VHF signal power suppression in stratiform and convective precipitation
Directory of Open Access Journals (Sweden)
A. J. McDonald
2006-03-01
Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.
VHF signal power suppression in stratiform and convective precipitation
Directory of Open Access Journals (Sweden)
A. J. McDonald
2006-03-01
Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.
This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal
Directory of Open Access Journals (Sweden)
О. В. Шишкін
2013-07-01
Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium
Discharge Characteristic of VHF-DC Superimposed Magnetron Sputtering System
Toyoda, Hirotaka; Fukuoka, Yushi; Fukui, Takashi; Takada, Noriharu; Sasai, Kensuke
2014-10-01
Magnetron plasmas are one of the most important tools for sputter deposition of thin films. However, energetic particles from the sputtered target such as backscattered rare gas atoms or oxygen negative ions from oxide targets sometimes induce physical and chemical damages as well as surface roughening to the deposited film surface during the sputtering processes. To suppress kinetic energy of such particles, superposition of RF or VHF power to the DC power has been investigated. In this study, influence of the VHF power superposition on the DC target voltage, which is important factor to determine kinetic energy of high energy particles, is investigated. In the study, 40 MHz VHF power was superimposed to an ITO target and decrease in the target DC voltage was measured as well as deposited film deposition properties such as deposition rate or electrical conductivity. From systematic measurement of the target voltage, it was revealed that the target voltage can be determined by a very simple parameter, i.e., a ratio of VHF power to the total input power (DC and VHF powers) in spite of the DC discharge current. Part of this work was supported by ASTEP, JST.
33 CFR 26.03 - Radiotelephone required.
2010-07-01
... BRIDGE-TO-BRIDGE RADIOTELEPHONE REGULATIONS § 26.03 Radiotelephone required. (a) Unless an exemption is... 26 feet or over in length while navigating; and (4) Every dredge and floating plant engaged in or... for an unmanned or intermittently manned floating plant under the control of a dredge. (b) Every...
47 CFR 80.873 - VHF radiotelephone transmitter.
2010-10-01
...) The transmitter must deliver a carrier power between 8 and 25 watts into a 50 ohm effective resistance... 50 ohms effective resistance over the frequency band specified in § 80.871(d). An individual...
Dihydroazulene/Vinylheptafulvene (DHA/VHF)
DEFF Research Database (Denmark)
Vlasceanu, Alexandru
A theoretical and experimental investigation of conformational modifications on the thermodynamic, optical, and switching properties of dihydroazulene/vinylheptafulvene (DHA/VHF) photoswitches, in the context of molecular solar thermal (MOST) systems, is described herein. The optical properties...... of monomeric DHA/VHF systems are found to be strongly dependent on structural changes which can be tuned via steric modifications. This correlation is then used to infer structural features of more complex, macrocyclic DHA/VHF systems based on their optical properties. The introduction of macrocyclic ring...... strain is furthermore found to significantly influence the switching behavior of DHA/VHF moieties compared to non-cyclized systems. The thermal ring closure of macrocyclic VHF-VHF systems is found to occur in a stepwise manner, enabling the release of the energy on both a fast and slow timescale...
Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes
Directory of Open Access Journals (Sweden)
R. M. Worthington
1999-08-01
Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques
47 CFR 80.903 - Inspection of radiotelephone installation.
2010-10-01
... ship passes the inspection, the technician will issue a Communications Act Safety Radiotelephony... 47 Telecommunication 5 2010-10-01 2010-10-01 false Inspection of radiotelephone installation. 80... Passenger Boats § 80.903 Inspection of radiotelephone installation. Every vessel subject to Part III of...
47 CFR 80.271 - Technical requirements for portable survival craft radiotelephone transceivers.
2010-10-01
... craft radiotelephone transceivers. 80.271 Section 80.271 Telecommunication FEDERAL COMMUNICATIONS... Authorization for Compulsory Ships § 80.271 Technical requirements for portable survival craft radiotelephone transceivers. (a) Portable survival craft radiotelephone transceivers must comply with the following: (1) The...
47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...
47 CFR 80.320 - Radiotelephone distress call and message transmission procedure.
2010-10-01
... by its call sign or name, to permit direction-finding stations to determine its position. This... 47 Telecommunication 5 2010-10-01 2010-10-01 false Radiotelephone distress call and message... Procedures Distress, Alarm, Urgency and Safety Procedures § 80.320 Radiotelephone distress call and message...
International Nuclear Information System (INIS)
Zhang, H.Y.; He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C.; Zhuge, L.J.; Wu, X.M.
2015-01-01
HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO x are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf 2+ and Hf 4+ . The HfErO films are composed with the structures of HfO 2 , HfO and ErO x , which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO 2 in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO 2 are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)
2015-01-23
HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)
33 CFR 117.24 - Radiotelephone installation identification.
2010-07-01
... using Reflective Blue and Reflective White colors. Color and design information is available from the... the lower right quadrant. Note: It is recommended that the radiotelephone sign be similar in design to...
2010-10-01
...-cellular 800 MHz licensees from cellular radiotelephone or part 90-800 MHz cellular systems. 22.970 Section... MOBILE SERVICES Cellular Radiotelephone Service § 22.970 Unacceptable interference to part 90 non-cellular 800 MHz licensees from cellular radiotelephone or part 90-800 MHz cellular systems. (a) Definition...
47 CFR 22.960 - Cellular unserved area radiotelephone licenses subject to competitive bidding.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular unserved area radiotelephone licenses... (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.960 Cellular... applications for cellular unserved area Phase I and Phase II licenses filed after July 26, 1993 are subject to...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145
VHF Scintillation in an Artificially Heated Ionosphere
Suszcynsky, D. M.; Layne, J.; Light, M. E.; Pigue, M. J.; Rivera, L.
2017-12-01
As part of an ongoing project to characterize very-high-frequency (VHF) radio wave propagation through structured ionospheres, Los Alamos National Laboratory has been conducting a set of experiments to measure the scintillation effects of VHF transmissions under a variety of ionospheric conditions. Previous work (see 2015 Fall AGU poster by D. Suszcynsky et al.) measured the S4 index and ionospheric coherence bandwidth in the 32 - 44 MHz frequency range under naturally scintillated conditions in the equatorial region at Kwajalein Atoll during three separate campaigns centered on the 2014 and 2015 equinoxes. In this paper, we will present preliminary results from the February and September, 2017 High Altitude Auroral Research Project (HAARP) Experimental Campaigns where we are attempting to make these measurements under more controlled conditions using the HAARP ionospheric heater in a twisted-beam mode. Two types of measurements are made by transmitting VHF signals through the heated ionospheric volume to the Radio Frequency Propagation (RFProp) satellite experiment. The S4 scintillation index is determined by measuring the power fluctuations of a 135-MHz continuous wave signal and the ionospheric coherence bandwidth is simultaneously determined by measuring the delay spread of a frequency-modulated continuous wave (FMCW) signal in the 130 - 140 MHz frequency range. Additionally, a spatial Fourier transform of the CW time series is used to calculate the irregularity spectral density function. Finally, the temporal evolution of the time series is used to characterize spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities. All results are compared to theory and scaled for comparison to the 32 - 44 MHz Kwajalein measurements.
VHF lightning mapping observations of a triggered lightning flash
Edens, H. E.; Eack, K. B.; Eastvedt, E. M.; Trueblood, J. J.; Winn, W. P.; Krehbiel, P. R.; Aulich, G. D.; Hunyady, S. J.; Murray, W. C.; Rison, W.; Behnke, S. A.; Thomas, R. J.
2012-10-01
On 3 August 2010 an extensive lightning flash was triggered over Langmuir Laboratory in New Mexico. The upward positive leader propagated into the storm's midlevel negative charge region, extending over a horizontal area of 13 × 13 km and 7.5 km altitude. The storm had a normal-polarity tripolar charge structure with upper positive charge over midlevel negative charge. Lightning Mapping Array (LMA) observations were used to estimate positive leader velocities along various branches, which were in the range of 1-3 × 104 m s-1, slower than in other studies. The upward positive leader initiated at 3.4 km altitude, but was mapped only above 4.0 km altitude after the onset of retrograde negative breakdown, indicating a change in leader propagation and VHF emissions. The observations suggest that both positive and negative breakdown produce VHF emissions that can be located by time-of-arrival systems, and that not all VHF emissions occurring along positive leader channels are associated with retrograde negative breakdown.
47 CFR 80.1095 - Survival craft equipment.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Survival craft equipment. 80.1095 Section 80... for Ship Stations § 80.1095 Survival craft equipment. (a) At least three two-way VHF radiotelephone... they can be rapidly placed in any survival craft other than life rafts required by Regulation III/26.1...
47 CFR 87.131 - Power and emissions.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Power and emissions. 87.131 Section 87.131... Technical Requirements § 87.131 Power and emissions. The following table lists authorized emissions and... Authorized emission(s) 9 Maximum power 1 Aeronautical advisory VHF A3E 10 watts. 10 Aeronautical multicom VHF...
Using the SLAC VHF and UHF radio systems
International Nuclear Information System (INIS)
Struven, W.
1987-02-01
The use of the SLAC VHF and UHF Radio Systems and the Tunnel Antenna Systems as they are presently configured is described. The original radio system was built in 1966 and has grown in scope over the years. The Tunnel Antenna Systems were developed for, and first installed in, the PEP ring, and later added to other tunnels and redesigned to cover the UHF range, as well as VHF. The UHF radio system was designed and built for SLC use, and was first used in the SLC Arcs. The three radio systems will be described and the capabilities of each system will be defined
CMOS VHF transconductance-C lowpass filter
Nauta, Bram
1990-01-01
Experimental results of a VHF CMOS transconductance-C lowpass filter are described. The filter is built with transconductors as published earlier. The cutoff frequency can be tuned from 22 to 98 MHz and the measured filter response is very close to the ideal response
2010-10-01
... with simultaneous radiotelephone channels and their associated glide path station frequency from the...) VHF omni-range (VOR) stations are to be assigned frequencies in the 112.050-117.950 MHz band (50 kHz channel spacing) and the following frequencies in the 108-112 MHz band: 108.200 108.250 108.400 108.450...
Combined VLF and VHF lightning observations of Hurricane Rita landfall
Henderson, B. G.; Suszcynsky, D. M.; Wiens, K. C.; Hamlin, T.; Jeffery, C. A.; Orville, R. E.
2009-12-01
Hurricane Rita displayed abundant lightning in its northern eyewall as it made landfall at 0740 UTC 24 Sep 2005 near the Texas/Louisiana border. For this work, we combined VHF and VLF lightning data from Hurricane Rita, along with radar observations from Gulf Coast WSR-88D stations, for the purpose of demonstrating the combined utility of these two spectral regions for hurricane lightning monitoring. Lightning is a direct consequence of the electrification and breakdown processes that take place during the convective stages of thunderstorm development. As Rita approached the Gulf coast, the VHF lightning emissions were distinctly periodic with a period of 1.5 to 2 hours, which is consistent with the rotational period of hurricanes. VLF lightning emissions, measured by LASA and NLDN, were present in some of these VHF bursts but not all of them. At landfall, there was a significant increase in lightning emissions, accompanied by a significant convective surge observed in radar. Furthermore, VLF and VHF lightning source heights clearly increase as a function of time. The evolution of the IC/CG ratio is consistent with that seen in thunderstorms, showing a dominance of IC activity during storm development, followed by an increase in CG activity at the storm’s peak. The periodic VHF lightning events are correlated with increases in convective growth (quantified by the volume of radar echo >40 dB) above 7 km altitude. VLF can discriminate between lightning types, and in the LASA data, Rita landfall lightning activity was dominated by Narrow Bi-polar Events (NBEs)—high-energy, high-altitude, compact intra-cloud discharges. The opportunity to locate NBE lightning sources in altitude may be particularly useful in quantifying the vertical extent (strength) of the convective development and in possibly deducing vertical charge distributions.
47 CFR 80.102 - Radiotelephone station identification.
2010-10-01
... use of the name of the bridge in lieu of the call sign. (c) Ship stations transmitting on any authorized VHF bridge-to-bridge channel may be identified by the name of the ship in lieu of the call sign... may be identified by the name of the ship in lieu of the call sign, or as directed by the agency or...
Development of a High-Brightness VHF Electron Source at LBNL
International Nuclear Information System (INIS)
Lidia, Steven M.; Sannibale, Fernando; Staples, John W.; Virostek, Steve P.; Wells, Russell P.
2007-01-01
Currently proposed ERL and high average power FEL projects require electron beam sources that can generate ∼1nC bunch charges at high repetition rates. Many proposed sources are based around either high voltage DC or microwave RF guns, each with its particular set of technological limits and system complications. We propose a novel solution that greatly diminishes high voltage breakdown issues while also decreasing peak RF power requirements in a warm copper device, and that has the benefit of mapping the rf oscillation period much more closely to the required beam repetition rate. We present the initial RF and mechanical design for a 750kV electron source and beam injection system utilizing a gun resonant in the VHF band. Beam dynamics simulations demonstrate excellent beam quality preservation and transport
Utilizing Yagi antennas in Lightning Mapping Array to detect low-power VHF signals
Tilles, J.; Thomas, R. J.; Edens, H. E.; Krehbiel, P. R.; Rison, W.
2013-12-01
The New Mexico Tech VHF Lightning Mapping Array (LMA) being operated at Langmuir Laboratory in central New Mexico is comprised of 22 time-of-arrival stations spanning an area approximately 60 km north-south and 45 km east-west. Nine stations are at high altitude (3.1-3.3 km GPS) over a 3 x 4 km area around the mountain-top Laboratory, and 13 are on the surrounding plains and the Rio Grande valley, at altitudes between 1.4 and 2.2 km. Each station utilizes a vertical half-wave dipole antenna having about 2 dBi gain at horizontal incidence and providing omnidirectional azimuthal coverage. In 2012, four additional stations utilizing higher gain (11 dBi) Yagi antennas were co-located at four of the surrounding sites within 10-15 km of the laboratory, each pointed over the laboratory area. The purpose was to test if directional antennas would improve detection of low-power sources in the laboratory vicinity, such as those associated with positive breakdown or weak precursor events. The test involved comparing the number and quality of radiation sources obtained by processing data from two sets of stations: first for a 17-station network in which all stations were omnidirectional, and then for the same network with Yagi-based measurements substituted in place of the omni measurements at the four co-located stations. For radiation events located in both datasets, the indicated source power values from Yagi stations were typically 5-10 dB greater than their omnidirectional counterpart for sources over or near the laboratory, consistent with the 9 dB difference in on-axis gain values. The difference decreased through zero and to negative values with increasing distance from the laboratory, confirming that it was due to the directionality of the Yagi antennas. It was expected that a network having Yagi antennas at all outlying stations would improve the network's detection of lower power sources in its central region. Rather, preliminary results show that there is no
47 CFR 80.1015 - Power supply.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Power supply. 80.1015 Section 80.1015... MARITIME SERVICES Radiotelephone Installations Required by the Bridge-to-Bridge Act § 80.1015 Power supply. (a) There must be readily available for use under normal load conditions, a power supply sufficient...
Environmental/Noise Effects on VHF/UHF UWB SAR
National Research Council Canada - National Science Library
Ralston, James
1998-01-01
This paper presents a straightforward approach to estimating the impact of natural environmental noise on an overall system noise temperature for very high frequency/ultrahigh frequency synthetic aperture radar (VHF/UHF SAR...
47 CFR 80.917 - Reserve power supply.
2010-10-01
... power supply must be adequately treated to prevent freezing or overheating consistent with the season... 47 Telecommunication 5 2010-10-01 2010-10-01 false Reserve power supply. 80.917 Section 80.917... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.917 Reserve power...
Effect of geomagnetic storms on VHF scintillations observed at low latitude
Singh, S. B.; Patel, Kalpana; Singh, A. K.
2018-06-01
A geomagnetic storm affects the dynamics and composition of the ionosphere and also offers an excellent opportunity to study the plasma dynamics. In the present study, we have used the VHF scintillations data recorded at low latitude Indian station Varanasi (Geomag. latitude = 14^{°}55^' }N, long. = 154^{°}E) which is radiated at 250 MHz from geostationary satellite UFO-02 during the period 2011-2012 to investigate the effects of geomagnetic storms on VHF scintillation. Various geomagnetic and solar indices such as Dst index, Kp index, IMF Bz and solar wind velocity (Vx) are used to describe the geomagnetic field variation observed during geomagnetic storm periods. These indices are very helpful to find out the proper investigation and possible interrelation between geomagnetic storms and observed VHF scintillation. The pre-midnight scintillation is sometimes observed when the main phase of geomagnetic storm corresponds to the pre-midnight period. It is observed that for geomagnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time and extends to early morning hours.
47 CFR 80.965 - Reserve power supply.
2010-10-01
... conditions. When meeting this 2 hour requirement, such reserve power supply must be located on the bridge... radiotelephone must be a “reserve power supply” for the purposes of paragraphs (c), (d) and (e) of this section... meeting the requirements of paragraph (a) of this section as follows: (1) When the reserve power supply...
Adjuvant VHF therapy in locally recurrent and primary unresectable rectal cancer
International Nuclear Information System (INIS)
Trotter, J.M.; Lamb, M.H.; Bayliss, E.J.; Edis, A.J.; Blackwell, J.B.; Shepherd, J.M.; Cassidy, B.
1996-01-01
In a prospective randomized study, 434 MHz microwave therapy combined with external beam radiotherapy (VHF+RT) was compared with standard external beam radiotherapy (RT) in controlling locally recurrent or unresectable primary adenocarcinoma of the rectum. Independent assessors documented quality of life scores, performance status, toxicities local response to treatment, and systemic disease progression before treatment and after treatment and every 8 week thereafter. Of 75 patients randomized, 73 were eligible for inclusion in the study. Forty-three of these patients had local pelvic tumour recurrence only and 21 also had distant metastases. In addition, nine patients had primary inoperable carcinomas, two of whom also had metastases. Thirty-seven patients were randomized to RT and 36 to VHF+RT. Th median dose of radiation in the VHF+RT arm was 4275 cGy with a median fraction size of 150 cGy and median duration of therapy of 48.5 days versus 4500 cGy in the RT-only arm with a median fraction size of 180 cGy and median duration of therapy of 38 days. These doses are unlikely to be significantly different in biological effect. No significant difference between the two groups was observed in extent and duration of local control, measures of toxicity or quality of life scores. Additionally, survival and cumulative incidence of pelvic site of first progression did not differ significantly between the groups. It is concluded that VHF microwave therapy in conjunction with radiotherapy produces no therapeutic advantage over conventional radiation therapy alone in the treatment of locally recurrent rectal carcinoma. 35 refs., 8 tabs., 3 figs
A signature correlation study of ground target VHF/UHF ISAR imagery
Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Kersey, William T.; Waldman, Jerry; Carter, Steve; Nixon, William E.
2003-09-01
VV and HH-polarized radar signatures of several ground targets were acquired in the VHF/UHF band (171-342 MHz) by using 1/35th scale models and an indoor radar range operating from 6 to 12 GHz. Data were processed into medianized radar cross sections as well as focused, ISAR imagery. Measurement validation was confirmed by comparing the radar cross section of a test object with a method of moments radar cross section prediction code. The signatures of several vehicles from three vehicle classes (tanks, trunks, and TELs) were measured and a signature cross-correlation study was performed. The VHF/UHF band is currently being exploited for its foliage penetration ability, however, the coarse image resolution which results from the relatively long radar wavelengths suggests a more challenging target recognition problem. One of the study's goals was to determine the amount of unique signature content in VHF/UHF ISAR imagery of military ground vehicles. Open-field signatures are compared with each other as well as with simplified shapes of similar size. Signatures were also acquired on one vehicle in a variety of configurations to determine the impact of monitor target variations on the signature content at these frequencies.
Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)
Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.
2009-12-01
Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an
Directory of Open Access Journals (Sweden)
A. Westman
2004-04-01
Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields
Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?
International Nuclear Information System (INIS)
Van Erk, W; Luijks, G M J F; Hitchcock, W
2011-01-01
Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W -1 drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.
Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?
Energy Technology Data Exchange (ETDEWEB)
Van Erk, W [Philips Lighting, Sondervick 47, 5505 NB Veldhoven (Netherlands); Luijks, G M J F [Advanced Development Lighting, Philips Lighting, PO Box 80020, 5600 JM Eindhoven (Netherlands); Hitchcock, W, E-mail: Gerard.luijks@philips.com [Philips Lighting Company, 7265 Route 54, Bath, NY 14810 (United States)
2011-06-08
Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W{sup -1} drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.
47 CFR 22.913 - Effective radiated power limits.
2010-10-01
... radiated power (ERP) of transmitters in the Cellular Radiotelephone Service must not exceed the limits in this section. (a) Maximum ERP. In general, the effective radiated power (ERP) of base transmitters and... areas, as those areas are defined in § 22.949, the ERP of base transmitters and cellular repeaters of...
A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver
DEFF Research Database (Denmark)
Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold
2011-01-01
, is inherently resonant, and switching losses are greatly reduced by ensuring Zero Voltage Switching (ZVS) of the power semiconductor devices. A design method to ensure ZVS operation when combining the inverter, rectifier, and gate driver is provided. Several parasitic effects and their influence on converter......This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver...... operation are discussed, and measurement results of a 100 MHz prototype converter are presented and evaluated. The designed prototype converter verifies the described topology....
From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators
DEFF Research Database (Denmark)
Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.
2008-01-01
This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...
Wells, R. P.; Ghiorso, W.; Staples, J.; Huang, T. M.; Sannibale, F.; Kramasz, T. D.
2016-02-01
A high repetition rate, MHz-class, high-brightness electron source is a key element in future high-repetition-rate x-ray free electron laser-based light sources. The VHF-gun, a novel low frequency radio-frequency gun, is the Lawrence Berkeley National Laboratory (LBNL) response to that need. The gun design is based on a normal conducting, single cell cavity resonating at 186 MHz in the VHF band and capable of continuous wave operation while still delivering the high accelerating fields at the cathode required for the high brightness performance. The VHF-gun was fabricated and successfully commissioned in the framework of the Advanced Photo-injector EXperiment, an injector built at LBNL to demonstrate the capability of the gun to deliver the required beam quality. The basis for the selection of the VHF-gun technology, novel design features, and fabrication techniques are described.
Testing VHF/GPS collar design and safety in the study of free-roaming horses.
Directory of Open Access Journals (Sweden)
Gail H Collins
Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.
Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.
Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong
2017-10-23
The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-10-13
Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.
A beaded collar for dual micro GPS/VHF transmitter attachment to nutria
Haramis, G.M.; White, T.S.
2011-01-01
We report on the development of an approximately 85-g beaded collar for dual micro GPS/VHF transmitter attachment to semi-aquatic nutria (Myocastor coypus). Prototype collars were tested on captive nutria and refined during field trials. Central to the design was novel use of the VHF transmitter antenna as a collar. A circular collar was formed by passing the 44-cm antenna cable through a pre-made hole in the transmitter, leaving an approximately 16-cm upright antenna. GPS units were mounted separately via a hole in the base of each unit. For good satellite contact, GPS units (28 g) were maintained at the nape of the neck by counterbalance of the heavier VHF transmitters (50 g) positioned under the neck. To reduce friction, we lined the collar with alternate-sized plastic and, later, more durable nylon beads. The final collar configuration was worn for approximately 1 month deployments with only minor neck abrasion; one collar was worn successfully for 5 months. Foot entanglement remained the greatest risk of injury from the collar. By fitting collars tightly, we reduced the incidence of foot entanglement to 2 of 33 deployments (6%). Successful GPS tracks were acquired on 29 of 33 deployments (88%).
Evolution of Very High Frequency Power Supplies
DEFF Research Database (Denmark)
Knott, Arnold; Andersen, Toke Meyer; Kamby, Peter
2013-01-01
The ongoing demand for smaller and lighter power supplies is driving the motivation to increase the switching frequencies of power converters. Drastic increases however come along with new challenges, namely the increase of switching losses in all components. The application of power circuits used...... in radio frequency transmission equipment helps to overcome those. However those circuits were not designed to meet the same requirements as power converters. This paper summarizes the contributions in recent years in application of very high frequency (VHF) technologies in power electronics, shows results...... of the recent advances and describes the remaining challenges. The presented results include a self-oscillating gate-drive, air core inductor optimizations, an offline LED driver with a power density of 8.9 W/cm3 and a 120 MHz, 9 W DC powered LED driver with 89 % efficiency as well as a bidirectional VHF...
High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes
Energy Technology Data Exchange (ETDEWEB)
Deng, Xunming [University of Toledo; Fan, Qi Hua
2011-12-31
The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.
TH-AB-209-09: Quantitative Imaging of Electrical Conductivity by VHF-Induced Thermoacoustics
Energy Technology Data Exchange (ETDEWEB)
Patch, S; Hull, D [Avero Diagnostics, Irving, TX (United States); See, W [Medical College of Wisconsin, Milwaukee, WI (United States); Hanson, G [UW-Milwaukee, Milwaukee, WI (United States)
2016-06-15
Purpose: To demonstrate that very high frequency (VHF) induced thermoacoustics has the potential to provide quantitative images of electrical conductivity in Siemens/meter, much as shear wave elastography provides tissue stiffness in kPa. Quantitatively imaging a large organ requires exciting thermoacoustic pulses throughout the volume and broadband detection of those pulses because tomographic image reconstruction preserves frequency content. Applying the half-wavelength limit to a 200-micron inclusion inside a 7.5 cm diameter organ requires measurement sensitivity to frequencies ranging from 4 MHz down to 10 kHz, respectively. VHF irradiation provides superior depth penetration over near infrared used in photoacoustics. Additionally, VHF signal production is proportional to electrical conductivity, and prostate cancer is known to suppress electrical conductivity of prostatic fluid. Methods: A dual-transducer system utilizing a P4-1 array connected to a Verasonics V1 system augmented by a lower frequency focused single element transducer was developed. Simultaneous acquisition of VHF-induced thermoacoustic pulses by both transducers enabled comparison of transducer performance. Data from the clinical array generated a stack of 96-images with separation of 0.3 mm, whereas the single element transducer imaged only in a single plane. In-plane resolution and quantitative accuracy were measured at isocenter. Results: The array provided volumetric imaging capability with superior resolution whereas the single element transducer provided superior quantitative accuracy. Combining axial images from both transducers preserved resolution of the P4-1 array and improved image contrast. Neither transducer was sensitive to frequencies below 50 kHz, resulting in a DC offset and low-frequency shading over fields of view exceeding 15 mm. Fresh human prostates were imaged ex vivo and volumetric reconstructions reveal structures rarely seen in diagnostic images. Conclusion
Kudo, A.; Stock, M.; Ushio, T.
2017-12-01
We compared the optical observation from Geostationary Lightning Mapper (GLM) which is mounted on the geostationary meteorological satellite GOES-16 launched last year, and the radio observations from the ground-based VHF broad band interferometer. GLM detects 777.4 nm wavelength infrared optical signals from thunderstorm cells which are illuminated by the heated path during lightning discharge, and was developed mainly for the purpose of increasing the lead time for warning of severe weather and clarifying the discharge mechanism. Its detection has 2 ms frame rate, and 8 km square of space resolution at nadir. The VHF broad band interferometer is able to capture the electromagnetic waves from 20 MHz to 75 MHz and estimate the direction of arrival of the radiation sources using the interferometry technique. This system also has capability of observing the fast discharge process which cannot be captured by other systems, so it is expected to able to make detailed comparison. The recording duration of the system is 1 second. We installed the VHF broad band interferometer which consists of three VHF antenna and one fast antenna at Huntsville, Alabama from April 22nd to May 15th and in this total observation period, 720 triggers of data were observed by the interferometer. For comparison, we adopted the data from April 27th , April 30th. Most April 27th data has GLM "event" detection which is coincident time period. In time-elevation plot comparison, we found GLM detection timing was well coincide with interferometer during K-changes or return strokes and few detection during breakdown process. On the other hand, no GLM detection near the site for all data in April 30th and we are triyng to figure out the reason. We would like to thank University of Alabama Huntsville, New Mexico Institute of Mining and Technology, and RAIRAN Pte. Ltd for the help during the campaign.
Repotenciación de un sistema de radiocomunicaciones VHF
Directory of Open Access Journals (Sweden)
Juan Ortega
2016-11-01
Full Text Available Las comunicaciones móviles avanzan a pasos acelerados, como fuente de ayuda para la interrelación entre personas, empresas y proyectos que se enmarcan dentro de los criterios zonales de planificación, el cambio en la matriz productiva del país y el Plan Nacional del Buen Vivir. En tal virtud, el estudio de una repotenciación mediante la aplicación de conocimientos y herramientas enmarcadas dentro de las comunicaciones VHF, es fundamental dentro del mejoramiento en términos de calidad de servicio dentro del área de concesión donde se fundamenta el estudio. El presente artículo realiza un análisis situacional de la red de radiocomunicaciones VHF actual de la Empresa Eléctrica Regional Centro Sur C. A., el área de concesión, localización y coberturas de los repetidores existentes, con el diagnóstico actual de la misma. Además, se desarrolla la propuesta de repotenciación detallando la infraestructura necesaria para su ejecución, la ampliación del área de cobertura, la configuración del software para la gestión e interconexión de los equipos de diferentes zonas.
Directory of Open Access Journals (Sweden)
R. Sekar
2004-09-01
Full Text Available The VHF radars have been extensively used to investigate the structures and dynamics of equatorial Spread F (ESF irregularities. However, unambiguous identification of the nature of the structures in terms of plasma depletion or enhancement requires another technique, as the return echo measured by VHF radar is proportional to the square of the electron density fluctuations. In order to address this issue, co-ordinated radar backscatter and thermospheric airglow intensity measurements were carried out during March 2003 from the MST radar site at Gadanki. Temporal variations of 630.0-nm and 777.4-nm emission intensities reveal small-scale ("micro" and large-scale ("macro" variations during the period of observation. The micro variations are absent on non-ESF nights while the macro variations are present on both ESF and non-ESF nights. In addition to the well-known anti-correlation between the base height of the F-region and the nocturnal variation of thermospheric airglow intensities, the variation of the base height of the F-layer, on occasion, is found to manifest as a bottomside wave-like structure, as seen by VHF radar on an ESF night. The micro variations in the airglow intensities are associated with large-scale irregular plasma structures and found to be in correspondence with the "plume" structures obtained by VHF radar. In addition to the commonly observed depletions with upward movement, the observation unequivocally reveals the presence of plasma enhancements which move downwards. The observation of enhancement in 777.4-nm airglow intensity, which is characterized as plasma enhancement, provides an experimental verification of the earlier prediction based on numerical modeling studies.
Directory of Open Access Journals (Sweden)
H. Nagamoto
2008-08-01
Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.
Very High Frequency Galvanic Isolated Offline Power Supply
DEFF Research Database (Denmark)
Pedersen, Jeppe Arnsdorf
During the last decades many researchers have turned their attention to raising the operation frequency of power converters to the very high frequency (VHF) range going from 30 MHz to 300 MHz. Increasing the operating frequency of a power converter leads to smaller energy storing components...... inverters with a single combined rectifier. The converter designed to deliver 9 W to a 60 V LED load and is achieving an efficiency of 89.4% and a power density of 2.14 W3 . The development of this converter proof that offline VHF converter can be implemented with high efficiencies even for low power applications...... are described together with the possibility of using capacitors as the power galvanic isolation, both methods of creating galvanic isolation are implemented in converters. Regarding EMC a series of converters with different filter implementations are examined. The results from the conducted mea-surement from 150...
Two-dimensional simulations of multi-hollow VHF SiH4/H2 plasma
Directory of Open Access Journals (Sweden)
Li-Wen Su
2018-02-01
Full Text Available A triode multi-hollow VHF SiH4/H2 plasma (60 MHz was examined at a pressure of 20 Pa by two-dimensional simulations using the fluid model. In this study, we considered the effect of the rate constant of reaction, SiH3 + SiH3→SiH2 + SiH4, on the plasma characteristics. A typical VHF plasma of a high-electron density with a low-electron temperature was obtained between two discharge electrodes. Spatial profiles of SiH3+, SiH2+, SiH3- and SiH3 densities were similar to that of the electron density while the electron temperature had a maximum value near the two discharge electrodes. It was found that the SiH3 radical density did not decrease rapidly near the substrate and the electron temperature was lower than 1 eV, suggesting that the triode multi-hollow plasma source can provide high quality amorphous silicon with a high deposition rate.
First Joint Observations of Radio Aurora by the VHF and HF Radars of the ISTP SB RAS
Berngardt, O. I.; Lebedev, V. P.; Kutelev, K. A.; Kushnarev, D. S.; Grkovich, K. V.
2018-01-01
Two modern radars for diagnosis of the ionosphere by the radio-wave backscattering method, namely, the Irkutsk incoherent scatter radar at VHF (IISR, 154-162 MHz) and the Ekaterinburg coherent radar at HF (EKB, 8-20 MHz) are operated at the Institute of Solar-Terrestrial Physics, Siberian Branch of the Russian Academy of Sciences (ISTP SB RAS). The paper analyzes the results of joint observations of strong scattering (radio aurora) on June 8, 2015. To determine the geographical position of the radio aurora, we developed original methods that take into account both the features of the radio-wave propagation and the features of the radar antenna systems. It is shown that there are areas where the spatial position of the HF and VHF radio aurora can coincide. This permits using the radars as a single complex for diagnosis of the characteristics of small-scale high-latitude irregularities in the ionospheric E and F layers. A comparative analysis of the characteristics and temporal dynamics of the radio-aurora region in the HF and VHF ranges is performed. Using the DMSP satellite data, it has been shown that the radio aurora dynamics during this experiment with the EKB radar can be related with the spatial dynamics of the localized area with high electric field, which moves from high to equatorial latitudes. It is found that due to the broader field of view, radio aurora at the HF radar was stably observed 6-12 min earlier than at the VHF radar. This permits using the EKB radar data for prediction of the radio-aurora detection by the IISR radar.
Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands
Directory of Open Access Journals (Sweden)
G. D. Nastrom
2001-08-01
Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques
Robles, Guillermo; Fresno, José Manuel; Martínez-Tarifa, Juan Manuel; Ardila-Rey, Jorge Alfredo; Parrado-Hernández, Emilio
2018-03-01
The measurement of partial discharge (PD) signals in the radio frequency (RF) range has gained popularity among utilities and specialized monitoring companies in recent years. Unfortunately, in most of the occasions the data are hidden by noise and coupled interferences that hinder their interpretation and renders them useless especially in acquisition systems in the ultra high frequency (UHF) band where the signals of interest are weak. This paper is focused on a method that uses a selective spectral signal characterization to feature each signal, type of partial discharge or interferences/noise, with the power contained in the most representative frequency bands. The technique can be considered as a dimensionality reduction problem where all the energy information contained in the frequency components is condensed in a reduced number of UHF or high frequency (HF) and very high frequency (VHF) bands. In general, dimensionality reduction methods make the interpretation of results a difficult task because the inherent physical nature of the signal is lost in the process. The proposed selective spectral characterization is a preprocessing tool that facilitates further main processing. The starting point is a clustering of signals that could form the core of a PD monitoring system. Therefore, the dimensionality reduction technique should discover the best frequency bands to enhance the affinity between signals in the same cluster and the differences between signals in different clusters. This is done maximizing the minimum Mahalanobis distance between clusters using particle swarm optimization (PSO). The tool is tested with three sets of experimental signals to demonstrate its capabilities in separating noise and PDs with low signal-to-noise ratio and separating different types of partial discharges measured in the UHF and HF/VHF bands.
Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios
2015-05-01
Transactions on. 2002;50(5):591-599. 22. Nerguizian C, Despins C, Affes S, Djadel M. Radio-channel characterization of an underground mine at 2.4 ghz...INTENTIONALLY LEFT BLANK. viii 1. Introduction Reliable wireless communication is of paramount importance for many important civilian and military...report, we study near-ground, wireless channel modeling in the lower VHF band for indoor and indoor/outdoor scenarios, drawing from extensive propagation
Directory of Open Access Journals (Sweden)
N. Swarnalingam
2009-04-01
Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.
VHF/UHF imagery and RCS measurements of ground targets in forested terrain
Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Waldman, Jerry; Nixon, William E.
2002-08-01
The monostatic VV and HH-polarized radar signatures of several targets and trees have been measured at foliage penetration frequencies (VHF/UHF) by using 1/35th scale models and an indoor radar range operating at X-band. An array of high-fidelity scale model ground vehicles and test objects as well as scaled ground terrain and trees have been fabricated for the study. Radar measurement accuracy has been confirmed by comparing the signature of a test object with a method of moments radar cross section prediction code. In addition to acquiring signatures of targets located on a smooth, dielectric ground plane, data have also been acquired with targets located in simulated wooded terrain that included scaled tree trunks and tree branches. In order to assure the correct backscattering behavior, all dielectric properties of live tree wood and moist soil were scaled properly to match the complex dielectric constant of the full-scale materials. The impact of the surrounding tree clutter on the VHF/UHF radar signatures of ground vehicles was accessed. Data were processed into high-resolution, polar-formatted ISAR imagery and signature comparisons are made between targets in open-field and forested scenarios.
VHF/UHF radar observations of tropical mesoscale convective systems over southern India
Directory of Open Access Journals (Sweden)
K. Kishore Kumar
2005-07-01
Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other.
Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing
VHF/UHF radar observations of tropical mesoscale convective systems over southern India
Directory of Open Access Journals (Sweden)
K. Kishore Kumar
2005-07-01
Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing
Some radiation safety aspects of operating medical generators of VHF electromagnetic energy
International Nuclear Information System (INIS)
Bosevski, V.; Radev, S.; Donev, Ch.
1977-01-01
The state of radiation safety in physiotherapy practice using very-high-frequency diathermy was studied with regard to personnel and patient protection. A specially devised shielding set to protect patients and personnel is offered for adoption, and the necessity is insistently stressed of prohibiting any patient head or gonad exposure. It is pointed out that the protective set developed may also be used at facilities employing other types of VHF electromagnetic energy sources. (author)
47 CFR 22.727 - Power limits for conventional rural radiotelephone transmitters.
2010-10-01
... this section. (a) Maximum ERP. The effective radiated power (ERP) of central office and rural... circumstances. Frequency range (MHz) Maximum ERP (watts) 152-153 1400 157-159 150 454-455 3500 459-460 150 (b) Basic power limit. Except as provided in paragraph (d) of this section, the ERP of central office...
International Nuclear Information System (INIS)
Joseph, W.; Goeminne, F.; Verloock, L.; Vermeeren, G.; Martens, L.
