Middle Eastern Power systems have evolved independently of each other over many decades. The region covers a wide geographical area of over 4 million square kilometers with an estimated population in 1990 of over 120 million people. This paper discusses the present status and future power system developments in the Middle East with emphasis on the Mashrequ Arab Countries (MAC). MAC consists of Egypt, Iraq, Jordan, Lebanon, Syria, Yemen, and the six Gulf Cooperation Council (GCC) countries, namely, Bahrain, Kuwait, Qatar, Saudi Arabia, Oman, and the United Arab Emirates (UAE). Interconnections within MAC and possible extensions to Turkey, Europe, and Central Africa are discussed. A common characteristic of the MAC power systems is that they are all operated by government or semi-government bodies. The energy resources in the region are varied. Countries such as Iraq, Egypt, and Syria have significant hydro power resources. On the other hand, the GCC countries and Iraq have abundant fossil fuel reserves

  17. Water Powered Bioassay System

    National Research Council Canada - National Science Library

    Lin, Liwei

    2004-01-01

    ... of 0.2 1/hr without requiring electrical power. A low-leakage, hole-in-the-wall micro valve was demonstrated that provided fluidic resistance 255 times higher in the closed state than in the open state...

  18. Wind Power in Georgia

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-11-01

    Georgia has good wind power potential. Preliminary analyses show that the technical wind power potential in Georgia is good. Meteorological data shows that Georgia has four main areas in Georgia with annual average wind speeds of over 6 m/s and two main areas with 5-6 m/s at 80m. The most promising areas are the high mountain zone of the Great Caucasus, The Kura river valley, The South-Georgian highland and the Southern part of the Georgian Black Sea coast. Czech company Wind Energy Invest has recently signed a Memorandum of Understanding with Georgian authorities for development of the first wind farm in Georgia, a 50MW wind park in Paravani, Southern Georgia, to be completed in 2014. Annual generation is estimated to 170.00 GWh and the investment estimated to 101 million US$. Wind power is suited to balance hydropower in the Georgian electricity sector Electricity generation in Georgia is dominated by hydro power, constituting 88% of total generation in 2009. Limited storage capacity and significant spring and summer peaks in river flows result in an uneven annual generation profile and winter time shortages that are covered by three gas power plants. Wind power is a carbon-free energy source well suited to balance hydropower, as it is available (often strongest) in the winter and can be exported when there is a surplus. Another advantage with wind power is the lead time for the projects; the time from site selection to operation for a wind power park (approximately 2.5 years) is much shorter than for hydro power (often 6-8 years). There is no support system or scheme for renewable sources in Georgia, so wind power has to compete directly with other energy sources and is in most cases more expensive to build than hydro power. In a country and region with rapidly increasing energy demands, the factors described above nevertheless indicate that there is a commercial niche and a role to play for Georgian wind power. Skra: An example of a wind power development

  19. Prognostics of Power MOSFET

    Data.gov (United States)

    National Aeronautics and Space Administration — This paper demonstrates how to apply prognostics to power MOSFETs (metal oxide field effect transistor). The methodology uses thermal cycling to age devices and...

  20. Electric Power Transmission Lines

    Data.gov (United States)

    Department of Homeland Security — Transmission Lines are the system of structures, wires, insulators and associated hardware that carry electric energy from one point to another in an electric power...

  1. Power conversion technologies

    Energy Technology Data Exchange (ETDEWEB)

    Newton, M. A.

    1997-02-01

    The Power Conversion Technologies thrust area identifies and sponsors development activities that enhance the capabilities of engineering at Lawrence Livermore National Laboratory (LLNL) in the area of solid- state power electronics. Our primary objective is to be a resource to existing and emerging LLNL programs that require advanced solid-state power electronic technologies.. Our focus is on developing and integrating technologies that will significantly impact the capability, size, cost, and reliability of future power electronic systems. During FY-96, we concentrated our research efforts on the areas of (1) Micropower Impulse Radar (MIR); (2) novel solid-state opening switches; (3) advanced modulator technology for accelerators; (4) compact accelerators; and (5) compact pulse generators.