2012-01-01
Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m -1 for occupational exposure and from 0.007 to 8.0 V m -1 for general public exposure. The average fields equal 5.2 V m -1 for workers, and 0.7 V m -1 for general public. (authors)
Joseph, Wout; Goeminne, Francis; Verloock, Leen; Vermeeren, Günter; Martens, Luc
2012-09-01
Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric-field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m(-1) for occupational exposure and from 0.007 to 8.0 V m(-1) for general public exposure. The average fields equal 5.2 V m(-1) for workers, and 0.7 V m(-1) for general public.
Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD
International Nuclear Information System (INIS)
Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto
2015-01-01
The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively
Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD
Energy Technology Data Exchange (ETDEWEB)
Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)
2015-04-16
The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.
On the Ongoing Evolution of Very High Frequency Power Supplies
DEFF Research Database (Denmark)
Knott, Arnold; Andersen, Toke Meyer; Kamby, Peter
2013-01-01
The ongoing demand for smaller and lighter power supplies is driving the motivation to increase the switching frequencies of power converters. Drastic increases however come along with new challenges, namely the increase of switching losses in all components. The application of power circuits used...... in radio frequency transmission equipment helps to overcome those. However those circuits were not designed to meet the same requirements as power converters. This paper summarizes the contributions in recent years in application of very high frequency (VHF) technologies in power electronics, describes...
Graphene-based tunable non-foster circuit for VHF applications
Energy Technology Data Exchange (ETDEWEB)
Tian, Jing; Nagarkoti, Deepak Singh; Rajab, Khalid Z.; Hao, Yang, E-mail: y.hao@qmul.ac.uk [School of Electronic Engineering and Computer Science, Queen Mary, University of London, London, E1 4NS (United Kingdom)
2016-06-15
This paper presents a negative impedance converter (NIC) based on graphene field effect transistors (GFETs) for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS) topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010)] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS) show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency) using Nyquist stability criterion to ensure there are no oscillation issues.
Graphene-based tunable non-foster circuit for VHF applications
Directory of Open Access Journals (Sweden)
Jing Tian
2016-06-01
Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.
Directory of Open Access Journals (Sweden)
R. M. Worthington
1999-02-01
Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.
Microfabricated Air-core Toroidal Inductor In Very High Frequency Power Converters
DEFF Research Database (Denmark)
Lê Thanh, Hoà; Nour, Yasser; Han, Anpan
2018-01-01
Miniaturization of power supplies is required for future intelligent electronic systems e.g. internet of things devices. Inductors play an essential role, and they are by far the most bulky and expensive components in power supplies. This paper presents a miniaturized microelectromechanical systems...... (MEMS) inductor and its performance in a very high frequency (VHF) power converter. The MEMS inductor is a siliconembedded air-core toroidal inductor, and it is constructed with through-silicon vias, suspended copper windings, silicon fixtures, and a silicon support die. The air-core inductors...
Directory of Open Access Journals (Sweden)
G. Manju
2005-06-01
Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.
Directory of Open Access Journals (Sweden)
G. Manju
2005-06-01
Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.
Observations of lightning processes using VHF radio interferometry
Rhodes, C. T.; Shao, X. M.; Krehbiel, P. R.; Thomas, R.
1991-01-01
A single station, multiple baseline radio interferometer was used to locate the direction of VHF radiation from lightning discharges with microsec time resolution. Radiation source directions and electric field waveforms were analyzed for various types of breakdown events. These include initial breakdown and K type events of in-cloud activity, and the leaders of initial and subsequent strokes to ground and activity during and following return strokes. Radiation during the initial breakdown of a flash and in the early stages of initial leaders to ground is found to be similar. In both instances, the activity consists of localized bursts of radiation that are intense and slow moving. Motion within a given burst is unresolved by the interferometer. Radiation from in-cloud K type events is essentially the same as that from dart leaders; in both cases it is produced at the leading edge of a fast moving streamer that propagates along a well defined, often extensive path. K type events are sometimes terminated by fast field changes that are similar to the return stroke initiated by dart leaders; such K type events are the in-cloud analog of the dart leader return stroke process.
Morphology and Structural Characterization of Carbon Nanowalls Grown via VHF-PECVD
Akmal Hasanudin, M.; Wahab, Y.; Ismail, A. K.; Zahid Jamal, Z. A.
2018-03-01
A 150 MHz very high frequency plasma enhanced chemical vapor deposition (150 MHz VHF-PECVD) system was utilized to fabricate two-dimensional carbon nanostructure from the mixture of methane and hydrogen. Morphology and structural properties of the grown nanostructure were investigated by FESEM imaging and Raman spectroscopy. Carbon nanowalls (CNW) with dense and wavy-like structure were successfully synthesized. The wavy-like morphology of CNW was found to be more distinct during growth at small electrode spacing and denser with increasing deposition time due to better flux of hydrocarbon radicals to the substrate and higher rate of reaction, respectively. Typical characteristics of CNW were observed from strong D band, narrow bandwidth of G band and single broad peak of 2D band of Raman spectra indicating the presence of disordered nanocrystalline graphite structure with high degree of graphitization.
Embedded Solenoid Transformer for Power Conversion
DEFF Research Database (Denmark)
2015-01-01
A resonant power converter for operation in the radio frequency range, preferably in the VHF, comprises at least one PCB-embedded transformer. The transformer is configured for radio frequency operation and comprises a printed circuit board defining a horizontal plane, the printed circuit board...... comprising at least two horizontal conductive layers separated by an isolating layer, a first embedded solenoid forming a primary winding of the transformer and a second embedded solenoid being arranged parallel to the first solenoid and forming a secondary winding of the transformer, wherein the first...
Use of vhf dielectric measurements for borehole formation analysis
Energy Technology Data Exchange (ETDEWEB)
Poley, J.P.; Nooteboom, J.J.; de Waal, P.J.
1978-01-01
A study of the dielectric properties of sedimentary rocks at a sufficiently high frequency may provide useful data for the evaluation of borehole wall formations in exploration and production wells. An experimental program carried out between 1960 and 1967 on sandstone and limestone samples lent further support to these expectations. At frequencies above 20 Mc/s both real and imaginary parts of the complex epsilon* = epsilon' - j epsilon'' were measurable. Moreover, at higher frequencies, epsilon' proved to be independent of the salinity of the water filling the pores, and insensitive to the way in which the oil and the water are actually distributed. The value of epsilon'', on the other hand, turned out to be indicative of the prevailing salinity. By combining other logging data (for instance from an electric or porosity log) with a series of such v.h.f. measurements of epsilon' and epsilon'', the oil or water saturation, the effective formation porosity, the pore-filling fluid salinity, and the rock matrix formation factor might be deduced, if the depth of investigation can be made large enough to overcome the invasion effects.
International Nuclear Information System (INIS)
Flikweert, A J; Zimmermann, T; Merdzhanova, T; Weigand, D; Appenzeller, W; Gordijn, A
2012-01-01
A concept for high-rate plasma deposition (PECVD) of hydrogenated microcrystalline silicon on moving substrates (dynamic deposition) is developed and evaluated. The chamber allows for substrates up to a size of 40 × 40 cm 2 . The deposition plasma is sustained between linear VHF electrodes (60 MHz) and a moving substrate. Due to the gas flow geometry and the high degree of source gas depletion, from the carrier's point of view the silane concentration varies when passing the electrodes. This is known to lead to different growth conditions which can induce transitions from microcrystalline to amorphous growth. The effect of different silane concentrations is simulated at a standard RF showerhead electrode by intentionally varying the silane concentration during deposition in static mode. This variation may decrease the layer quality of microcrystalline silicon, due to a shift of the crystallinity away from the optimum. However, adapting the input silane concentration, state-of-the-art solar cells are obtained. Microcrystalline cells (ZnO : Al/Ag back contacts) produced by the linear VHF plasma sources show an efficiency of 7.9% and 6.6% for depositions in static and dynamic mode, respectively. (paper)
Intrinsic Nonlinearities and Layout Impacts of 100 V Integrated Power MOSFETs in Partial SOI Process
DEFF Research Database (Denmark)
Fan, Lin; Knott, Arnold; Jørgensen, Ivan Harald Holger
Parasitic capacitances of power semiconductors are a part of the key design parameters of state-of-the-art very high frequency (VHF) power supplies. In this poster, four 100 V integrated power MOSFETs with different layout structures are designed, implemented, and analyzed in a 0.18 ȝm partial...... Silicon-on-Insulator (SOI) process with a die area 2.31 mm2. A small-signal model of power MOSFETs is proposed to systematically analyze the nonlinear parasitic capacitances in different transistor states: off-state, sub-threshold region, and on-state in the linear region. 3D plots are used to summarize...
Li, Yun; Qiu, Shi; Shi, Lihua; Huang, Zhengyu; Wang, Tao; Duan, Yantao
2017-12-01
The time resolved three-dimensional (3-D) spatial reconstruction of lightning channels using high-speed video (HSV) images and VHF broadband interferometer (BITF) data is first presented in this paper. Because VHF and optical radiations in step formation process occur with time separation no more than 1 μs, the observation data of BITF and HSV at two different sites provide the possibility of reconstructing the time resolved 3-D channel of lightning. With the proposed procedures for 3-D reconstruction of leader channels, dart leaders as well as stepped leaders with complex multiple branches can be well reconstructed. The differences between 2-D speeds and 3-D speeds of leader channels are analyzed by comparing the development of leader channels in 2-D and 3-D space. Since return stroke (RS) usually follows the path of previous leader channels, the 3-D speeds of the return strokes are first estimated by combination with the 3-D structure of the preceding leaders and HSV image sequences. For the fourth RS, the ratios of the 3-D to 2-D RS speeds increase with height, and the largest ratio of the 3-D to 2-D return stroke speeds can reach 2.03, which is larger than the result of triggered lightning reported by Idone. Since BITF can detect lightning radiation in a 360° view, correlated BITF and HSV observations increase the 3-D detection probability than dual-station HSV observations, which is helpful to obtain more events and deeper understanding of the lightning process.
Broadband VHF Interferometer Observations of an Energetic In-cloud Pulse (EIP)
Tilles, J.; Krehbiel, P. R.; Stanley, M. A.; Rison, W.; Lyu, F.; Cummer, S.; Liu, N.; Dwyer, J. R.; Brown, R. G.; Wilson, J. G.
2017-12-01
Energetic in-cloud pulses (EIPs) are a little-known in-cloud subprocess of lightning. While they may be best identified by their large peak current (>200 kA) [Lyu et al., Geophys. Res. Lett., 42, 2015], they differ from narrow bipolar events (NBEs) - another type of in-cloud, high peak-current process - in that the sferic of an EIP lasts an order of magnitude longer ( ˜100 us) than that of a typical NBE ( ˜10 us). To further differentiate them from NBEs, EIPs are generally embedded within other electrical activity, whereas NBEs are known to primarily occur in isolation or as a lightning-initiating event [Smith et al., J. Geophys. Res., 104, D4, 4189-4212, 1999; Rison et al., Nat. Commun., 7, 10721, 2016]. Moreover, EIPs may have an intrinsic connection with the production of terrestrial gamma ray flashes (TGFs) [Cummer et al., Geophys. Res. Lett., 41, 8586-8593, 2014].Here we present coincident broadband VHF interferometer (INTF) observations and electric and magnetic field waveforms of an EIP with an associated NLDN peak current of 247 kA. The EIP occurs nearly 4 ms into a normal-polarity intracloud flash as part of the upward extension of the negative-polarity lightning leader. For this reason, we suspect that EIPs are a more energetic version of initial breakdown pulses (IBPs), which accompany the development of negative stepped leaders [e.g. Marshall et al., J. Geophys. Res. Atmos., 119, 445-460, 2014]. In addition, we show similarities with NBE-producing fast breakdown [Rison et al., 2016; Tilles et al., AE12A-03, AGU Fall Meeting, 2016], in that the breakdown accompanying the EIP propagates over a similar vertical extent ( ˜0.5-1 km) and with similar propagation speed ( ˜3×107 m/s). The INTF was developed by New Mexico Tech and has been deployed at Kennedy Space Center since July 2016. It employed three 100-m baselines in 2016, has a bandwidth of 14-88 MHz and samples at 180 MS/s with 16-bit resolution. A synchronously digitized fast antenna (FA), with
International Nuclear Information System (INIS)
Dolgonosov, M.; Gotlib, V.; Karedin, V.; Kosov, A.; Nazarov, V.; Zelenyi, L.; Klimov, S.
2017-01-01
Space Research Institute of the RAS is gradually developing its own program of the space-born experiments to study high- energy process in the terrestrial atmosphere. Terrestrial Gamma-ray Flashes (TGFS) and Compact Intracloud Discharges (CIDs) are among principal goals of the scientific research of the program. To conduct research is supposed to produce new «instruments»: microsatellite «ChibiS-AI» and VHF interferometer «Kite» aboard International Space Station. Microsatellite ”Chibis-AI” will be constructed on the platform originally designed at the Special Engineering Department of Space Research Institute of the Russian Academy of Sciences in 2011. It's forerunner «Chibis-M» was successfully launched in 2012. Expected date of «Chibis-AI» launch is 2019. The principal idea underlying design of the scientific payload of the microsatellite ”Chibis-AI” is the joint observations of the TGF and CID emissions by different detectors installed onboard: Radio Frequency Analyzer (RFA) and Neutron and Gamma spectrometer (N GS). RFA contained two passbands in the range 15-26 and 26-48 MHZ with a digitization at 96 megasamples/s. NGS is based on LaBr3(Ce3+) crystal with the maximum achievable today spectral resolution and efficiency of gamma rays in the energy range 100 Kev - 10 MeV among scintillation crystals. The microsatellite orbit will be circular with inclination 51° with initial elevation above sea level around 550 km. VHF interferometer «Kite» to be installed in 2019-2020 aboard 188. To implement interferometric scheme 4 antennas will be installed on the 188 surface. The passband of the instrument will be ∼50-100 MHZ. Technical details of both experiments, its current stage and features as well results of the previous experiment «Chibis-M» will be discussed. (author)
47 CFR 80.959 - Radiotelephone transmitter.
2010-10-01
... watts into 50 ohms nominal resistance when operated with its rated supply voltage. The transmitter must... capability of the transmitter, measurements of primary supply voltage and transmitter output power must be... voltage measured at the power input terminals to the transmitter terminated in a matching artificial load...
47 CFR 22.867 - Effective radiated power limits.
2010-10-01
... MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.867... operating on the frequency ranges listed in § 22.857 must not exceed the limits in this section. (a) The peak ERP of airborne mobile station transmitters must not exceed 12 Watts. (b) The peak ERP of ground...
Directory of Open Access Journals (Sweden)
Mario Macea Anaya
2016-03-01
Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.
Amplitude modulator of radio frequency system for 1.3 GeV Electron Synchrotron
International Nuclear Information System (INIS)
Fukushima, T.
1977-01-01
The amplitude modulator for the 8F68 VHF high power tetrode tube has been designed and constructed. The modulator was constructed with solid components such as transistors and integrated circuits. In case of changing circuit elements of the modulator to solid components from tubes, many attentions are paid for preventing the noise and the over load, due to connection between the low power circuits (modulator) and high power circuits (VHF amplifier). The new modulator is constructed with taking careful consideration into selection of the method of the power control and the protection system. (auth.)
Fuel cell/photovoltaic integrated power system for a remote telecommunications repeater
Energy Technology Data Exchange (ETDEWEB)
Lehman, P.; Chamberlin, C.; Zoellick, J.; Engel, R.; Rommel, D. [Humbolt State University, Arcata, CA (United States). Schatz Energy Research Center
2002-07-01
There is a special energy supply challenge associated with remote telecommunication systems, as they require reliable, unattended power system operation in areas and locations where there is no grid power. To supply back-up power to the Schoolhouse Peak remote photovoltaic-powered radio-telephone repeater located in Redwood National Park in northwestern California, the Schatz Energy Research Center built and operated a proton exchange membrane (PEM) fuel cell power system. In those instances where solar insolation is insufficient to maintain state-of-charge of the system's battery, the fuel cell automatically starts. Remote monitoring and control is made possible with the use of a cellular modem. The original fuel cell stack logged 3239 hours of run time in 229 days of operation. Subsequent to improvements and a rebuilt fuel cell stack, it operated for 3836 hours during 269 days. In this paper, system performance, long-term fuel cell voltage decay, and lessons learned and applied in system refurbishment were discussed. During this trial, the flawless performance of the hydrogen storage and delivery subsystem, the battery voltage-sensing relay, the safety shutdowns, and the remote data acquisition and control equipment was noted. To protect the stack from sudden temperature increases while minimizing unneeded parasitic loads, experience showed that a temperature-controlled fan switch, despite its additional complexity, was justified. 4 refs., 10 figs.
Large power electron tubes for high frequency heating
International Nuclear Information System (INIS)
Okamoto, Tadashi; Sato, Hisaaki.
1988-01-01
On the large power electron tubes used for electron cyclotron heating, lower hybrid resonance frequency heating, and ion cyclotron range of frequency heating, namely gyrotron, klystron and quadrupole tube, the features, the present status of development, the construction, the principle and so on are explained. The research and development of gyrotrons are most advanced in USSR, the inventor. The course of the development of gyrotrons in foreign countries and in Japan is described. There are many variants of gyrotrons, for example whispering gallery mode, klystron type, backward wave oscillator type, gyro-peniotron and others. The principle of gyrotrons is explained, and about the examples of the developed gyrotrons, the design parameters are shown. For the purpose of using for the LHRF heating in JT-60, a superlarge power klystron of 1 MW output at 2 GHz frequency, which is the largest class in the world, has been developed. Its total length is 2.7 m, and weight is 1.5 t. It features, construction, function and performance are reported. The trend of large power quadrupole tubes is toward stable action with large power in VHF zone, and the typical products in USA and Europe are shown. (Kako, I.)
Ion upflow and downflow at the topside ionosphere observed by the EISCAT VHF radar
Directory of Open Access Journals (Sweden)
M. Endo
2000-02-01
Full Text Available We have determined the MLT distribution and KP dependence of the ion upflow and downflow of the thermal bulk oxygen ion population based on a data analysis using the EISCAT VHF radar CP-7 data obtained at Tromsø during the period between 1990 and 1996: (1 both ion upflow and downflow events can be observed at any local time (MLT, irrespective of dayside and nightside, and under any magnetic disturbance level, irrespective of quiet and disturbed levels; (2 these upflow and downflow events are more frequently observed in the nightside than in the dayside; (3 the upflow events are more frequently observed than the downflow events at any local time except midnight and at any KP level and the difference of the occurrence frequencies between the upflow and downflow events is smaller around midnight; and (4 the occurrence frequencies of both the ion upflow and downflow events appear to increase with increasing KP level, while the occurrence frequency of the downflow appears to stop increasing at some KP level.Key words: Ionosphere (particle acceleration; plasma waves and instabilities - Space plasma physics (transport processes
Directory of Open Access Journals (Sweden)
P. V. S. Rama Rao
2005-10-01
Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents
The Meteorology of Storms that Produce Narrow Bipolar Events
Lang, Timothy; McCaul, Bill; Fuchs, Brody; Cummer, Steve
2013-01-01
Narrow Bipolar Event's (NBE) are compact ( 10 kW in VHF), and impulsive (approx 10 micro s) electrical discharges in thunderstorms, also known as compact intracloud discharges (CIDs). Can be either positive or negative polarity and have distinctive broadband waveform signatures sometimes confused for +CGs in the past by NLDN and other networks. NBEs are related to lightning but are likely optically "dark". As revealed by VHF sensors (both satellite and ground): (1) The most powerful lightning--related VHF sources observed (2) Tend to occur at the beginning of intracloud discharges (3) Difficult to estimate altitude properly due to receiver saturation.