  2. Wind power forecast

    Energy Technology Data Exchange (ETDEWEB)

    Pestana, Rui [Rede Electrica Nacional (REN), S.A., Lisboa (Portugal). Dept. Systems and Development System Operator; Trancoso, Ana Rosa; Delgado Domingos, Jose [Univ. Tecnica de Lisboa (Portugal). Seccao de Ambiente e Energia

    2012-07-01

    Accurate wind power forecast are needed to reduce integration costs in the electric grid caused by wind inherent variability. Currently, Portugal has a significant wind power penetration level and consequently the need to have reliable wind power forecasts at different temporal scales, including localized events such as ramps. This paper provides an overview of the methodologies used by REN to forecast wind power at national level, based on statistical and probabilistic combinations of NWP and measured data with the aim of improving accuracy of pure NWP. Results show that significant improvement can be achieved with statistical combination with persistence in the short-term and with probabilistic combination in the medium-term. NWP are also able to detect ramp events with 3 day notice to the operational planning. (orig.)

  3. Electronic Power Transformer for Power Distribution Networks

    Directory of Open Access Journals (Sweden)

    Ermuraсhi Iu.V.

    2017-12-01

    Full Text Available Reducing losses in electricity distribution networks is a current technical problem. This issue also has social and environmental aspects. As a promising solution one can examine the direct distribution from the medium voltage power network using new equipment based on the use of power electronics. The aim of the paper is to propose and argue an innovative technical solution for the realization of the Solid State Transformer (SST in order to decrease the number of energy transformation stages compared to the known solutions, simplifying the topology of the functional scheme with the reduction of production costs and the loss of energy in transformers used in electrical distribution networks. It is proposed the solution of simplifying the topology of the AC/AC electronic transformer by reducing the number of passive electronic components (resistors, inductors, capacitors and active (transistors. The inverter of the SST transformer ensures the switching mode of the transistors, using for this purpose the inductance of the magnetic leakage flux of the high frequency transformer. The robustness of the laboratory sample of the SST 10 / 0.22 kV transformer with the power of 20 kW was manufactured and tested. Testing of the laboratory sample confirmed the functionality of the proposed scheme and the possibility of switching of the transistors to at zero current (ZCS mode with the reduction of the energy losses. In the proposed converter a single high-frequency transformer with a simplified construction with two windings is used, which reduces its mass and the cost of making the transformer. The reduction in the manufacturing cost of the converter is also due to the decrease in the number of links between the functional elements.

  4. Power conditioning devices in nuclear power plants

    International Nuclear Information System (INIS)

    Shida, Toichi.

    1979-01-01

    Purpose: To automatically prevent the liquid level from lowering in a reactor even if a feedwater adjusting valve is locked in a bwr type nuclear power plant. Constitution: Where a feedwater adjusting valve should be locked, and if the mismatching degree between the main steam flow rate and the feedwater flow rate exceeds a predetermined value and the mismatched state continues for a certain period, the value set to a main control for setting the recycling flow rate is changed corresponding to the mismatching degree to compensate the same thereby preventing the liquid level from lowering in the reactor. (Ikeda, J.)

  5. Laser power supply

    International Nuclear Information System (INIS)

    Whitehouse, D.R.; Hartshorn, D.W.

    1975-01-01

    A method of energizing a laser source stimulating flash lamp directly from an ac power line is presented. Uncontrolled diodes couple the anode and cathode of the flash lamp directly to the ac line. The lamp is triggered by a separate triggering circuit which produces its trigger pulse at a predetermined phase of the ac power source. The use of high current carrying controlled rectifiers and large energy storage devices is thereby eliminated. (U.S.)

  6. International power plant business

    Energy Technology Data Exchange (ETDEWEB)

    Grohe, R.

    1986-03-03

    At the Brown Boveri press seminar 'Energy' in Baden-Baden Rainer Grohe, member of the Brown Boveri board, Mannheim, gave a survey of the activities on the international power plant market in recent years. He showed the vacuities which must be taken into account in this sector today. The drastic escalation of demands on power plant suppliers has lead not to a reduction of protagonists but to an increase. (orig.).

  7. Nuclear power development

    International Nuclear Information System (INIS)

    Povolny, M.

    1980-01-01

    The development and uses of nuclear power in Czechoslovakia and other countries are briefly outlined. In the first stage, the Czechoslovak nuclear programme was oriented to the WWER 440 type reactor while the second stage of the nuclear power plant construction is oriented to the WWER 10O0 type reactor. It is envisaged that 12 WWER 440 type reactors and four to five WWER 1000 type reactors will be commissioned till 1990. (J.P.)

  8. The nuclear power station

    International Nuclear Information System (INIS)

    Plettner, B.

    1987-04-01

    The processes taking place in a nuclear power plant and the dangers arising from a nuclear power station are described. The means and methods of controlling, monitoring, and protecting the plant and things that can go wrong are presented. There is also a short discourse on the research carried out in the USA and Germany, aimed at assessing the risks of utilising nuclear energy by means of the incident tree analysis and probability calculations. (DG) [de

  9. Dictionary of nuclear power

    International Nuclear Information System (INIS)

    Koelzer, W.

    2012-06-01

    The actualized version (June 2012) of the dictionary on nuclear power includes all actualizations and new inputs since the last version of 2001. The original publication dates from 1980. The dictionary includes definitions, terms, measuring units and helpful information on the actual knowledge concerning nuclear power, nuclear fuel cycle, nuclear facilities, radioactive waste management, nuclear physics, reactor physics, isotope production, biological radiation effects, and radiation protection.

  10. Power industry and environment

    International Nuclear Information System (INIS)

    Hrynkiewicz, A.

    2000-01-01

    Structure of power industry from the view point of fuel used in Poland have been presented. Environmental impact connecting with emission of CO 2 , SO 2 , NO x and fly ash have been assessed. The comparison of environmental hazards with that being result of nuclear power plants have been also done. On the base of presenting data, building of nuclear energetics in Poland as soon as possible seem to be necessary

  11. Power Curve Measurements FGW

    DEFF Research Database (Denmark)

    Georgieva Yankova, Ginka; Federici, Paolo

    This report describes power curve measurements carried out on a given turbine in a chosen period. The measurements are carried out in accordance to IEC 61400-12-1 Ed. 1 and FGW Teil 2.......This report describes power curve measurements carried out on a given turbine in a chosen period. The measurements are carried out in accordance to IEC 61400-12-1 Ed. 1 and FGW Teil 2....

  12. Tobruk power station

    Energy Technology Data Exchange (ETDEWEB)

    Boergardts, B

    1978-01-01

    In February of 1975, the Electricity Corporation Benghazi (ECB) awarded a contract for the construction of a turnkey power station and seawater desalination plant in Tobruk, Libya to a consortium under the leadership of BBC Mannheim. This power station has an output of 129 MW and supplies about 24,000 m/sup 3/ of drinking water daily. It went into operation in 1977, two and a half years after the contract was awarded.

  13. LDC nuclear power: Argentina

    International Nuclear Information System (INIS)

    Tweedale, D.L.

    1982-01-01

    Argentina's 31-year-old nuclear research and power program makes it a Third World leader and the preeminent Latin American country. Easily accessible uranium fuels the heavy water reactor, Atucha I, which provides 10% of the country's electric power. Atucha II and III are under construction. Several domestic and international factors combined to make Argentina's program succeed, but achieving fuel-cycle independence and the capacity to divert fissionable material to military uses is a cause for some concern. 60 references

  14. Power policy review - Gujarat

    International Nuclear Information System (INIS)

    2006-01-01

    Power is the engine of growth of any developing economy. Consumption of electrical energy is an universally accepted indicator of progress in the agricultural, industrial and commercial sectors, as also of the well being of the people of the State. No major economic activity can be sustained without adequate and reliable supply of power. It plays a critical role in employment generation, regional development and poverty eradication

  15. Wind electric power generation

    International Nuclear Information System (INIS)

    Koch, M.K.; Wind, L.; Canter, B.; Moeller, T.

    2001-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of the private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 1999 and 2000. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. (CLS)

  16. Wind electric power generation

    International Nuclear Information System (INIS)

    Koch, M. K.; Wind, L.; Canter, B.; Moeller, T.

    2002-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of the private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 2000 and 2001. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. (SM)

  17. Nuclear power in Spain

    International Nuclear Information System (INIS)

    1979-01-01

    the plans of the Spanish Government to reduce their dependence on oil over the next ten years by a considerable increase in nuclear generating capacity are outlined. Data on the type, generating power, location and commissioning data of a number of nuclear power stations in Spain are tabulated. The use of foreign companies for the design and construction of the nuclear stations and the national organisations responsible for different aspects of the programme are considered. (UK)

  18. NSTX Electrical Power Systems

    International Nuclear Information System (INIS)