EMC Investigation of a Very High Frequency Self-oscillating Resonant Power Converter
DEFF Research Database (Denmark)
Pedersen, Jeppe Arnsdorf; Knott, Arnold; Andersen, Michael A. E.
2016-01-01
This paper focuses on the electromagnetic compatibility (EMC) performance of a Very High Frequency (VHF) converter and how to lower the emissions. To test the EMC performance a VHF converter is implemented with a Class-E inverter and a Class-DE rectifier. The converter is designed to deliver 3 W...... the regulations. This converter shows to be well below the levels for conducted emission even without filtering. For the radiated emissions the converter is above the limits without input and output filters. Several designs with different ways to lower the emissions are implemented and the different layouts...
The setting for ground based augmentation system station
Ni, Yude; Liu, Ruihua
2007-11-01
Based on the minimum field strength requirement within the whole GBAS service volume, this paper performs nominal link power budget for GBAS VHF data broadcast (VDB) system, and the required power transmitted from VDB system is derived. The paper elaborates the requirement of Desired-to-Undesired (D/U) signal ratio for a specific VHF airborne receiver to ensure the normal operation by the test, and presents the experimental method and results for acquiring the D/U signal ratios. The minimum geographical separations among GBAS, VOR and ILS stations are calculated according to the specifications of these three kinds of navigation systems.
VHF and HF radar measurements of E and R region plasma drifts at the magnetic equator
International Nuclear Information System (INIS)
Viswanathan, K.S.; Namboothiri, S.P.; Rao, P.B.
1992-01-01
Simultaneous observations of E region horizontal irregularity drifts by VHF backscatter radar and of F region vertical plasma drift by HF Doppler radar conducted during daytime on a few magnetically quiet days at Trivandrum (dip 0.2 degree N) are presented. A comparative study of the two measurements indicates broadly (1) a resemblance in the daytime changes of the E-W component between the electric field and (2) evidence of quasi-periodic electric field variations with periods ranging mostly from 1 to 2 hours. The electric fields derived from HF Doppler radar observations are somewhat lower than those deduced by HVHF radar observations. The correlation coefficient for the variations of the electric fields measured by the two experimental techniques is found to be in the range of about 0.5 to 0.9. The observed difference in the E and F region electric fields at the magnetic equator is discussed in terms of the measurement uncertainties and the limitations involved in deriving E-W electric fields. The observations are suggestive of a latitudinal variation in the E-W component of the electric field in the equatorial ionosphere
Horizontal maps of echo power in the lower stratosphere using the MU radar
Directory of Open Access Journals (Sweden)
M. Hirono
2004-03-01
Full Text Available In recent works, zenithal and azimuthal angle variations of echo power measured by VHF Stratosphere-Troposphere (ST radars have been analyzed in detail using different radar multi-beam configurations. It was found that the azimuthal angle corresponding to maximum echo power is closely related to the direction of the horizontal wind shear. These properties indicate that local wind shear affects the tilt of the scatterers. Moreover, horizontal maps of echo power collected using a large set of beams steered pulse-to-pulse up to 40 degrees off zenith revealed that the power distribution pattern in the troposphere is often skewed. In this work, a three-dimensional description of echo power variations up to 24 degrees off zenith is shown for measurements in the lower stratosphere (i.e. up to approximately 20km using a "sequential multi-beam" (SMB configuration. Such a description was not possible above the tropopause with classical multi-beam configurations because of the loss of radar sensitivity due to the limited integration time by the use of a large number of beams. This work attempts to complete previous descriptions of the phenomenon by some observations in the lower stratosphere discussed in association with complementary balloon measurements. Key words. Meteorology and atmospheric dynamics (turbulence – Radio Science (remote sensing
Printed Circuit Board Integrated Toroidal Radio Frequency Inductors
DEFF Research Database (Denmark)
Kamby, Peter; Knott, Arnold; Andersen, Michael A. E.
2012-01-01
Modern power semiconductors allow for switching frequencies of power converters in the very high frequency (VHF) band (30 MHz to 300 MHz). The major advantage of this frequency increase is a remarkable reduction of the size of power converters due to smaller passive components. However crucial...
Horizontal maps of echo power in the lower stratosphere using the MU radar
Directory of Open Access Journals (Sweden)
M. Hirono
2004-03-01
Full Text Available In recent works, zenithal and azimuthal angle variations of echo power measured by VHF Stratosphere-Troposphere (ST radars have been analyzed in detail using different radar multi-beam configurations. It was found that the azimuthal angle corresponding to maximum echo power is closely related to the direction of the horizontal wind shear. These properties indicate that local wind shear affects the tilt of the scatterers. Moreover, horizontal maps of echo power collected using a large set of beams steered pulse-to-pulse up to 40 degrees off zenith revealed that the power distribution pattern in the troposphere is often skewed. In this work, a three-dimensional description of echo power variations up to 24 degrees off zenith is shown for measurements in the lower stratosphere (i.e. up to approximately 20km using a "sequential multi-beam" (SMB configuration. Such a description was not possible above the tropopause with classical multi-beam configurations because of the loss of radar sensitivity due to the limited integration time by the use of a large number of beams. This work attempts to complete previous descriptions of the phenomenon by some observations in the lower stratosphere discussed in association with complementary balloon measurements.
Key words. Meteorology and atmospheric dynamics (turbulence – Radio Science (remote sensing
Morphological study of the field-aligned E-layer irregularities observed by the Gadanki VHF radar
Directory of Open Access Journals (Sweden)
C. J. Pan
2004-11-01
Full Text Available We report on the field-aligned irregularities observed in the low-latitude sporadic E-layer (Es with the Gadanki (13.5° N, 79.2° E; geomagnetic latitude 6.3° N VHF radar. The radar was operated intermittently for 15 days during the summer months in 1998 and 1999, for both daytime and nighttime observation. The total observation periods are 161h for the nighttime and 68h for the daytime. The observations were used to study the percentage of occurrence of the E-region echoes for both daytime and nighttime. The statistical characteristics of the mean radial velocity and spectral width are presented for three cases based on the echo occurrence characteristics and the altitude of observations (from 90 to 140km ranges, namely, the lower E-region daytime (90-110km, the lower E-region nighttime (90-105km and the upper E-region nighttime (105-140km echoes. The results are compared with that of Piura, a low-latitude station located at about the same geomagnetic latitude, but to the south of the equator. By comparing the behaviors of the lower E-region radar echoes of the summer months between Gadanki and Piura, we find that the lower altitude echoes below about 100km are rarely reported in Piura but commonly seen in Gadanki. Features of the nighttime echoes observed by these two radars are quite similar but daytime FAI echoes are again seldom detected by Piura.
Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3
Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.
2004-01-01
The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland
47 CFR 80.911 - VHF transmitter.
2010-10-01
... resistance when operated with a primary supply voltage of 13.6 volts DC. (d) When an individual demonstration... paragraph must be met as follows: (1) Measurements of primary supply voltage and transmitter output power must be made with the equipment drawing energy only from ship's battery; (2) The primary supply voltage...
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
The research and development project is implemented for the amorphous/microcrystalline solar cells with the thin microcrystalline silicon film as the i layer, and the FY 1999 results are reported. The fabrication technologies are investigated for the microcrystalline silicon solar cells of pin or nip structure by RF or VHF plasma CVD using SiH{sub 4} and H{sub 2} as the stock gases. The tests are conducted for evaluating characteristics of the thin microcrystalline silicon film, to investigate the effects of film-making pressure, power and hydrogen dilution rate on the characteristics at a constant film-making temperature of 180 degrees C. The researches on the fabrication technologies for the microcrystalline solar cell of pin structure confirm that use of VHF plasma CVD improves crystallinity, electrical and optical characteristics of the p-type thin microcrystalline silicon film. The researches on the fabrication technologies for the microcrystalline solar cell of nip structure covers transparent substrates, film-making speed of the p layer, power and substrates, and a conversion efficiency of 7.5% is realized by the solar cell formed on a texture substrate. (NEDO)
Command and Service Module Communications
Interbartolo, Michael
2009-01-01
This viewgraph presentation examines Command and Service Module (CSM) Communications. The communication system's capabilities are defined, including CSM-Earth, CSM-Lunar Module and CSM-Extravehicular crewman communications. An overview is provided for S-band communications, including data transmission and receiving rates, operating frequencies and major system components (pre-modulation processors, unified S-band electronics, S-band power amplifier and S-band antennas). Additionally, data transmission rates, operating frequencies and the capabilities of VHF communications are described. Major VHF components, including transmitters and receivers, and the VHF multiplexer and antennas are also highlighted. Finally, communications during pre-launch, ascent, in-flight and entry are discussed. Overall, the CSM communication system was rated highly by flight controllers and crew. The system was mostly autonomous for both crew and flight controllers and no major issues were encountered during flight.
Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest
Directory of Open Access Journals (Sweden)
R. P. Singh
2004-09-01
Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.
International Nuclear Information System (INIS)
Nelson, O.R.
1984-01-01
Equatorial ionospheric irregularity distribution morphology, and dynamics, and the dynamics of the ambient ionosphere were investigated. Spread F data from ionograms over Fortaleza (4 0 S; 38 0 O) and Cachoeira Paulista (22,7 0 S; 45 0 O), and simultaneous VHF scintillations of geoestationary satellite beacon received over Natal (5,6 0 S; 33,7 0 O) were used to determine the irregularity local time versus seasonal distribution, over the equatorial and low latitude location, during the solar activity maximum as well as minimum epochs. Concept of flux tube alignment properties of the transequatorial plasma bubbles were used to determine statistical features of the plasma bubble rise velocities. Calculations of plasma bubble rise velocities were then carried out for different solar activity epochs and compared with prereversal enhancement amplitude in the F-layer vertical rise velocities, for the same epochs. Using theoretical considerations on the development of plasma bubble based on flux tube integrated properties, the observed dependence of the plasma bubble rise velocities and the F-region dynamo electric field has been analysed to estimate the average ionizations depletions in the plasma bubble. Possible causes for the lack of correlation often observed between bubble rise velocities and F-Layer velocities also are discussed. (Author) [pt
Directory of Open Access Journals (Sweden)
B. A. Shand
Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.
Directory of Open Access Journals (Sweden)
B. A. Shand
1996-08-01
Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-02-22
The Southwestern Federal Power System encompasses the operation of 24 hydroelectric power plants by the U.S. Army Corps of Engineers and the marketing of power and energy from those plants by the Southwestern Power Administration of the U.S. Department of Energy. To integrate the operation of these hydroelectric generating plants and to transmit power from the dams to its customers, Southwestern Power Administration (Southwestern) maintains 2,220 kilometers (1,380 miles) of high-voltage transmission lines, 24 substations, and 46 microwave and VHF radio sites. Southwestern`s headquarters are in Tulsa, Oklahoma; its dispatch center is in Springfield, Missouri; and its maintenance crews are based in Jonesboro, Arkansas, in Gore and Tupelo, Oklahoma, and in Springfield, Missouri. Three offices - Power Marketing and Delivery, Maintenance, and Administration and Rates - are responsible for meeting Southwestern`s mission. Twelve of the 24 generating plants are scheduled directly by Southwestern, and a total of 19 contribute to the interconnected system operations. Generation at the five remaining projects (Denison, Narrows, Sam Rayburn, Whitney, and Willis) is used to serve specific customer loads. At the end of fiscal year 1995, Southwestern marketed power and energy to 10 generation and transmission cooperatives, one distribution cooperative, three military installations, 44 municipal utilities, and three municipal utility joint-action agencies. One of the joint-action agencies has its own allocation of power from Southwestern; the other two serve 33 municipal utilities to whom Southwestern has allocated power. The total number of power allocation customers is 92. Additionally, excess energy is occasionally sold to non-allocation utilities.
Online calibration of high-frequency partial discharge signals in three-phase belted power cables
Wouters, P.A.A.F.
2005-01-01
Partial discharge (PD) magnitudes from classical detection techniques are expressed in terms of apparent charges. Signals from HF/VHF/UHF techniques on substation components are often hard to express in this quantity because of complex signal excitation and propagation channels. A method to
47 CFR 22.905 - Channels for cellular service.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Channels for cellular service. 22.905 Section... MOBILE SERVICES Cellular Radiotelephone Service § 22.905 Channels for cellular service. The following frequency bands are allocated for assignment to service providers in the Cellular Radiotelephone Service. (a...
47 CFR 80.268 - Technical requirements for radiotelephone installation.
2010-10-01
... a visual indication whenever the transmitter is supplying power to the antenna. (4) Have a two-tone... between masts or other supports subject to whipping, a safety link must be installed which under heavy stress will reduce breakage of the antenna, the halyards, or any other supporting elements. (d) The...
Kim, Yongha; Kim, Jeong-Han; Jee, Geonwha; Lee, Chang-Sup
2010-05-01
A VHF radar at King Sejong Station, Antarctica has been measuring meteor echoes since March 2007. Temperatures near the mesopause are derived from meteor decay times with an improved method of selecting meteor echo samples, and compared with airglow temperatures simultaneously observed by a spectral airglow temperature imager (SATI). The temperatures derived from meteor decay times are mostly consistent with the rotational temperatures of SATI OH(6-2) and O2(0-1) emissions from March through October. During southern summer when SATI cannot be operated due to brief night time, the meteor radar observation shows cold mesospheric temperatures, significantly lower than the CIRA86 model. The meteor radar observation also provides wind field information between 80 and 100 km of altitude. The measured meridional winds seem to follow the summer pole to winter pole circulation, and thus are correlated with the measured seasonal temperature change. However, the correlation between meridional winds and temperatures is not found in day by day base, as a previous study reported. Tidal characteristics of both zonal and meridional winds will also be compared with those of other Antarctic stations.
Low-Profile Multiband and Flush-Mountable Wideband Antennas for HF/VHF and K/Ka Band Applications
Garrido Lopez, David
This thesis introduces several novel antenna systems with extended performance capabilities achieved by either enabling multiple operation bands or by widening the bandwidth. Proposed theoretical concepts are successfully tested through simulations and experiments with excellent agreement are demonstrated. The designs developed in this thesis research are low-profile or flush mountable, enabling simple platform integration. In the HF/VHF bands, the development of a novel low-profile multiband antenna for vehicular applications is presented. Specifically, an inverted-F antenna is used as a driven element, to operate at the lowest frequency of 27 MHz, whereas two parasitic elements are built as inverted-L monopoles to enable resonances at 49 and 53 MHz. To eliminate the need for an external matching network, an offset feeding technique is used. When the antenna is mounted on a vehicle and bent to follow its profile, a very low-profile is achieved (lambda/44) while good impedance and far-field performance are maintained across all three bands. The developed antenna system is not only electrically smallest among others found in the literature, but it is easily modified for other band selections and tuning of each band can be readily achieved. Vehicular antennas are often used for high power applications, which may cause exposure of nearby individuals to possibly dangerous electromagnetic fields. To assess this hazard, the RF exposure of a vehicle's crew is discussed and an original and fast modeling approach for prediction thereof is demonstrated. The modeling approach is based on eigenmode analysis for acquiring a range of frequencies where the shielding effectiveness of a vehicle cabin is expected to be lower than average. This approach is typically much faster and requires less computational resources as compared to classical full-wave analyses. This analysis also shows that the position of an antenna system is critical and must be considered when high-power RF
Photoswitchable Dihydroazulene Macrocycles for Solar Energy Storage: The Effects of Ring Strain.
Vlasceanu, Alexandru; Frandsen, Benjamin N; Skov, Anders B; Hansen, Anne Schou; Rasmussen, Mads Georg; Kjaergaard, Henrik G; Mikkelsen, Kurt V; Nielsen, Mogens Brøndsted
2017-10-06
Efficient energy storage and release are two major challenges of solar energy harvesting technologies. The development of molecular solar thermal systems presents one approach to address these issues by tuning the isomerization reactions of photo/thermoswitches. Here we show that the incorporation of photoswitches into macrocyclic structures is a particularly attractive solution for increasing the storage time. We present the synthesis and properties of a series of macrocycles incorporating two dihydroazulene (DHA) photoswitching subunits, bridged by linkers of varying chain length. Independent of ring size, all macrocycles exhibit stepwise, light-induced, ring-opening reactions (DHA-DHA to DHA-VHF to VHF-VHF; VHF = vinylheptafulvene) with the first DHA undergoing isomerization with a similar efficiency as the uncyclized parent system while the second (DHA-VHF to VHF-VHF) is significantly slower. The energy-releasing, VHF-to-DHA, ring closures also occur in a stepwise manner and are systematically found to proceed slower in the more strained (smaller) cycles, but in all cases with a remarkably slow conversion of the second VHF to DHA. We managed to increase the half-life of the second VHF-to-DHA conversion from 65 to 202 h at room temperature by simply decreasing the ring size. A computational study reveals the smallest macrocycle to have the most energetic VHF-VHF state and hence highest energy density.
A study on multifrequency scintillations near the EIA crest of the Indian zone
Chakraborty, S. K.; Chatterjee, S.; Jana, Debasis
2017-10-01
Occurrence features of ionospheric scintillations at S band (2492.028 MHz) are reported for the first time. The same have been explored in the context of scintillations at VHF (250.650 MHz) and L5 (1176.45 MHz) bands. Observations were carried out during the period April-December, 2015 at Raja Peary Mohan College Centre (RPMC: 22.66° N, 88.4° E), located near the equatorial ionization anomaly (EIA) crest of the Indian longitude zone. Mostly weak (<10 dB), short duration, slow fading rate with shallower slope power spectra characterize the S band scintillations compared to VHF and L5 band. In the severe scintillation conditions of VHF frequent loss of lock in L5 channel is reflected. Fade depth of 4.2 ± 1.3 dB and fade rate ∼9 fades/minute at S band mostly precede the loss of lock at L5 channel. A good correspondence between fade rates at multi frequency band is reflected irrespective of phases of scintillation. Spectral analysis reveals weak scattering is the dominating mechanism for scintillation at S band while VHF and L5 band scintillations are mostly attributed to multiple scattering. The estimated threshold coherence length of <23 m at VHF may be suggested to be a good indicator for occurrence of L5 and S band scintillations. Occurrence of simultaneous multi-satellite multi-frequency scintillations leads to speculation over the failsafe navigation using available IRNSS constellation. The results are discussed in terms of existing theory of evolution, structure and dynamics of electron density irregularities in the low latitude region.