    A. Ilic; E. Baker; R. Hatcher; S. Ramakrishnan; et al

    1999-01-01

    The National Spherical Torus Experiment (NSTX) has been designed and installed in the existing facilities at Princeton Plasma Physic Laboratory (PPPL). Most of the hardware, plant facilities, auxiliary sub-systems, and power systems originally used for the Tokamak Fusion Test Reactor (TFTR) have been used with suitable modifications to reflect NSTX needs. The design of the NSTX electrical power system was tailored to suit the available infrastructure and electrical equipment on site. Components were analyzed to verify their suitability for use in NSTX. The total number of circuits and the location of the NSTX device drove the major changes in the Power system hardware. The NSTX has eleven (11) circuits to be fed as compared to the basic three power loops for TFTR. This required changes in cabling to insure that each cable tray system has the positive and negative leg of cables in the same tray. Also additional power cabling had to be installed to the new location. The hardware had to b e modified to address the need for eleven power loops. Power converters had to be reconnected and controlled in anti-parallel mode for the Ohmic heating and two of the Poloidal Field circuits. The circuit for the Coaxial Helicity Injection (CHI) System had to be carefully developed to meet this special application. Additional Protection devices were designed and installed for the magnet coils and the CHI. The thrust was to making the changes in the most cost-effective manner without compromising technical requirements. This paper describes the changes and addition to the Electrical Power System components for the NSTX magnet systems

  19. Superconductivity in power engineering

    International Nuclear Information System (INIS)

    Chaddah, P.; Dande, Y.D.; Dasannacharya, B.A.; Malik, M.K.; Raghavan, R.V.

    1987-01-01

    The advantages of low power loss, high magnetic fields and compactness of size of superconducting magnets have generated world-wide interest in using them for MHD generators, Tokamak fusion reactors, energy storage systems etc. With a view to assess the feasibility of using the technology in power engineering in India, the status of the efforts in the country is reviewed and the areas of R and D required are indicated. 13 figures, 15 refs. (author)

  20. Nuclear power in space

    International Nuclear Information System (INIS)

    Aftergood, S.; Hafemeister, D.W.; Prilutsky, O.F.; Rodionov, S.N.; Primack, J.R.

    1991-01-01

    Nuclear reactors have provided energy for satellites-with nearly disastrous results. Now the US government is proposing to build nuclear-powered boosters to launch Star Wars defenses. These authors represent scientific groups that are opposed to the use of nuclear power in near space. The authors feel that the best course for space-borne reactors is to ban them from Earth orbit and use them in deep space

  1. Hydroelectric power and privatisation

    International Nuclear Information System (INIS)

    Frankovic, B.

    2000-01-01

    The paper considers privatisation aspects of both the existing hydroelectric power plants presently owned by the Croatian state and those to be built in the future. The paper highlights the water power utilisation as just one of the possible purposes of water and land resources development, which are the most important segment of the physical development of the Croatian territory, and the fact that water and land are public wealth. (author)

  2. Enabling Wind Power Nationwide

    Energy Technology Data Exchange (ETDEWEB)

    Jose Zayas, Michael Derby, Patrick Gilman and Shreyas Ananthan,

    2015-05-01

    Leveraging this experience, the U.S. Department of Energy’s (DOE’s) Wind and Water Power Technologies Office has evaluated the potential for wind power to generate electricity in all 50 states. This report analyzes and quantifies the geographic expansion that could be enabled by accessing higher above ground heights for wind turbines and considers the means by which this new potential could be responsibly developed.

  3. Nuclear power and acceptation

    International Nuclear Information System (INIS)

    Speelman, J.E.

    1990-01-01

    In 1989 a workshop was held organized by the IAEA and the Argonne National Laboratory. The purpose was to investigate under which circumstances a large-scale extension of nuclear power can be accepted. Besides the important technical information, the care for the environment determined the atmosphere during the workshop. The opinion dominated that nuclear power can contribute in tackling the environment problems, but that the social and political climate this almost makes impossible. (author). 7 refs.; 1 fig.; 1 tab

  4. Village power in Thailand

    Energy Technology Data Exchange (ETDEWEB)

    Bergey, M.

    1997-12-01

    This paper presents an overview of the electric power system in Thailand. 99% of the country is electrified, but much of this is with diesel generators which leaves high costs but a high level of service. The paper discusses renewable energy projects which have been sited in the country, and examples of hybrid systems which have been retrofit into existing diesel generator systems. Photovoltaic and hydroelectric power projects are described. Dedicated systems have been installed for water pumping and battery charging applications.

  5. Stabilized power constant alimentation

    International Nuclear Information System (INIS)

    Roussel, L.

    1968-06-01

    The study and realization of a stabilized power alimentation variable from 5 to 100 watts are described. In order to realize a constant power drift of Lithium compensated diodes, we have searched a 1 per cent precision of regulation and a response time minus than 1 sec. Recent components like Hall multiplicator and integrated amplifiers give this possibility and it is easy to use permutable circuits. (author) [fr

  6. Nuclear power: Pt. 6

    International Nuclear Information System (INIS)

    Janse van Rensburg, H.J.

    1985-01-01

    Based on the annual growthrate of 2,5% in the need for energy and the present coal, oil, gas and uranium reserves, it is expected that there will be an energy deficiency early in the twentieth century. Coal-fired power stations have the disadvantage of pollution and a high water consumption. The use of nuclear power in South Africa is backed-up by its uranium reserves

  7. Power transformers quality assurance

    CERN Document Server

    Dasgupta, Indrajit

    2009-01-01

    About the Book: With the view to attain higher reliability in power system operation, the quality assurance in the field of distribution and power transformers has claimed growing attention. Besides new developments in the material technology and manufacturing processes of transformers, regular diagnostic testing and maintenance of any engineering product may be ascertained by ensuring: right selection of materials and components and their quality checks. application of correct manufacturing processes any systems engineering. the user`s awareness towards preventive maintenance. The

  8. Thermal power measurement apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Thermal power measurements are important in nuclear power plants, fossil-fuel plants and other closed loop systems such as heat exchangers and chemical reactors. The main object of this invention is to determine the enthalpy of a fluid using only acoustically determined sound speed and correlating the speed with enthalpy. An enthalpy change is measured between two points in the fluid flow: the apparatus is described in detail. (U.K.)

  9. Nuclear power experience

    International Nuclear Information System (INIS)

    Daglish, J.

    1982-01-01

    A report is given of a recent international conference convened by the IAEA to consider the technical and economic experience acquired by the nuclear industry during the past 30 years. Quotations are given from a number of contributors. Most authors shared the opinion that nuclear power should play a major role in meeting future energy needs and it was considered that the conference had contributed to make nuclear power more viable. (U.K.)

  10. Reactive power compensator

    Science.gov (United States)

    El-Sharkawi, Mohamed A.; Venkata, Subrahmanyam S.; Chen, Mingliang; Andexler, George; Huang, Tony

    1992-01-01

    A system and method for determining and providing reactive power compensation for an inductive load. A reactive power compensator (50,50') monitors the voltage and current flowing through each of three distribution lines (52a, 52b, 52c), which are supplying three-phase power to one or more inductive loads. Using signals indicative of the current on each of these lines when the voltage waveform on the line crosses zero, the reactive power compensator determines a reactive power compensator capacitance that must be connected to the lines to maintain a desired VAR level, power factor, or line voltage. Alternatively, an operator can manually select a specific capacitance for connection to each line, or the capacitance can be selected based on a time schedule. The reactive power compensator produces control signals, which are coupled through optical fibers (102/106) to a switch driver (110, 110') to select specific compensation capacitors (112) for connections to each line. The switch driver develops triggering signals that are supplied to a plurality of series-connected solid state switches (350), which control charge current in one direction in respect to ground for each compensation capacitor. During each cycle, current flows from ground to charge the capacitors as the voltage on the line begins to go negative from its positive peak value. The triggering signals are applied to gate the solid state switches into a conducting state when the potential on the lines and on the capacitors reaches a negative peak value, thereby minimizing both the potential difference and across the charge current through the switches when they begin to conduct. Any harmonic distortion on the potential and current carried by the lines is filtered out from the current and potential signals used by the reactive power compensator so that it does not affect the determination of the required reactive compensation.

  11. Reactive power compensator

    Energy Technology Data Exchange (ETDEWEB)

    El-Sharkawi, Mohamed A. (Renton, WA); Venkata, Subrahmanyam S. (Woodinville, WA); Chen, Mingliang (Kirkland, WA); Andexler, George (Everett, WA); Huang, Tony (Seattle, WA)