A no-tune no-match wideband probe for nuclear quadrupole resonance spectroscopy in the VHF range
Scharfetter, Hermann; Petrovic, Andreas; Eggenhofer, Heidi; Stollberger, Rudolf
2014-12-01
Nuclear quadrupole resonance (NQR) spectroscopy is a method for the characterization of chemical compounds containing so-called quadrupolar nuclei. Similar to nuclear magnetic resonance (NMR), the sample under investigation is irradiated with strong radiofrequency (RF) pulses, which stimulate the emission of weak RF signals from the quadrupolar nuclei. The signals are then amplified and Fourier transformed so as to obtain a spectrum. In principle, narrowband NQR spectra can be measured with NMR spectrometers. However, pure NQR signals require the absence of a static magnetic field and several special applications require the characterization of a substance over a large bandwidth, e.g. 50-100% of the central frequency, which is hardly possible with standard NMR equipment. Dedicated zero-field NQR equipment is not widespread and current concepts employ resonating probes which are tuned and matched over a wide range by using mechanical capacitors driven by stepper motors. While providing the highest signal to noise ratio (SNR) such probes are slow in operation and can only be operated from dedicated NMR consoles. We developed a low-cost NQR wideband probe without tuning and matching for applications in the very high frequency (VHF) range below 300 MHz. The probe coil was realized as part of a reactive network which approximates an exponential transmission line. The input reflection coefficient of the two developed prototype probe coils is ≤ 20 dB between 90-145 MHz and 74.5-99.5 MHz, respectively. Two wideband NQR spectra of published test substances were acquired with an SNR of better than 20 dB after sufficient averaging. The measured signals and the SNR correspond very well to the theoretically expected values and demonstrate the feasibility of the method. Because there is no need for tuning and matching, our probes can be operated easily from any available NMR console.
2011-10-07
... a designated representative via VHF radio on channel 16. The Coast Guard will provide notice of the... effects, distributive impacts, and equity). Executive Order 13563 emphasizes the importance of quantifying... Government and Indian Tribes, or on the distribution of power and responsibilities between the Federal...
77 FR 14965 - Special Local Regulations; Red Bull Candola, New River, Fort Lauderdale, FL
2012-03-14
... designated representative via VHF radio on channel 16, to request authorization. If authorization to enter... equity). Executive Order 13563 emphasizes the importance of quantifying both costs and benefits, of... relationship between the national government and the States, or on the distribution of power and...
Lu, Yi; Kondo, Hiroki; Ishikawa, Kenji; Oda, Osamu; Takeda, Keigo; Sekine, Makoto; Amano, Hiroshi; Hori, Masaru
2014-04-01
Gallium nitride (GaN) films have been grown by using our newly developed Radical-Enhanced Metalorganic Chemical Vapor Deposition (REMOCVD) system. This system has three features: (1) application of very high frequency (60 MHz) power in order to increase the plasma density, (2) introduction of H2 gas together with N2 gas in the plasma discharge region to generate not only nitrogen radicals but also active NHx molecules, and (3) radical supply under remote plasma arrangement with suppression of charged ions and photons by employing a Faraday cage. Using this new system, we have studied the effect of the trimethylgallium (TMG) source flow rate and of the plasma generation power on the GaN crystal quality by using scanning electron microscopy (SEM) and double crystal X-ray diffraction (XRD). We found that this REMOCVD allowed the growth of epitaxial GaN films of the wurtzite structure of (0001) orientation on sapphire substrates with a high growth rate of 0.42 μm/h at a low temperature of 800 °C. The present REMOCVD is a promising method for GaN growth at relatively low temperature and without using costly ammonia gas.
DEFF Research Database (Denmark)
Pedersen, Jeppe Arnsdorf; Madsen, Mickey Pierre; Mønster, Jakob Døllner
2016-01-01
This paper describes a Very High Frequency (VHF) converter made with three Class-E inverters and a single ClassDE rectifier. The converter is designed for the US mains (120 V, 60 Hz) and can deliver 9 W to a 60 V LED. The converter has a switching frequency of 37 MHz and achieves an efficiency...
77 FR 19934 - Special Local Regulations; Charleston Race Week, Charleston Harbor, Charleston, SC
2012-04-03
... telephone at (843)740- 7050, or a designated representative via VHF radio on channel 16, to request... Order 13563 emphasizes the importance of quantifying both costs and benefits, of reducing costs, of... the States, or on the distribution of power and responsibilities among the various levels of...
76 FR 79571 - Special Local Regulations; Patriot Challenge Kayak Race, Ashley River, Charleston, SC
2011-12-22
... (843) 740-7050, or a designated representative via VHF radio on channel 16. If authorization to enter..., distributive impacts, and equity). Executive Order 13563 emphasizes the importance of quantifying both costs... distribution of power and responsibilities between the Federal Government and Indian Tribes. Energy Effects We...
2012-06-25
... telephone at (843) 740-7050, or a designated representative via VHF radio on channel 16 to seek... Order 13563 emphasizes the importance of quantifying both costs and benefits, of reducing costs, of... Government and Indian Tribes, or on the distribution of power and responsibilities between the Federal...
77 FR 21446 - Safety Zone; Volvo Ocean Racing Youth Regatta, Biscayne Bay, Miami, FL
2012-04-10
... telephone at (305) 535-4472, or a designated representative via VHF radio on channel 16, to request... emphasizes the importance of quantifying both costs and benefits, of reducing costs, of harmonizing rules... Government and Indian Tribes, or on the distribution of power and responsibilities between the Federal...
Kim, Ki Seok; Kim, Ki Hyun; Ji, You Jin; Park, Jin Woo; Shin, Jae Hee; Ellingboe, Albert Rogers; Yeom, Geun Young
2017-10-19
Depositing a barrier film for moisture protection without damage at a low temperature is one of the most important steps for organic-based electronic devices. In this study, the authors investigated depositing thin, high-quality SiN x film on organic-based electronic devices, specifically, very high-frequency (162 MHz) plasma-enhanced chemical vapor deposition (VHF-PECVD) using a multi-tile push-pull plasma source with a gas mixture of NH 3 /SiH 4 at a low temperature of 80 °C. The thin deposited SiN x film exhibited excellent properties in the stoichiometry, chemical bonding, stress, and step coverage. Thin film quality and plasma damage were investigated by the water vapor transmission rate (WVTR) and by electrical characteristics of organic light-emitting diode (OLED) devices deposited with SiN x , respectively. The thin deposited SiN x film exhibited a low WVTR of 4.39 × 10 -4 g (m 2 · day) -1 for a single thin (430 nm thick) film SiN x and the electrical characteristics of OLED devices before and after the thin SiN x film deposition on the devices did not change, which indicated no electrical damage during the deposition of SiN x on the OLED device.
A survey of the urban radiofrequency (RF) environment
International Nuclear Information System (INIS)
Tell, Richard A.; Kavet, Robert
2014-01-01
In 1980, Tell and Mantiply published a study of radiofrequency (RF) fields measured across 15 major metropolitan areas in the USA. They required a van fully equipped with instrumentation and computing capability for their measurements. This study aimed to assess whether and how hand-held instrumentation available today would facilitate and enhance the efficiency of large-scale surveys of ambient RF fields. In addition, the data would provide a suggestion as to how the profile of ambient RF fields has changed with respect to frequency content and magnitude. Not unexpectedly, the relative power densities were orders of magnitude lower than the Federal Communications Commission's (FCC) maximum permissible exposure (MPE) for the general public, with a maximum time-averaged value across the VHF-FM-UHF-cellular bands of 0.12 % of the MPE (AM's contribution was negligible). In both the 1980 and the present study, the power density in the FM band was a major contributor to overall power density, but over time, power densities in the VHF and UHF band decreased and increased, respectively. From the perspective of absolute power density, the wideband values in the 1980 study, this study and any number of assessments conducted in European nations are not generally different from one another. (authors)
Kim, Yongha; Kim, Jeong-Han; Lee, Changsup; Jee, Gun-Hwa
A VHF meteor radar, installed at King Sejong Station in March, 2007, has been detecting echoes from more than 20,000 meteors per day. Meteor echoes are decayed typically within seconds as meteors spread away by atmospheric diffusion. The diffusion coefficients can thus be obtained from decay times of meteor echo signals, providing with information on the atmospheric temperatures and pressures at meteor altitudes from 70 to 100 km. In this study, we present altitude profiles of 15-min averaged diffusion coefficients in each month, which clearly show a minimum at 80 - 85 km. The minimum appears at higher altitude during austral summer than winter, and seems to be near the lower level of two temperature minimum structure around the mesopause seen by TIMED/SABER data at high latitudes. The higher mesopause level (95-100 km) of the SABER data does not appear in our diffusion profiles probably because it is too close the limit of meaningful diffusion coefficients that can be derived from meteor decay detection. In order to understand temperature variation around the mesopause more directly, we will discuss various methods to extract temperature profiles from the diffusion profiles. We will also present monthly averaged OH and O2 airglow temperatures observed at the same site, and compare them with those derived from the meteor radar observation.
2012-04-24
... (843) 740-7050, or a designated representative via VHF radio on channel 16. If authorization to enter... Order 13563 emphasizes the importance of quantifying both costs and benefits, of reducing costs, of... government and the States, or on the distribution of power and responsibilities among the various levels of...
77 FR 15258 - Special Local Regulations; Patriot Challenge Kayak Race, Ashley River, Charleston, SC
2012-03-15
... telephone at (843) 740-7050, or a designated representative via VHF radio on channel 16. If authorization to..., distributive impacts, and equity). Executive Order 13563 emphasizes the importance of quantifying both costs... the relationship between the national government and the States, or on the distribution of power and...
2013-04-15
... Championship. On June 1, 2013, Game One Sports Marketing Group is hosting the West Palm Beach Triathlon... VHF radio on channel 16, to request authorization. If authorization to enter, transit through, anchor... government and the States, or on the distribution of power and responsibilities among the various levels of...
Directory of Open Access Journals (Sweden)
A. Serafimovich
2005-01-01
Full Text Available A case study to investigate the properties of inertia-gravity waves in the upper troposphere/lower stratosphere has been carried out over Northern Germany during the occurrence of an upper tropospheric jet in connection with a poleward Rossby wave breaking event from 17-19 December 1999. The investigations are based on the evaluation of continuous radar measurements with the OSWIN VHF radar at Kühlungsborn (54.1 N, 11.8 E and the 482 MHz UHF wind profiler at Lindenberg (52.2 N, 14.1 E. Both radars are separated by about 265 km. Based on wavelet transformations of both data sets, the dominant vertical wavelengths of about 2-4 km for fixed times as well as the dominant observed periods of about 11 h and weaker oscillations with periods of 6 h for the altitude range between 5 and 8 km are comparable. Gravity wave parameters have been estimated at both locations separately and by a complex cross-spectral analysis of the data of both radars. The results show the appearance of dominating inertia-gravity waves with characteristic horizontal wavelengths of 300 km moving in the opposite direction than the mean background wind and a secondary less pronounced wave with a horizontal wavelength in the order of about 200 km moving with the wind. Temporal and spatial differences of the observed waves are discussed.
Directory of Open Access Journals (Sweden)
María del Pilar Celemín
2007-06-01
Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to
Frequency effects in silane plasmas for PECVD
International Nuclear Information System (INIS)
Howling, A.A.; Dorier, J.L.; Hollenstein, C.; Finger, F.; Kroll, U.
1991-09-01
It is generally recognised that the excitation frequency is an important parameter in rf plasma-assisted deposition. VHF silane plasmas (50-100 MHz) have been shown to produce high quality amorphous silicon films up to 20 A/s, and therefore the aim of this work is to compare the VHF range with the 13.56 MHz industrial frequency in the same reactor. The principal diagnostics used are electrical measurements and a CCD camera for spatially-resolved plasma-induced emission with Abel inversion of the plasma image. We present a comparative study of key discharge parameters such as deposition rates, plasma uniformity, ion impact energy, power transfer efficiency and powder formation for the rf range 13-70 MHz. (author) 5 figs., 19 refs
Lewis acid enhanced switching of the 1,1-dicyanodihydroazulene/vinylheptafulvene photo/thermoswitch
DEFF Research Database (Denmark)
Parker, Christian Richard; Tortzen, Christian Gregers; Broman, Søren Lindbæk
2011-01-01
Mild Lewis acids enhance the rate of the thermal conversion of vinylheptafulvene (VHF) to dihydroazulene (DHA). In the absence of light, stronger Lewis acids promote the otherwise photoinduced DHA to VHF conversion.......Mild Lewis acids enhance the rate of the thermal conversion of vinylheptafulvene (VHF) to dihydroazulene (DHA). In the absence of light, stronger Lewis acids promote the otherwise photoinduced DHA to VHF conversion....
2011-05-06
... the repairs. Because of the vital importance of the repairs to Logan Airport, and the safety zone... designated on scene representative may be contacted via VHF Channel 16 or by telephone at (617) 223-5750... relationship between the Federal Government and Indian tribes, or on the distribution of power and...
2013-01-15
.... Discussion of Proposed Rule On June 1, 2013, Game One Sports Marketing Group is hosting the West Palm Beach... representative via VHF radio on channel 16, to request authorization. If authorization to enter, transit through... between the national government and the States, or on the distribution of power and responsibilities among...
Metabolic impacts of high dietary exposure to persistent organic pollutants in mice
DEFF Research Database (Denmark)
Ibrahim, Mohammad Madani; Fjære, Even; Lock, Erik-Jan
2012-01-01
Persistent organic pollutants (POPs) have been linked to metabolic diseases. Yet, the effects of high exposure to dietary POPs remain unclear. We therefore investigated whether elevated exposure to POPs provided by whale meat supplementation could contribute to insulin resistance. C57BL/6J mice...... were fed control (C) or very high-fat diet (VHF) containing low or high levels of POPs (VHF+POPs) for eight weeks. To elevate the dietary concentrations of POPs, casein was replaced by whale meat containing high levels of pollutants. Feeding VHF+POPs induced high POP accumulation in the adipose tissue...... of mice. However, compared with VHF-fed mice, animals fed VHF+POPs had improved insulin sensitivity and glucose tolerance, and reduced body weight. Levels of ectopic fat in skeletal muscles and liver were reduced in mice fed VHF+POPs. These mice also gained less adipose tissue and had a tendency...
Directory of Open Access Journals (Sweden)
Mohammad Madani Ibrahim
Full Text Available BACKGROUND: Dietary interventions are critical in the prevention of metabolic diseases. Yet, the effects of fatty fish consumption on type 2 diabetes remain unclear. The aim of this study was to investigate whether a diet containing farmed salmon prevents or contributes to insulin resistance in mice. METHODOLOGY/PRINCIPAL FINDINGS: Adult male C57BL/6J mice were fed control diet (C, a very high-fat diet without or with farmed Atlantic salmon fillet (VHF and VHF/S, respectively, and Western diet without or with farmed Atlantic salmon fillet (WD and WD/S, respectively. Other mice were fed VHF containing farmed salmon fillet with reduced concentrations of persistent organic pollutants (VHF/S(-POPs. We assessed body weight gain, fat mass, insulin sensitivity, glucose tolerance, ex vivo muscle glucose uptake, performed histology and immunohistochemistry analysis, and investigated gene and protein expression. In comparison with animals fed VHF and WD, consumption of both VHF/S and WD/S exaggerated insulin resistance, visceral obesity, and glucose intolerance. In addition, the ability of insulin to stimulate Akt phosphorylation and muscle glucose uptake was impaired in mice fed farmed salmon. Relative to VHF/S-fed mice, animals fed VHF/S(-POPs had less body burdens of POPs, accumulated less visceral fat, and had reduced mRNA levels of TNFα as well as macrophage infiltration in adipose tissue. VHF/S(-POPs-fed mice further exhibited better insulin sensitivity and glucose tolerance than mice fed VHF/S. CONCLUSIONS/SIGNIFICANCE: Our data indicate that intake of farmed salmon fillet contributes to several metabolic disorders linked to type 2 diabetes and obesity, and suggest a role of POPs in these deleterious effects. Overall, these findings may participate to improve nutritional strategies for the prevention and therapy of insulin resistance.
Directory of Open Access Journals (Sweden)
J. G. Yoe
Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.
The Mitigation of Radio Noise from External Sources at Receiving Sites
2007-05-01
53 3.1.7 Underground Distribution Lines...available newer models were preferred for laboratory measurements of time- stable signals and noise. 9 An ELF Engineering Model 7200B 3-Axis... communications terminal was located about 1 km from an HF and VHF receiving site. The satellite terminal was equipped with an Uninterruptible Power Supply (UPS
Thermoacoustic contrast of prostate cancer due to heating by very high frequency irradiation
International Nuclear Information System (INIS)
Patch, S K; Hull, D; Thomas, M; Jacobsohn, K; See, WA; Griep, SK
2015-01-01
Applying the thermoacoustic (TA) effect to diagnostic imaging was first proposed in the 1980s. The object under test is irradiated by high-power pulses of electromagnetic energy, which heat tissue and cause thermal expansion. Outgoing TA pressure pulses are detected by ultrasound transducers and reconstructed to provide images of the object. The TA contrast mechanism is strongly dependent upon the frequency of the irradiating electromagnetic pulse. When very high frequency (VHF) electromagnetic irradiation is utilized, TA signal production is driven by ionic content. Prostatic fluids contain high levels of ionic metabolites, including citrate, zinc, calcium, and magnesium. Healthy prostate glands produce more ionic metabolites than diseased glands. VHF pulses are therefore expected to generate stronger TA signal in healthy prostate glands than in diseased glands. A benchtop system for performing ex vivo TA computed tomography with VHF energy is described and images are presented. The system utilizes irradiation pulses of 700 ns duration exceeding 20 kW power. Reconstructions frequently visualize anatomic landmarks such as the urethra and verumontanum. TA reconstructions from three freshly excised human prostate glands with little, moderate, and severe cancerous involvement are compared with histology. TA signal strength is negatively correlated with percent cancerous involvement in this small sample size. For the 45 regions of interest analyzed, a reconstruction value of 0.4 mV provides 100% sensitivity but only 29% specificity. This sample size is far too small to draw sweeping conclusions, but the results warrant a larger volume study including comparison of TA images to the gold standard, histology. (paper)
2013-05-01
ground-based all-sky imagers that support the NASA THEMIS mission. Magnetometers at HAARP • Fluxgate magnetometer . This instrument is part of the...while others are owned by PI institutions and supported by the HAARP program. These diagnostic instruments include magnetometers , riometers, an...Ionosonde • HF/VHF Radars • Optical Photometer • Magnetometers ULF/ELF/VLF Receivers Striations Geomagnetic Field Artificial Ionized Layer Optical
Kim, Y.; Lee, C.; Kim, J.; Jee, G.
2013-12-01
For the first time, vertical winds near the mesopause region were estimated from radial velocities of meteor echoes detected by a VHF meteor radar at King Sejong Station (KSS) in 2011 and 2012. Since the radar usually detects more than a hundred echoes every hour in an altitude bin of 88 - 92 km, much larger than other radars, we were able to fit measured radial velocities of these echoes with a 6 component model that consists of horizontal winds, spatial gradients of horizontal winds and vertical wind. The conventional method of deriving horizontal winds from meteor echoes utilizes a 2 component model, assuming that vertical winds and spatial gradients of horizontal winds are negligible. We analyzed the radar data obtained for 8400 hours in 2012 and 8100 hours in 2011. We found that daily mean values of vertical winds are mostly within +/- 1 m/s, whereas those of zonal winds are a few tens m/s mostly eastward. The daily mean vertical winds sometimes stay positive or negative for more than 20 days, implying that the atmosphere near the mesopause experiences episodically a large scale low and high pressure environments, respectively, like the tropospheric weather system. By conducting Lomb-normalized periodogram analysis, we also found that the vertical winds have diurnal, semidiurnal and terdiurnal tidal components with about equal significance, in contrast to horizontal winds that show a dominant semidiurnal one. We will discuss about uncertainties of the estimated vertical wind and possible reasons of its tidal and daily variations.