    1992-01-01

    A system and method for determining and providing reactive power compensation for an inductive load. A reactive power compensator (50,50') monitors the voltage and current flowing through each of three distribution lines (52a, 52b, 52c), which are supplying three-phase power to one or more inductive loads. Using signals indicative of the current on each of these lines when the voltage waveform on the line crosses zero, the reactive power compensator determines a reactive power compensator capacitance that must be connected to the lines to maintain a desired VAR level, power factor, or line voltage. Alternatively, an operator can manually select a specific capacitance for connection to each line, or the capacitance can be selected based on a time schedule. The reactive power compensator produces control signals, which are coupled through optical fibers (102/106) to a switch driver (110, 110') to select specific compensation capacitors (112) for connections to each line. The switch driver develops triggering signals that are supplied to a plurality of series-connected solid state switches (350), which control charge current in one direction in respect to ground for each compensation capacitor. During each cycle, current flows from ground to charge the capacitors as the voltage on the line begins to go negative from its positive peak value. The triggering signals are applied to gate the solid state switches into a conducting state when the potential on the lines and on the capacitors reaches a negative peak value, thereby minimizing both the potential difference and across the charge current through the switches when they begin to conduct. Any harmonic distortion on the potential and current carried by the lines is filtered out from the current and potential signals used by the reactive power compensator so that it does not affect the determination of the required reactive compensation.

  12. 76 FR 20624 - Oglethorpe Power Corporation: Proposed Biomass Power Plant

    Science.gov (United States)

    2011-04-13

    ... DEPARTMENT OF AGRICULTURE Rural Utilities Service Oglethorpe Power Corporation: Proposed Biomass Power Plant AGENCY: Rural Utilities Service, USDA. ACTION: Notice of Availability of a Draft... financial assistance to Oglethorpe Power Corporation (Oglethorpe) for the construction of a 100 megawatt (MW...

  13. Economic Operation of Power Systems with Significant Wind Power Penetration

    DEFF Research Database (Denmark)

    Farashbashi-Astaneh, Seyed-Mostafa

    This dissertation addresses economic operation of power systems with high penetration of wind power. Several studies are presented to address the economic operation of power systems with high penetration of variable wind power. The main concern in such power systems is high variability...... and unpredictability. Unlike conventional power plants, the output power of a wind farm is not controllable. This brings additional complexity to operation and planning of wind dominant power systems. The key solution in face of wind power uncertainty is to enhance power system flexibility. The enhanced flexibility......, cooperative wind-storage operation is studied. Lithium-Ion battery units are chosen as storage units. A novel formulation is proposed to investigate optimal operation of a storage unit considering power system balancing conditions and wind power imbalances. An optimization framework is presented to increase...

  14. SSP Power Management and Distribution

    Science.gov (United States)

    Lynch, Thomas H.; Roth, A. (Technical Monitor)

    2000-01-01

    Space Solar Power is a NASA program sponsored by Marshall Space Flight Center. The Paper presented here represents the architectural study of a large power management and distribution (PMAD) system. The PMAD supplies power to a microwave array for power beaming to an earth rectenna (Rectifier Antenna). The power is in the GW level.

  15. Nuclear power costs

    International Nuclear Information System (INIS)

    1963-01-01

    A report prepared by the IAEA Secretariat and presented to the seventh session of the Agency's General Conference says that information on nuclear power costs is now rapidly moving from the domain of uncertain estimates to that of tested factual data. As more and more nuclear power stations are being built and put into operation, more information on the actual costs incurred is becoming available. This is the fourth report on nuclear power costs to be submitted to the IAEA General Conference. The report last year gave cost information on 38 nuclear power projects, 17 of which have already gone into operation. Certain significant changes in the data given last year are included-in the present report; besides, information is given on seven new plants. The report is divided into two parts, the first on recent developments and current trends in nuclear power costs and the second on the use of the cost data for economic comparisons. Both stress the fact that the margin of uncertainty in the basic data has lately been drastically reduced. At the same time, it is pointed out, some degree of uncertainty is inherent in the assumptions made in arriving at over-all generating cost figures, especially when - as is usually the case - a nuclear plant is part of an integrated power system

  16. Electric power annual, 1991

    International Nuclear Information System (INIS)

    1993-01-01

    The Electric Power Annual is prepared by the Survey Management Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. The 1991 edition has been enhanced to include statistics on electric utility demand-side management and nonutility supply. ''The US Electric Power Industry at a Glance'' section presents a profile of the electric power industry ownership and performance, and a review of key statistics for the year. Subsequent sections present data on generating capability, including proposed capability additions; net generation; fossil-fuel statistics; electricity sales, revenue, and average revenue per kilowatthour sold; financial statistics; environmental statistics; electric power transactions; demand-side management; and nonutility power producers. In addition, the appendices provide supplemental data on major disturbances and unusual occurrences in US electricity power systems. Each section contains related text and tables and refers the reader to the appropriate publication that contains more detailed data on the subject matter. Monetary values in this publication are expressed in nominal terms