Directory of Open Access Journals (Sweden)
A. R. Jain
Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence
SPEED IS LIFE: WHY MACH and MANEUVERABILITY DOMINATE IN 2030
2016-06-01
enable F-X1. For instance, Mr. Stillion portrays a networked unit of UCAV aircraft, where F-X1 is the command node for the formation and the UCAVs act...www.ausairpower.net/ APA -S-400-Triumf.html. 6 Ibid. 7 Guy Plopsky & Fabrizio Bozzato, “The F-35 vs. The VHF Threat” The Diplomat, 21 Aug 2014, http...Carlo Kopp, “Sukhoi Flankers, The Shifting Balance of Regional Air Power,” Air Power Australia, 27 Jan 2014, http://www.ausairpower.net/ APA
Immunological features underlying viral hemorrhagic fevers.
Messaoudi, Ilhem; Basler, Christopher F
2015-10-01
Several enveloped RNA viruses of the arenavirus, bunyavirus, filovirus and flavivirus families are associated with a syndrome known as viral hemorrhagic fever (VHF). VHF is characterized by fever, vascular leakage, coagulation defects and multi organ system failure. VHF is currently viewed as a disease precipitated by viral suppression of innate immunity, which promotes systemic virus replication and excessive proinflammatory cytokine responses that trigger the manifestations of severe disease. However, the mechanisms by which immune dysregulation contributes to disease remain poorly understood. Infection of nonhuman primates closely recapitulates human VHF, notably Ebola and yellow fever, thereby providing excellent models to better define the immunological basis for this syndrome. Here we review the current state of our knowledge and suggest future directions that will better define the immunological mechanisms underlying VHF. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Utlaut, W.F.
1975-01-01
When the ionized upper atmosphere of the earth is illuminated by high-power HF radio waves at appropriate frequencies, the temperature of electrons in the ionosphere can be raised substantially. In addition, radio waves with sufficient energy cause parametric instabilities that generate a spectrum of intense plasma waves. Observations of these phenomena have produced new understanding of plasma processes. One consequence of heating and plasma wave generation is that irregularities are formed in the electron distribution which are aligned with the earth's magnetic field. Because of this, a scatterer of large radar cross section is produced, which scatters HF through UHF communication signals over long distance paths, that would not otherwise be normally possible by ionospheric means. Results of radio, radar, communication, and photometric experiments that explored the characteristics of the volume of ionosphere which has been intentionally modified, temporarily, above facilities near Boulder (Platteville), Colo., and at Arecibo, Puerto Rico are summarized
Portable gamma-ray detection system for location of radioactive sources
International Nuclear Information System (INIS)
Worth, G.M.; Henery, C.N.; Hastings, R.D.; France, S.W.
1976-01-01
A portable, battery-powered gamma radiation detection system, the RBM 1100 Road Block Monitor, is described. The detector is a 12.7-cm diameter by 2.54-cm thick NaI(Tl) integral assembly, housed in a weatherproof, insulated case with high and low voltage batteries, amplifier, lower level discriminator, low power CMOS logic electronics, and a VHF FM transmitter. Alarms indicating the presence of radioactive material are generated by a logic system that periodically stores a trip level based on an average background plus an internally calculated standard deviation. The operator may select the optimum counting time, the trip level in numbers of standard deviations above the average background, the background updating mode, and the method of alarm annunciation. Alarms may be indicated locally by panel indication and/or audible tone, or remotely via a VHF FM transmitter with a maximum range of 1.6-km line-of-sight to a suitable receiver. Count rate may be read on a top panel meter or recorded on a chart recorder. A single frame camera may be attached to provide a photographic record. Battery lifetime is 100 to 300 hours, depending on alarm rate and use of the transmitter
Results of tests of the X2274 high power tetrode in a JT-60 110 to 130 MHz ICRH amplifier
International Nuclear Information System (INIS)
Remsen, D.B.; Loring, C.M.; McNees, S.G.; Moriyama, S.; Ogawa, Y.; Anno, K.; Fujii, T.; Terakado, M.; Kogure, S.; Nagashima, T.; Ohta, M.
1990-09-01
This paper reports the results of tests of the newly developed Varian EIMAC X2274 in the JAERI JT-60 ICRH system at pulse lengths up to 6 seconds at 131 MHz. It is our belief that these tests achieved the highest long pulse, or CW, power that has ever been delivered by a single power grid tube at frequencies above 100 MHz. Varian's EIMAC X2274, developed in conjunction with General Atomics and the US Department of Energy, uses an improved pyrolytic graphite grid configuration which provides significantly better vhf performance than the grids of the X2242 tetrode which was tested in this system in 1989. The EIMAC X2274 combines the improved grids with a new anode design which reduces the required water flow approximately 50% and increases the maximum anode dissipation 80%. All tests were performed at 131 MHz, the system's highest operating frequency. Tests of both prototype EIMAC X2274s produced essentially identical results. The basic objectives of these tests were: to demonstrate that the system with the EIMAC X2274 can reliably produce 1.5 MW at 130 MHz at 5 second pulse lengths for the JT-60U tokamak and to collect data for use in the design of future high power ICRH systems. In these tests the tube and system produced up to 1.7 MW at pulse lengths up to 5.4 seconds: i.e, the EIMAC X2274 in this system can easily meet Objective 1. The remainder of this paper shows that Objective 2 has been fulfilled. In addition to the high power tests, operational range tests were performed under variable VSWR conditions. Unlike the EIMAC X2242 tests were rf current heating of the screen grid limited output power, system parameters, rather than tube parameters, limited the output power in the high power tests. Operational range tests were conducted at output power levels chosen to be well within the system's anode cooling capability
Tombak, Ali
The recent advancement in wireless communications demands an ever increasing improvement in the system performance and functionality with a reduced size and cost. This thesis demonstrates novel RF and microwave components based on ferroelectric and solid-state based tunable capacitor (varactor) technologies for the design of low-cost, small-size and multi-functional wireless communication systems. These include tunable lumped element VHF filters based on ferroelectric varactors, a beam-steering technique which, unlike conventional systems, does not require separate power divider and phase shifters, and a predistortion linearization technique that uses a varactor based tunable R-L-C resonator. Among various ferroelectric materials, Barium Strontium Titanate (BST) is actively being studied for the fabrication of high performance varactors at RF and microwave frequencies. BST based tunable capacitors are presented with typical tunabilities of 4.2:1 with the application of 5 to 10 V DC bias voltages and typical loss tangents in the range of 0.003--0.009 at VHF frequencies. Tunable lumped element lowpass and bandpass VHF filters based on BST varactors are also demonstrated with tunabilities of 40% and 57%, respectively. A new beam-steering technique is developed based on the extended resonance power dividing technique. Phased arrays based on this technique do not require separate power divider and phase shifters. Instead, the power division and phase shifting circuits are combined into a single circuit, which utilizes tunable capacitors. This results in a substantial reduction in the circuit complexity and cost. Phased arrays based on this technique can be employed in mobile multimedia services and automotive collision avoidance radars. A 2-GHz 4-antenna and a 10-GHz 8-antenna extended resonance phased arrays are demonstrated with scan ranges of 20 degrees and 18 degrees, respectively. A new predistortion linearization technique for the linearization of RF
Directory of Open Access Journals (Sweden)
S. E. Milan
2001-02-01
Full Text Available Observations of HF radar backscatter from the auroral electrojet E region indicate the presence of five major spectral populations, as opposed to the two predominant spectral populations, types I and II, observed in the VHF regime. The Doppler shift, spectral width, backscatter power, and flow angle dependencies of these five populations are investigated and described. Two of these populations are identified with type I and type II spectral classes, and hence, are thought to be generated by the two-stream and gradient drift instabilities, respectively. The remaining three populations occur over a range of velocities which can greatly exceed the ion acoustic speed, the usual limiting velocity in VHF radar observations of the E region. The generation of these spectral populations is discussed in terms of electron density gradients in the electrojet region and recent non-linear theories of E region irregularity generation.Key words. Ionosphere (ionospheric irregularities
Moghaddam, Mahta; Pierce, Leland; Tabatabaeenejad, Alireza; Rodriguez, Ernesto
2005-01-01
Knowledge of subsurface characteristics such as permittivity variations and layering structure could provide a breakthrough in many terrestrial and planetary science disciplines. For Earth science, knowledge of subsurface and subcanopy soil moisture layers can enable the estimation of vertical flow in the soil column linking surface hydrologic processes with that in the subsurface. For planetary science, determining the existence of subsurface water and ice is regarded as one of the most critical information needs for the study of the origins of the solar system. The subsurface in general can be described as several near-parallel layers with rough interfaces. Each homogenous rough layer can be defined by its average thickness, permittivity, and rms interface roughness assuming a known surface spectral distribution. As the number and depth of layers increase, the number of measurements needed to invert for the layer unknowns also increases, and deeper penetration capability would be required. To nondestructively calculate the characteristics of the rough layers, a multifrequency polarimetric radar backscattering approach can be used. One such system is that we have developed for data prototyping of the Microwave Observatory of Subcanopy and Subsurface (MOSS) mission concept. A tower-mounted radar makes backscattering measurements at VHF, UHF, and L-band frequencies. The radar is a pulsed CW system, which uses the same wideband antenna to transmit and receive the signals at all three frequencies. To focus the beam at various incidence angles within the beamwidth of the antenna, the tower is moved vertically and measurements made at each position. The signals are coherently summed to achieve focusing and image formation in the subsurface. This requires an estimate of wave velocity profiles. To solve the inverse scattering problem for subsurface velocity profile simultaneously with radar focusing, we use an iterative technique based on a forward numerical solution of
Directory of Open Access Journals (Sweden)
R. Huang
2015-01-01
Full Text Available We report on measurements and analysis of a field-emitted electron current in the very-high-frequency (VHF gun, a room temperature rf gun operating at high field and continuous wave (CW mode at the Lawrence Berkeley National Laboratory (LBNL. The VHF gun is the core of the Advanced Photo-injector Experiment (APEX at LBNL, geared toward the development of an injector for driving the next generation of high average power x-ray free electron lasers. High accelerating fields at the cathode are necessary for the high-brightness performance of an electron gun. When coupled with CW operation, such fields can generate a significant amount of field-emitted electrons that can be transported downstream the accelerator forming the so-called “dark current.” Elevated levels of a dark current can cause radiation damage, increase the heat load in the downstream cryogenic systems, and ultimately limit the overall performance and reliability of the facility. We performed systematic measurements that allowed us to characterize the field emission from the VHF gun, determine the location of the main emitters, and define an effective strategy to reduce and control the level of dark current at APEX. Furthermore, the energy spectra of isolated sources have been measured. A simple model for energy data analysis was developed that allows one to extract information on the emitter from a single energy distribution measurement.
Mortality of radio collared willow ptarmigan in Smoela wind-power plant
Energy Technology Data Exchange (ETDEWEB)
Pedersen, Hans Chr.; Broeseth, Henrik; Nilsen, Erlend B.; Sandercock, Brett K.; Bevanger, Kjetil
2011-07-01
Full text: In the project Pre- and post-construction studies of conflicts between birds and wind turbines in coastal Norway (BirdWind), Smoela willow ptarmigan (Lagopus lagopus variegatus) has been one of the species studied. This sub-species represent gallinaceous birds, known to be bad flyers susceptible to collide with artificial structures, e.g. power lines. However, the possible impact of a wind-power plant on survival and behaviour in a willow ptarmigan population was unknown. The objectives of the study were therefore rather wide; to study direct and indirect effects of wind turbines on willow ptarmigan behaviour, habitat selection, reproduction and survival in areas where wind-power plants are established. To collect data on habitat selection, movements, collision risks, avoidance behaviour, survival and general population dynamic parameters, willow ptarmigan were radio-tagged in 2008-2010, using traditional VHF-transmitters (Holohill) with mortality switch, necklace mount, 12 g, lasting for approximately 24 months. Due to low population density and only occasional snow cover, a method using strong lights, dipnet and car was used to catch birds. In total, 34 willow ptarmigan were caught (19 males and 15 females). All birds were caught inside the wind-power plant area (WPA). The birds were radio-tracked at irregular intervals and almost all birds, when found, was located within the WPA. All carcasses of dead birds were examined. When possible, cause of death was determined as; predation (raptor), collision, unknown, other. In total, 28 of the radio-tagged birds have died since January 2008. A Kaplan-Meier analysis of cumulative survival rates, show an exceptionally low survival (<30%). Unlike other willow ptarmigan populations most of the mortality takes place during winter, from December throughout March. Although a thorough analysis of mortality causes has yet not been carried out, a majority of the birds have probably been killed by avian predators and to
Directory of Open Access Journals (Sweden)
S. E. Milan
Full Text Available Observations of HF radar backscatter from the auroral electrojet E region indicate the presence of five major spectral populations, as opposed to the two predominant spectral populations, types I and II, observed in the VHF regime. The Doppler shift, spectral width, backscatter power, and flow angle dependencies of these five populations are investigated and described. Two of these populations are identified with type I and type II spectral classes, and hence, are thought to be generated by the two-stream and gradient drift instabilities, respectively. The remaining three populations occur over a range of velocities which can greatly exceed the ion acoustic speed, the usual limiting velocity in VHF radar observations of the E region. The generation of these spectral populations is discussed in terms of electron density gradients in the electrojet region and recent non-linear theories of E region irregularity generation.
Key words. Ionosphere (ionospheric irregularities
VHF Series-Input Parallel-Output Interleaved Self-Oscillating Resonant SEPIC Converter
DEFF Research Database (Denmark)
Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.
2013-01-01
If the switches of two resonant SEPIC converters are capacitively coupled, it is possible to obtain a self-oscillating converter in which the two power stages operate in interleaved mode. This paper describes a topology where the inputs of two SEPIC converters are connected in series, thereby sha...
Hospital-based surveillance for viral hemorrhagic fevers and hepatitides in Ghana.
Directory of Open Access Journals (Sweden)
Joseph Humphrey Kofi Bonney
Full Text Available BACKGROUND: Viral hemorrhagic fevers (VHF are acute diseases associated with bleeding, organ failure, and shock. VHF may hardly be distinguished clinically from other diseases in the African hospital, including viral hepatitis. This study was conducted to determine if VHF and viral hepatitis contribute to hospital morbidity in the Central and Northern parts of Ghana. METHODOLOGY/PRINCIPAL FINDINGS: From 2009 to 2011, blood samples of 258 patients with VHF symptoms were collected at 18 hospitals in Ashanti, Brong-Ahafo, Northern, Upper West, and Upper East regions. Patients were tested by PCR for Lassa, Rift Valley, Crimean-Congo, Ebola/Marburg, and yellow fever viruses; hepatitis A (HAV, B (HBV, C (HCV, and E (HEV viruses; and by ELISA for serological hepatitis markers. None of the patients tested positive for VHF. However, 21 (8.1% showed anti-HBc IgM plus HBV DNA and/or HBsAg; 37 (14% showed HBsAg and HBV DNA without anti-HBc IgM; 26 (10% showed anti-HAV IgM and/or HAV RNA; and 20 (7.8% were HCV RNA-positive. None was positive for HEV RNA or anti-HEV IgM plus IgG. Viral genotypes were determined as HAV-IB, HBV-A and E, and HCV-1, 2, and 4. CONCLUSIONS/SIGNIFICANCE: VHFs do not cause significant hospital morbidity in the study area. However, the incidence of acute hepatitis A and B, and hepatitis B and C with active virus replication is high. These infections may mimic VHF and need to be considered if VHF is suspected. The data may help decision makers to allocate resources and focus surveillance systems on the diseases of relevance in Ghana.
Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs
Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh
2014-01-01
While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...
Directory of Open Access Journals (Sweden)
Édgar Leonardo Gómez Gómez
2012-09-01
Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.
Examples of mesoscale structures and short-term wind variations detected by VHF Doppler radar
Forbes, G. S.
1986-01-01
The first of three wind profilers planned for operation in central and western Pennsylvania began full-time, high-quality operation during July 1985. It is located about 20 km south-southeast of University Park and operates at 50 MHz. Another 50-MHz radar and a 400-MHz radar are to be installed over the next few months, to complete a mesoscale triangle with sides of 120 to 160 km. During the period since early July, a number of weather systems have passed over the wind profiler. Those accompanied by thunderstorms caused data losses either because the Department computer system lost power or because power went out at the profiler site. A backup power supply and an automatic re-start program will be added to the profiler system to minimize such future losses. Data have normally been averaged over a one-hour period, although there have been some investigations of shorter-period averaging. In each case, preliminary examinations reveal that the profiler winds are indicative of meteorological phenomena. The only occasions of bad or missing data are obtained when airplane noise is occasionally experienced and when the returned power is nearly at the noise level, at the upper few gates, where a consensus wind cannot be determined. Jets streams, clouds, and diurnal variations of winds are discussed.
2012-04-27
.... Oyster Harbor Marine 122 Bridge 508-428-2017, VHF 9 a.m.-4 p.m 6 Street, 9, 79. Osterville. Crosby Yacht Yard 72 Crosby Circle, 508-428-6900, VHF 9 a.m.-5 p.m 6 Osterville, MA. 9. Centerville Harbor/3 Bays...
Das, T.; Roy, B.; Paul, A.
2014-10-01
Transionospheric satellite navigation links operate primarily at L band and are frequently subject to severe degradation of performances arising out of ionospheric irregularities. Various characteristic features of equatorial ionospheric irregularity bubbles like the drift velocity, characteristic velocity, decorrelation time, and decorrelation distance can be determined using spaced aerial measurements at VHF. These parameters measured at VHF from a station Calcutta situated near the northern crest of the Equatorial Ionization Anomaly (EIA) in the geophysically sensitive Indian longitude sector have been correlated with L band scintillation indices and GPS position accuracy parameters for identifying possible proxies to L band scintillations. Good correspondences have been observed between decorrelation times and distances at VHF with GPS S4 and Position Dilution of Precision during periods of GPS scintillations (S4 > 0.3) for February-April 2011, August-October 2011, and February-April 2012. A functional relation has been developed between irregularity drift velocity measured at VHF and S4 at L band during February-April 2011, and validation of measured S4 and predicted values performed during August-October 2011 and February-April 2012. Significant improvement in L band scintillation prediction and consequent navigational accuracy will result using such relations derived from VHF irregularity measurements which are much simpler and inexpensive.
76 FR 5521 - Innovation in the Broadcast Television Bands
2011-02-01
... broadcasters serving minority, foreign language and niche interests that might have smaller audiences and lower... signals, including those not specifically raised in this NPRM. Improving Reception of VHF TV Service 34... band that can cause interference, and reception of VHF signals requires physically larger antennas that...
Very High Frequency Half Bridge DC/DC Converter
DEFF Research Database (Denmark)
Madsen, Mickey Pierre; Knott, Arnold; Andersen, Michael A. E.
2014-01-01
This paper presents the first, off chip, class DE (resonant half bridge) converter working in the Very High Frequency (VHF) range. The benefits of using half bridge circuits both in the inverter and rectifier part of a VHF resonant dc/dc converter are analyzed and design equations for all...
47 CFR 22.972 - Interference resolution procedures.
2010-10-01
... filters into part 90 ESMR and/or Cellular Radiotelephone transmission equipment; (vi) Permanently changing... knowledge or belief after due diligence; (iv) Is not proffered by a contractor or other third party; and (v...
Bruning, Eric C.; Thomas, Ronald J.; Krehbiel, Paul R.; Rison, William; Carey, Larry D.; Koshak, William; Peterson, Harold; MacGorman, Donald R.
2013-01-01
We will use VHF Lightning Mapping Array data to estimate NOx per flash and per unit channel length, including the vertical distribution of channel length. What s the best way to find channel length from VHF sources? This paper presents the rationale for the fractal method, which is closely related to the box-covering method.
International Nuclear Information System (INIS)
Tereshchenko, E.D.; Khudukon, B.Z.; Gurevich, A.V.; Zybin, K.P.; Frolov, V.L.; Myasnikov, E.N.; Muravieva, N.V.; Carlson, H.C.
2004-01-01
Observations of the ionospheric electron density modified by a powerful wave of the Sura HF heating facility were carried out in Russia at middle latitudes in August 2002. Amplitude scintillations and variations of the phase of VHF signals from Russian orbiting satellites passing over the heated region along the chain of three satellite receivers have been recorded. The experimental data were converted to electron density maps using a stochastic inversion. Tomographic measurements conducted during a low magnetic activity revealed that HF powerful waves can produce significant electron density disturbances up to heights significantly exceeding altitudes of the F layer peak. Both large-scale plasma enhancements and small-scale density irregularities can be generated by the HF radiation. Wavy density structures were also observed within a sector which is much wider than the area covered by the main lobe of the heating antenna. Small-scale density irregularities are mostly field-aligned although large-scale structures can be detected within a much larger area. A distinctive peculiarity of electron density changes occurred during heating is producing a zone of low density inside the area illuminated by the antenna beam. The results indicate that satellite radio tomography and scintillation measurements are effective diagnostic techniques giving a valuable information to studies of effects induced by HF modification. The complete system of plasma density disturbances describing by the theory of 'the magnetic zenith effect' has been for the first time studied in this Letter. A good agreement between the theory and experimental data has been obtained
47 CFR 80.314 - Distress communications.
2010-10-01
... radiotelephone distress call consists of: (1) The distress signal MAYDAY spoken three times; (2) The words THIS IS; (3) The call sign (or name, if no call sign assigned) of the mobile station in distress, spoken...
Measurements of RF Radiation in the Vicinity of FM and TV Broadcasting Stations
Directory of Open Access Journals (Sweden)
Abdulaziz S. Al-Ruwais
2001-12-01
Full Text Available This paper provides measurements of power density around an FM and VHF-TV broadcasting station and its variation with distance. The maximum measured value was about 2.4 mW/cm2 at a height of 2 meters above ground level while the average value was fluctuating around 1 mW/cm2. It was found that the measured power density increases with height above ground and it reaches about 3.5 mW/cm2 at a height of about 15 meters at a location of about 400 meters from the station. At a nearer distance of 185 meters from the tower another measurement was taken at a height of 18 meters, the power density increased to 41 mW/cm2.
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
Research and development was conducted for the development of amorphous solar cell modules for power generation, high in performance and low in production cost. In the effort to improve cell efficiency, experiments were conducted for enhancing bottom a-SiGe cell efficiency for the embodiment of an enhanced-efficiency multi-junction cell, for improving crystallinity in microcrystalline silicon through the application of VHF (very high frequency) plasma CVD (chemical vapor deposition), for texturizing metal electrodes on a film substrate, and so forth. In the effort to increase the film fabrication rate, a VHF plasma CVD device was used for studying the effect of the discharge frequency on film deposition and quality, Vpp between the electrodes, and so forth. Studies about the high-throughput production technology centered on the film substrate solar cell process technology and the designing of an optimum geometrical pattern for SCAF (series-connection through apertures formed on film) cells. Production cost was estimated for the SCAF structure film substrate solar cell manufacturing process, and a production cost of 147.1 yen/W (in case of 100 MW/year production) was obtained as achievable under the currently available conditions. (NEDO)
TDRSS multimode transponder program. Phase 2: Equipment development
Cnossen, R. S.
1974-01-01
This report contains a complete description of the TDRS Multimode Transponder and its associated ground support equipment. The transponder will demonstrate candidate modulation techniques to provide the required information for the design of an eventual VHF/UHF transponder suitable for installation in a user satellite, capable of operating as part of a Tracking and Data Relay Satellite (TDRS) systems. Use of geosynchronous TDRS which can serve both low data rate users at VHF and high data rate users at other frequencies has been considered. The effects of radio frequency interference from the earth and of multipath propagation due to reflections from the earth are expected to pose problems for the TDRS system at VHF. Investigations have suggested several modulation techniques that offer promise to overcome these problems.
Electromagnetic Effices from Impacts on Spacecraft
Close, Sigrid
2018-04-01
Hypervelocity micro particles, including meteoroids and space debris with masses electromagnetic pulse (EMP) with a broad frequency spectrum. Subsequent plasma oscillations resulting from instabilities can also emit significant power and may be responsible for many reported satellite anomalies. We present theory and recent results from ground-based impact tests aimed at characterizing hypervelocity impact plasma and show that impact-produced radio frequency (RF) emissions occurred in frequencies ranging from VHF through L-band and that these emissions were highly correlated with fast (> 20 km/s) impacts that produced a fully ionized plasma.
2010-10-01
... competing with cellular renewal applications. 22.939 Section 22.939 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.939 Site availability requirements for applications competing with cellular renewal applications. In...
Strobel, C.; Chavarin, C. A.; Kitzmann, J.; Lupina, G.; Wenger, Ch.; Albert, M.; Bartha, J. W.
2017-06-01
N-type doped amorphous hydrogenated silicon (a-Si:H) is deposited on top of graphene (Gr) by means of very high frequency (VHF) and radio frequency plasma-enhanced chemical vapor deposition (PECVD). In order to preserve the structural integrity of the monolayer graphene, a plasma excitation frequency of 140 MHz was successfully applied during the a-Si:H VHF-deposition. Raman spectroscopy results indicate the absence of a defect peak in the graphene spectrum after the VHF-PECVD of (n)-a-Si:H. The diode junction between (n)-a-Si:H and graphene was characterized using temperature dependent current-voltage (IV) and capacitance-voltage measurements, respectively. We demonstrate that the current at the (n)-a-Si:H-graphene interface is dominated by thermionic emission and recombination in the space charge region. The Schottky barrier height (qΦB), derived by temperature dependent IV-characteristics, is about 0.49 eV. The junction properties strongly depend on the applied deposition method of (n)-a-Si:H with a clear advantage of the VHF(140 MHz)-technology. We have demonstrated that (n)-a-Si:H-graphene junctions are a promising technology approach for high frequency heterojunction transistors.
Video, LMA and ULF observations of a negative gigantic jet in North Texas
Bruning, E. C.; Cummer, S.; Palivec, K.; Lyons, W. A.; Chmielewski, V.; MacGorman, D. R.
2017-12-01
On 8 September 2016 at 0125:38 UTC video of a negative gigantic jet was captured from Hawley, TX. VHF Lightning Mapping Arrays in West Texas and Oklahoma also observed the parent flash (duration of about 1 s) and, for the first time, mapped dozens of points along ascending negative leaders, lasting about 50 ms, which extended well above cloud top to about 35 km MSL altitude. A few well-located VHF sources were also detected near 50 km. Together, the video and VHF observations provide additional confirmation of the altitude at which the leader-to-streamer transition takes place in gigantic jet discharges. ULF magnetic field data from the Duke iCMC network show a current excursion associated with the onset of the upward movement of negative charge and leaders in the VHF. As the gigantic jet reached its full height, current spiked to 80 kA, followed by several hundred milliseconds of continuing current of 10-20 kA. Total charge moment change was about 6000 C km. The storm complex produced predominantly negative large charge moment change events, which is characteristic of storms that produce negative gigantic jets.
Towards solar energy storage in the photochromic dihydroazulene-vinylheptafulvene system.
Cacciarini, Martina; Skov, Anders B; Jevric, Martyn; Hansen, Anne S; Elm, Jonas; Kjaergaard, Henrik G; Mikkelsen, Kurt V; Brøndsted Nielsen, Mogens
2015-05-11
One key challenge in the field of exploitation of solar energy is to store the energy and make it available on demand. One possibility is to use photochromic molecules that undergo light-induced isomerization to metastable isomers. Here we present efforts to develop solar thermal energy storage systems based on the dihydroazulene (DHA)/vinylheptafulvene (VHF) photo/thermoswitch. New DHA derivatives with one electron-withdrawing cyano group at position 1 and one or two phenyl substituents in the five-membered ring were prepared by using different synthetic routes. In particular, a diastereoselective reductive removal of one cyano group from DHAs incorporating two cyano groups at position 1 turned out to be most effective. Quantum chemical calculations reveal that the structural modifications provide two benefits relative to DHAs with two cyano groups at position 1: 1) The DHA-VHF energy difference is increased (i.e., higher energy capacity of metastable VHF isomer); 2) the Gibbs free energy of activation is increased for the energy-releasing VHF to DHA back-reaction. In fact, experimentally, these new derivatives were so reluctant to undergo the back-reaction at room temperature that they practically behaved as DHA to VHF one-way switches. Although lifetimes of years are at first attractive, which offers the ultimate control of energy release, for a real device it must of course be possible to trigger the back-reaction, which calls for further iterations in the future. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Gilsdorf, Andreas; Morgan, Dilys; Leitmeyer, Katrin
2012-11-21
Travel from countries where viral haemorrhagic fevers (VHF) are endemic has increased significantly over the past decades. In several reported VHF events on airplanes, passenger trace back was initiated but the scale of the trace back differed considerably. The absence of guidance documents to help the decision on necessity and scale of the trace back contributed to this variation.This article outlines the recommendations of an expert panel on Lassa fever, Ebola and Marburg haemorrhagic fever to the wider scientific community in order to advise the relevant stakeholders in the decision and scale of a possible passenger trace back. The evidence was collected through review of published literature and through the views of an expert panel. The guidance was agreed by consensus. Only a few events of VHF cases during air travel are reported in literature, with no documented infection in followed up contacts, so that no evidence of transmission of VHF during air travel exists to date. Based on this and the expert opinion, it was recommended that passenger trace back was undertaken only if: the index case had symptoms during the flight; the flight was within 21 days after detection of the event; and for Lassa fever if exposure of body fluid has been reported. The trace back should only be done after confirmation of the index case. Passengers and crew with direct contact, seat neighbours (+/- 1 seat), crew and cleaning personal of the section of the index case should be included in the trace back. No evidence has been found for the transmission of VHF in airplanes. This information should be taken into account, when a trace back decision has to be taken, because such a measure produces an enormous work load. The procedure suggested by the expert group can guide decisions made in future events, where a patient with suspected VHF infection travelled on a plane. However, the actual decision on start and scale of a trace back always lies in the hands of the responsible people
Microwave components for cellular portable radiotelephone
Muraguchi, Masahiro; Aikawa, Masayoshi
1995-09-01
Mobile and personal communication systems are expected to represent a huge market for microwave components in the coming years. A number of components in silicon bipolar, silicon Bi-CMOS, GaAs MESFET, HBT and HEMT are now becoming available for system application. There are tradeoffs among the competing technologies with regard to performance, cost, reliability and time-to-market. This paper describes process selection and requirements of cost and r.f. performances to microwave semiconductor components for digital cellular and cordless telephones. Furthermore, new circuit techniques which were developed by NTT are presented.
A first comparison of irregularity and ion drift velocity measurements in the E-region
Directory of Open Access Journals (Sweden)
R. A. Makarevich
2006-09-01
Full Text Available E-region irregularity velocity measurements at large flow angles with the STARE Finland coherent VHF radar are considered in context of the ion and electron velocity data provided by the EISCAT tristatic radar system, CUTLASS Finland coherent HF radar, and IMAGE fluxgate magnetometers. The data have been collected during a special experiment on 27 March 2004 during which EISCAT was scanning between several E- and one F-region altitudes along the magnetic field line. Within the E-region, the EISCAT measurements at two altitudes of 110 and 115 km are considered while the electron velocity is inferred from the EISCAT ion velocity measurements at 278 km. The line-of-sight (l-o-s VHF velocity measured by STARE VHF los is compared to the ion and electron velocity components (Vi0 comp and Ve0 comp along the STARE l-o-s direction. The comparison with Ve0 comp for the entire event shows that the measurements exhibit large scatter and small positive correlation. The correlation with Ve0 comp was substantial in the first half of the interval under study when Ve0 comp was larger in magnitude. The comparison with Vi0 comp at 110 and 115 km shows a considerable positive correlation, with VHF velocity being typically larger (smaller in magnitude than Vi0 comp at 110 km (115 km so that VVHF los appears to be bounded by the ion velocity components at two altitudes. It is also demonstrated that the difference between VVHF los and Vi0 comp at 110 km can be treated, in the first approximation, as a linear function of the effective backscatter height heff also counted from 110 km; heff varies in the range 108–114 km due to the altitude integration effects in the scattering cross-section. Our results are consistent with the notion that VHF
44 CFR 361.8 - Ineligible expenditures.
2010-10-01
... OF HOMELAND SECURITY PREPAREDNESS NATIONAL EARTHQUAKE HAZARDS REDUCTION ASSISTANCE TO STATE AND LOCAL GOVERNMENTS Earthquake Hazards Reduction Assistance Program § 361.8 Ineligible expenditures. (a) Expenditures... for the purchase or rental of any equipment such as radio/telephone communications equipment, warning...
VHF radar observations of gravity waves at a low latitude
Directory of Open Access Journals (Sweden)
G. Dutta
1999-08-01
Full Text Available Wind observations made at Gadanki (13.5°N by using Indian MST Radar for few days in September, October, December 1995 and January, 1996 have been analyzed to study gravity wave activity in the troposphere and lower stratosphere. Horizontal wind variances have been computed for gravity waves of period (2-6 h from the power spectral density (PSD spectrum. Exponential curves of the form eZ/H have been fitted by least squares technique to these variance values to obtain height variations of the irregular winds upto the height of about 15 km, where Z is the height in kilometers. The value of H, the scale height, as determined from curve fitting is found to be less than the theoretical value of scale height of neutral atmosphere in this region, implying that the waves are gaining energy during their passage in the troposphere. In other words, it indicates that the sources of gravity waves are present in the troposphere. The energy densities of gravity wave fluctuations have been computed. Polynomial fits to the observed values show that wave energy density increases in the troposphere, its source region, and then decreases in the lower stratosphere.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; waves and tides
Cellular-based sea level gauge
Digital Repository Service at National Institute of Oceanography (India)
Desai, R.G.P.; Joseph, A.
treaties with greater transparency. Among the various communication technologies used for real-time transmission of sea-level data are the wired telephone connection, VHF/UHF transceivers, satellite transmit terminals and cellular connectivity. Wired... telephone connections are severely susceptible to loss of connectivity during natural disasters such as storm surges, primarily because of telephone line breakage. Communication via VHF/UHF transceivers is limited by line-of-sight distance between...
1981-09-01
system SENEAM Servicies a la Navagacion en el Espacio Aero Mexicano SSB Single side band USB Upper side band VFR Visual flight rules VHF Very-high...working may mitigate many historical problems associated with HF communications. The ambient noise associated with monitoring an HF frequency led to...airports all have their VHF facilities on site. Communications are the responsibility of the Administration de l’Aeroport International Francois
47 CFR 22.969 - Cellular RSA licenses subject to competitive bidding.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular RSA licenses subject to competitive bidding. 22.969 Section 22.969 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.969 Cellular RSA licenses...
47 CFR 22.313 - Station identification.
2010-10-01
... Telephone Radio Systems in the Rural Radiotelephone Service; (5) [Reserved] (6) Stations operating pursuant... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES... of each station in the Public Mobile Services must ensure that the transmissions of that station are...
47 CFR 22.857 - Channel plan for commercial aviation air-ground systems.
2010-10-01
... board aircraft. Air-ground systems operating in these frequency bands are referred to in this part as... systems. 22.857 Section 22.857 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground...
2010-01-01
... developed methods of telecommunications. Modernization Plan (State Telecommunications Modernization Plan). A... legislature, or a numeric majority of the RUS Borrowers within the State. When this part refers to the PUC as... circuit, it is not the major method of transmission as in radiotelephone. ...
47 CFR 22.880 - Information exchange.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Information exchange. 22.880 Section 22.880 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...
47 CFR 22.973 - Information exchange.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Information exchange. 22.973 Section 22.973 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII...
47 CFR 22.923 - Cellular system configuration.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular system configuration. 22.923 Section... MOBILE SERVICES Cellular Radiotelephone Service § 22.923 Cellular system configuration. Mobile stations... directly or through cellular repeaters. Auxiliary test stations may communicate with base or mobile...
Evaluating Dihydroazulene/Vinylheptafulvene Photoswitches for Solar Energy Storage Applications.
Wang, Zhihang; Udmark, Jonas; Börjesson, Karl; Rodrigues, Rita; Roffey, Anna; Abrahamsson, Maria; Nielsen, Mogens Brøndsted; Moth-Poulsen, Kasper
2017-08-10
Efficient solar energy storage is a key challenge in striving toward a sustainable future. For this reason, molecules capable of solar energy storage and release through valence isomerization, for so-called molecular solar thermal energy storage (MOST), have been investigated. Energy storage by photoconversion of the dihydroazulene/vinylheptafulvene (DHA/VHF) photothermal couple has been evaluated. The robust nature of this system is determined through multiple energy storage and release cycles at elevated temperatures in three different solvents. In a nonpolar solvent such as toluene, the DHA/VHF system can be cycled more than 70 times with less than 0.01 % degradation per cycle. Moreover, the [Cu(CH 3 CN) 4 ]PF 6 -catalyzed conversion of VHF into DHA was demonstrated in a flow reactor. The performance of the DHA/VHF couple was also evaluated in prototype photoconversion devices, both in the laboratory by using a flow chip under simulated sunlight and under outdoor conditions by using a parabolic mirror. Device experiments demonstrated a solar energy storage efficiency of up to 0.13 % in the chip device and up to 0.02 % in the parabolic collector. Avenues for future improvements and optimization of the system are also discussed. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Exploration of suitable dry etch technologies for directed self-assembly
Yamashita, Fumiko; Nishimura, Eiichi; Yatsuda, Koichi; Mochiki, Hiromasa; Bannister, Julie
2012-03-01
Directed self-assembly (DSA) has shown the potential to replace traditional resist patterns and provide a lower cost alternative for sub-20-nm patterns. One of the possible roadblocks for DSA implementation is the ability to etch the polymers to produce quality masks for subsequent etch processes. We have studied the effects of RF frequency and etch chemistry for dry developing DSA patterns. The results of the study showed a capacitively-coupled plasma (CCP) reactor with very high frequency (VHF) had superior pattern development after the block co-polymer (BCP) etch. The VHF CCP demonstrated minimal BCP height loss and line edge roughness (LER)/line width roughness (LWR). The advantage of CCP over ICP is the low dissociation so the etch rate of BCP is maintained low enough for process control. Additionally, the advantage of VHF is the low electron energy with a tight ion energy distribution that enables removal of the polymethyl methacrylate (PMMA) with good selectivity to polystyrene (PS) and minimal LER/LWR. Etch chemistries were evaluated on the VHF CCP to determine ability to treat the BCPs to increase etch resistance and feature resolution. The right combination of RF source frequencies and etch chemistry can help overcome the challenges of using DSA patterns to create good etch results.
47 CFR 22.925 - Prohibition on airborne operation of cellular telephones.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Prohibition on airborne operation of cellular... CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.925 Prohibition on airborne operation of cellular telephones. Cellular telephones installed in or carried aboard airplanes, balloons or...