  17. Steps to nuclear power

    International Nuclear Information System (INIS)

    1975-01-01

    The recent increase in oil prices will undoubtedly cause the pace at which nuclear power is introduced in developing countries to quicken in the next decade, with many new countries beginning to plan nuclear power programmes. The guidebook is intended for senior government officials, policy makers, economic and power planners, educationalists and economists. It assumes that the reader has relatively little knowledge of nuclear power systems or of nuclear physics but does have a general technical or management background. Nuclear power is described functionally from the point of view of an alternative energy source in power system expansion. The guidebook is based on an idealized approach. Variations on it are naturally possible and will doubtless be necessary in view of the different organizational structures that already exist in different countries. In particular, some countries may prefer an approach with a stronger involvement of their Atomic Energy Commission or Authority, for which this guidebook has foreseen mainly a regulatory and licensing role. It is intended to update this booklet as more experience becomes available. Supplementary guidebooks will be prepared on certain major topics, such as contracting for fuel supply and fuel cycle requirements, which the present book does not go into very deeply

  18. Power plants 2010. Lectures

    International Nuclear Information System (INIS)

    2010-01-01

    The proceedings include the following lectures: Facing the challenges - new structures for electricity production. Renewable energies in Europe - chances and challenges. Nuclear outlook in the UK. Sustainable energy for Europe. Requirements of the market and the grid operator at the electricity production companies. Perspectives for the future energy production. Pumped storage plants - status and perspectives. Nuclear power/renewable energies -partners or opponents? New fossil fired power stations in Europe - status and perspectives. Nuclear energy: outlook for new build and lifetime extension in Europe. Biomass in the future European energy market - experiences for dong energy. Meeting the EU 20:20 renewable energy targets: the offshore challenges. DESERTEC: sustainable electricity for Europe, Middle East and North Africa. New power plants in Europe - a challenge for project and quality management. Consideration of safely in new build activities of power plants. Challenges to an integrated development in Maasvlakte, Netherlands. Power enhancement in EnBW power plants. Operational experiences of CCS pilot plants worldwide. Two years of operational experiences with Vattenfall's oxyfuel pilot plant. Pre-conditions for CCS. Storage technologies for a volatile generation. Overview: new generation of gas turbines.

  19. Maximum power point tracking

    International Nuclear Information System (INIS)

    Enslin, J.H.R.

    1990-01-01

    A well engineered renewable remote energy system, utilizing the principal of Maximum Power Point Tracking can be m ore cost effective, has a higher reliability and can improve the quality of life in remote areas. This paper reports that a high-efficient power electronic converter, for converting the output voltage of a solar panel, or wind generator, to the required DC battery bus voltage has been realized. The converter is controlled to track the maximum power point of the input source under varying input and output parameters. Maximum power point tracking for relative small systems is achieved by maximization of the output current in a battery charging regulator, using an optimized hill-climbing, inexpensive microprocessor based algorithm. Through practical field measurements it is shown that a minimum input source saving of 15% on 3-5 kWh/day systems can easily be achieved. A total cost saving of at least 10-15% on the capital cost of these systems are achievable for relative small rating Remote Area Power Supply systems. The advantages at larger temperature variations and larger power rated systems are much higher. Other advantages include optimal sizing and system monitor and control

  20. Low power arcjet performance

    Science.gov (United States)

    Curran, Francis M.; Sarmiento, Charles J.

    1990-01-01

    An experimental investigation was performed to evaluate arcjet operation at low power. A standard, 1 kW, constricted arcjet was run using nozzles with three different constrictor diameters. Each nozzle was run over a range of current and mass flow rates to explore stability and performance in the low power regime. A standard pulse-width modulated power processor was modified to accommodate the high operating voltages required under certain conditions. Stable, reliable operation at power levels below 0.5 kW was obtained at efficiencies between 30 and 40 percent. The operating range was found to be somewhat dependent on constrictor geometry at low mass flow rates. Quasi-periodic voltage fluctuations were observed at the low power end of the operating envelope. The nozzle insert geometry was found to have little effect on the performance of the device. The observed performance levels show that specific impulse levels above 350 seconds can be obtained at the 0.5 kW power level.