47 CFR 22.901 - Cellular service requirements and limitations.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular service requirements and limitations... SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.901 Cellular service requirements and limitations. The licensee of each cellular system is responsible for ensuring that its cellular system...
47 CFR 22.1035 - Construction period.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Construction period. 22.1035 Section 22.1035 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Offshore Radiotelephone Service § 22.1035 Construction period. The construction period (see § 22.142) for...
Effects of electromagnetic fields on fecundity in the chicken.
Krueger, W F; Giarola, A J; Bradley, J W; Shrekenhamer, A
1975-02-28
Egg production was reduced when young laying hens were kept in contact with metal cages while being continuously exposed to the following cw fields: a vhf field at a frequency of 260 MHz, with an incident power that decreased from 100 to 4mW during the experiment; a uhf field at a frequency of 915 MHz, with an incident power of 800 mW during the first 2.5 weeks, zero during the following week, and 200 mW for the remainder of the experiment; a uhf field at 2.435 GHz, with an incident power of 800 mW; an elf electric field at a frequency of 60 Hz, with a calculated value of field strength of 1600 V/m; an elf magnetic field at 60 Hz, with a value of magnetic flux density of 1.4G. With the exception of the hens exposed to the uhf field at 915 MHz, all other treated groups laid significantly less eggs than the controls (p smaller than or equal to 0.01). This reduction (similar 15% less than the controls) began with the first 4-week production period. The egg production curves for the hens exposed to the vhf field at 260 MHz and to the uhf field at 2.435 GHz were approximately the same beginning with the sixth week of production, and they maintained comparable production levels for the remainder of the experiment. An 8% total drop in production also was experienced in the group of birds exposed to the 915-MHz field, which pulsed because of equipment failure. Egg production rate curves for the birds in the elf electric and magnetic fields were substantially different from those exhibited by birds in the other electromagnetic fields. The birds in the E-field regained a production level comparable to the controls after 11 weeks production, whereas those in the B-field dropped to 31% production, which was approximately 40% poorer than the controls by the twelfth week of production. Fertility of cocks and hens was not affected by continuous low-power vhf and uhf near-zone electromagnetic exposure or elf electric or magnetic field treatment. Fertility was exceptionally good
Directory of Open Access Journals (Sweden)
Gilsdorf Andreas
2012-11-01
Full Text Available Abstract Background Travel from countries where viral haemorrhagic fevers (VHF are endemic has increased significantly over the past decades. In several reported VHF events on airplanes, passenger trace back was initiated but the scale of the trace back differed considerably. The absence of guidance documents to help the decision on necessity and scale of the trace back contributed to this variation. This article outlines the recommendations of an expert panel on Lassa fever, Ebola and Marburg haemorrhagic fever to the wider scientific community in order to advise the relevant stakeholders in the decision and scale of a possible passenger trace back. Method The evidence was collected through review of published literature and through the views of an expert panel. The guidance was agreed by consensus. Results Only a few events of VHF cases during air travel are reported in literature, with no documented infection in followed up contacts, so that no evidence of transmission of VHF during air travel exists to date. Based on this and the expert opinion, it was recommended that passenger trace back was undertaken only if: the index case had symptoms during the flight; the flight was within 21 days after detection of the event; and for Lassa fever if exposure of body fluid has been reported. The trace back should only be done after confirmation of the index case. Passengers and crew with direct contact, seat neighbours (+/− 1 seat, crew and cleaning personal of the section of the index case should be included in the trace back. Conclusion No evidence has been found for the transmission of VHF in airplanes. This information should be taken into account, when a trace back decision has to be taken, because such a measure produces an enormous work load. The procedure suggested by the expert group can guide decisions made in future events, where a patient with suspected VHF infection travelled on a plane. However, the actual decision on start and scale
Highlights of NASA/DOE photovoltaic market assessment visit to Morocco
1981-01-01
A broad range of agricultural, rural development, and other power applications in various regions of Morocco were examined to determine the potential market for photovoltaic products in Moroccan development. The primary focus of the study was the agriculture sector which accounts for approximately 17% of the country's GNP. The country has a clear need for reliable remote power systems, but does not have the financial resources to invest in the relatively high capital cost PV equipment. A modest potential for PV use was identified in nonagricultural rural services, such as refrigerators for rural clinics and rural radio-telephones. The main potential for PV in Morocco in the next five years lies mainly in the telecommunications sector. Applications include rural TV sets, TV repeater stations, microwave relay stations, and railroad, marine, and airline signalling. Market size estimates were derived from development and expansion plans. At an average customer cost for complete installed systems from $18/Wp to $30/Wp the total potential market value is estimated in the range of $6.6 to $11 million over the 1981-1986 period.
75 FR 76322 - Drawbridge Operation Regulation; Fox River, Oshkosh, WI
2010-12-08
... required to maintain and operate a marine radiotelephone, along with equipment to visually monitor the... the waterway. If you think that your business, organization, or governmental jurisdiction qualifies as... comment (see ADDRESSES) explaining why you think it qualifies and how and to what degree this rule would...
47 CFR 22.909 - Cellular markets.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular markets. 22.909 Section 22.909... Cellular Radiotelephone Service § 22.909 Cellular markets. Cellular markets are standard geographic areas used by the FCC for administrative convenience in the licensing of cellular systems. Cellular markets...
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Unacceptable interference to non-cellular 800 MHz licensees from 800 MHz cellular systems or part 22 Cellular Radiotelephone systems, and within the... Procedures and Process-Unacceptable Interference § 90.672 Unacceptable interference to non-cellular 800 MHz...
47 CFR 90.674 - Interference resolution procedures before, during and after band reconfiguration.
2010-10-01
... danger; (iii) Was formulated on the basis of either personal knowledge or belief after due diligence; (iv... transmission equipment; (vi) Permanently changing ESMR and/or part 22 Cellular Radiotelephone system...) Discontinuing operations when clear and imminent danger exists. When a public safety licensee determines that a...
Reach Out and Touch Someone: West Alabama Designs a New Emergency Link.
Coogan, Mercy Hardie
1980-01-01
Quality on-the-scene emergency care for a rural area is provided by West Alabama's Emergency Medical Services. The success of this delivery system is attributed to a radio/telephone communications system that provides quick, direct contact between paramedics at the scene and medical doctors miles away. (DS)
47 CFR 22.507 - Number of transmitters per station.
2010-10-01
... those that operate together as a system (e.g., trunked systems, simulcast systems), rather than independently. (b) Split of large systems. The FCC may split wide-area systems into two or more stations for... PUBLIC MOBILE SERVICES Paging and Radiotelephone Service § 22.507 Number of transmitters per station...
47 CFR 80.1001 - Applicability.
2010-10-01
... MARITIME SERVICES Radiotelephone Installations Required by the Bridge-to-Bridge Act § 80.1001 Applicability. The Bridge-to-Bridge Act and the regulations of this part apply to the following vessels in the... the deck excluding sheer, while navigating; and (d) Every dredge and floating plant engaged, in or...
47 CFR 80.925 - Electric light.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Electric light. 80.925 Section 80.925... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.925 Electric light. (a) If the vessel is navigated at night an electric light or dial lights which clearly illuminate the...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Scope. 22.801 Section 22.801 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Air-Ground Radiotelephone Service § 22.801 Scope. The rules in this subpart govern the licensing and operation of air-ground...
Solar effects on communications
International Nuclear Information System (INIS)
Cleveland, F.; Malcolm, W.; Nordell, D.E.; Zirker, J.
1991-01-01
When people involved in the power industry think of Solar Magnetic Disturbances (SMD), they normally consider the potential for disrupting power transmission which results form solar-induced disturbances to the earth's magnetic field known as geomagnetic storms. However, in addition to the disruption of power transmission, solar phenomena can interfere with utility communication systems. Utilities use many different types of communication media, some of which can be affected by various solar phenomena. These include wire-based facilities (metallic cables and power line carrier), radio systems (HF, VHF, UHF mobile radio, microwave networks, and satellite transmissions), and fiber optic systems. This paper reports that the solar flares and other solar phenomena can affect these media through different mechanisms: Radio communications can be disturbed by flare-induced changes in the ionispheric layer of the atmosphere; Cable communications can be disrupted by the flare-induced changes in the magnetosphere which surrounds the earth. These changes, in turn, induce currents in the power equipment that energizes long communications cables; Satellite communications can be disrupted by the flare-induced perturbations of satellite orbits and equipment
Yang, Jingjuan; Han, Xiaoxiao; Yuan, Peipei; Bian, Baoan; Wang, Yixiang
2018-01-01
We investigate the electronic transport properties of dihydroazulene (DHA) and vinylheptafulvene (VHF) molecule sandwiched between two carbon nanotubes using density functional theory and non-equilibrium Green's function. The device displays significantly switching behavior between DHA and VHF isomerizations. It is found the different substitution position of F in the molecule influences the switching ratio of device, which is analyzed by transmission spectra and molecular projected self-consistent Hamiltonian. The observed negative differential resistance effect is explained by transmission spectra and transmission eigenstates of transmission peak in the bias window. The observed reverse of current in VHF form in which two H atoms on the right side of the benzene ring of the molecule are replaced by F is explained by transmission spectra and molecule-electrode coupling with the varied bias. The results suggest that the reasonable substitution position of molecule may improve the switching ratio, displaying a potential application in future molecular circuit.
Solar Thermal Energy Storage in a Photochromic Macrocycle.
Vlasceanu, Alexandru; Broman, Søren L; Hansen, Anne S; Skov, Anders B; Cacciarini, Martina; Kadziola, Anders; Kjaergaard, Henrik G; Mikkelsen, Kurt V; Nielsen, Mogens Brøndsted
2016-07-25
The conversion and efficient storage of solar energy is recognized to hold significant potential with regard to future energy solutions. Molecular solar thermal batteries based on photochromic systems exemplify one possible technology able to harness and apply this potential. Herein is described the synthesis of a macrocycle based on a dimer of the dihydroazulene/vinylheptafulvene (DHA/VHF) photo/thermal couple. By taking advantage of conformational strain, this DHA-DHA macrocycle presents an improved ability to absorb and store incident light energy in chemical bonds (VHF-VHF). A stepwise energy release over two sequential ring-closing reactions (VHF→DHA) combines the advantages of an initially fast discharge, hypothetically addressing immediate energy consumption needs, followed by a slow process for consistent, long-term use. This exemplifies another step forward in the molecular engineering and design of functional organic materials towards solar thermal energy storage and release. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Comparison of multifrequency equatorial scintillation - American and Pacific sectors
Livingston, R. C.
1980-08-01
In this paper we examine the severity of radio wave amplitude scintillation measured at two stations near the equator but far separated in longitude: Kwajelein, Marshall Islands (167 E), and Ancon, Peru (-77 E). The data used are long-term observations of the Defense Nuclear Agency (DNA) Wideband satellite signal intensity at VHF, UHF, and L band frequencies. The seasonal behavior of the scintillation at the two stations is similar; each shows a broad 8- to 9-month disturbed season centered about local summer. There is short-term variability in the scintillation occurrence statistics but no clear equinoctial maxima. Little difference is observed in the occurrence or severity of L band scintillation at the two stations, although a systematic difference in the frequency dependence of the scintillation produces significantly stronger VHF and UHF scintillation at Ancon. The VHF and UHF latitudinal distributions of scintillation are asymmetric about the geomagnetic equator at both stations.
Parametric nanomechanical amplification at very high frequency.
Karabalin, R B; Feng, X L; Roukes, M L
2009-09-01
Parametric resonance and amplification are important in both fundamental physics and technological applications. Here we report very high frequency (VHF) parametric resonators and mechanical-domain amplifiers based on nanoelectromechanical systems (NEMS). Compound mechanical nanostructures patterned by multilayer, top-down nanofabrication are read out by a novel scheme that parametrically modulates longitudinal stress in doubly clamped beam NEMS resonators. Parametric pumping and signal amplification are demonstrated for VHF resonators up to approximately 130 MHz and provide useful enhancement of both resonance signal amplitude and quality factor. We find that Joule heating and reduced thermal conductance in these nanostructures ultimately impose an upper limit to device performance. We develop a theoretical model to account for both the parametric response and nonequilibrium thermal transport in these composite nanostructures. The results closely conform to our experimental observations, elucidate the frequency and threshold-voltage scaling in parametric VHF NEMS resonators and sensors, and establish the ultimate sensitivity limits of this approach.
A VHF Interleaved Self-Oscillating Resonant SEPIC Converter with Phase-Shift Burst-Mode Control
DEFF Research Database (Denmark)
Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.
2014-01-01
This paper presents design and implementation of the phase-shift burst-mode control method for interleaved selfoscillating resonant SEPIC converters for LED lighting applications. The proposed control method utilizes delays in the turn-on and turn-off of the power stage and control circuitry...... in order to reduce requirements for the comparator in the regulation circuit. The control method is experimentally evaluated on a 49 MHz dc-dc converter prototype, and the results are presented. The designed converter demonstrates peak efficiency of 81%, maintains efficiency above 75% from 20% load to full...
47 CFR 80.953 - Inspection and certification.
2010-10-01
... date on which it is placed in service. (b) An inspection and certification of a ship subject to the... must be recorded in the ship's radiotelephone log and include: (1) The date the inspection was... part and has successfully passed the inspection. (c) The vessel owner, operator, or ship's master must...
47 CFR 22.921 - 911 call processing procedures; 911-only calling mode.
2010-10-01
... programming in the mobile unit that determines the handling of a non-911 call and permit the call to be... CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.921 911 call processing procedures; 911-only calling mode. Mobile telephones manufactured after February 13, 2000 that are capable of...
Syntheses of donor-acceptor-functionalized dihydroazulenes
DEFF Research Database (Denmark)
Broman, Søren Lindbæk; Jevric, Martyn; Bond, Andrew
2014-01-01
The dihydroazulene (DHA)/vinylheptafulvene (VHF) photo/thermoswitch has been of interest for use in molecular electronics and advanced materials. The switching between the two isomers has previously been found to depend strongly on the presence of donor and acceptor groups. The fine-tuning of opt......The dihydroazulene (DHA)/vinylheptafulvene (VHF) photo/thermoswitch has been of interest for use in molecular electronics and advanced materials. The switching between the two isomers has previously been found to depend strongly on the presence of donor and acceptor groups. The fine...
Ionospheric plasma by VHF waves
Indian Academy of Sciences (India)
The amplitude scintillations of very high frequency electromagnetic wave ... Scintillations at low latitude are known to occur in discrete patches [5,6] and are part .... weakly ionized plasma with a density gradient and a relative drift of ions and ...
Degree of dissociation measured by FTIR absorption spectroscopy applied to VHF silane plasmas
International Nuclear Information System (INIS)
Sansonnens, L.; Howling, A.A.; Hollenstein, C.
1997-10-01
In situ Fourier transform infrared (FTIR) absorption spectroscopy has been used to determine the fractional depletion of silane in a radio-frequency (rf) glow discharge. The technique used a simple single pass arrangement and was implemented in a large area industrial reactor for deposition of amorphous silicon. Measurements were made on silane plasmas for a range of excitation frequencies. It was observed that at constant plasma power, the fractional depletion increased from 35% at 13.56 MHz to 70% at 70 MHz. With a simple model based on the density continuity equations in the gas phase, it was shown that this increase is due to a higher dissociation rate and is largely responsible for the observed increase in the deposition rate with the frequency. (author) 5 figs., 30 refs
Hydrogen atom kinetics in capacitively coupled plasmas
Nunomura, Shota; Katayama, Hirotaka; Yoshida, Isao
2017-05-01
Hydrogen (H) atom kinetics has been investigated in capacitively coupled very high frequency (VHF) discharges at powers of 16-780 mW cm-2 and H2 gas pressures of 0.1-2 Torr. The H atom density has been measured using vacuum ultra violet absorption spectroscopy (VUVAS) with a micro-discharge hollow cathode lamp as a VUV light source. The measurements have been performed in two different electrode configurations of discharges: conventional parallel-plate diode and triode with an intermediate mesh electrode. We find that in the triode configuration, the H atom density is strongly reduced across the mesh electrode. The H atom density varies from ˜1012 cm-3 to ˜1010 cm-3 by crossing the mesh with 0.2 mm in thickness and 36% in aperture ratio. The fluid model simulations for VHF discharge plasmas have been performed to study the H atom generation, diffusion and recombination kinetics. The simulations suggest that H atoms are generated in the bulk plasma, by the electron impact dissociation (e + H2 \\to e + 2H) and the ion-molecule reaction (H2 + + H2 \\to {{{H}}}3+ + H). The diffusion of H atoms is strongly limited by a mesh electrode, and thus the mesh geometry influences the spatial distribution of the H atoms. The loss of H atoms is dominated by the surface recombination.
47 CFR 80.163 - Operator requirements of the Bridge-to-Bridge Act.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Operator requirements of the Bridge-to-Bridge... Requirements § 80.163 Operator requirements of the Bridge-to-Bridge Act. Each ship subject to the Bridge-to-Bridge Act must have on board a radio operator who holds a restricted radiotelephone operator permit or...
Commercial satellite broadcasting for Europe
Forrest, J. R.
1988-12-01
A review is presented of the current television broadcasting situation in European countries, which involves a varied mix of terrestrial VHF or UHF systems and cable networks. A small market has emerged in Europe for receivers using the low-power telecommunications satellite transmission between the program providers and cable network companies. This is expected to change with the launch of medium-power pan-European telecommunication satellites (e.g. ASTRA, EUTELSAT II), which are now directly addressing the market of home reception. DBS (direct broadcast satellite) in the UK, using the D-MAC transmission standard, will offer three additional television channels, data broadcasting services, and a planned evolution to compatible forms of wide-screen, high-definition television. Comments are given on receiver and conditional access system standardization. Some views are expressed on satellite broadcasting as part of an overall broadcasting framework for the future.
Self-oscillating Galvanic Isolated Bidirectional Very High Frequency DC-DC Converter
DEFF Research Database (Denmark)
Pedersen, Jeppe Arnsdorf; Madsen, Mickey Pierre; Knott, Arnold
2015-01-01
This paper describes a galvanic isolated bidirectional Very High Frequency (VHF = 30 MHz - 300MHz) ClassE converter. The reason for increasing the switching frequency is to minimize the passive components in the converter. To make the converter topology bidirectional the rectifier has to be synch......This paper describes a galvanic isolated bidirectional Very High Frequency (VHF = 30 MHz - 300MHz) ClassE converter. The reason for increasing the switching frequency is to minimize the passive components in the converter. To make the converter topology bidirectional the rectifier has...
Using Volcanic Lightning Measurements to Discern Variations in Explosive Volcanic Activity
Behnke, S. A.; Thomas, R. J.; McNutt, S. R.; Edens, H. E.; Krehbiel, P. R.; Rison, W.
2013-12-01
VHF observations of volcanic lightning have been made during the recent eruptions of Augustine Volcano (2006, Alaska, USA), Redoubt Volcano (2009, Alaska, USA), and Eyjafjallajökull (2010, Iceland). These show that electrical activity occurs both on small scales at the vent of the volcano, concurrent with an eruptive event and on large scales throughout the eruption column during and subsequent to an eruptive event. The small-scale discharges at the vent of the volcano are often referred to as 'vent discharges' and are on the order of 10-100 meters in length and occur at rates on the order of 1000 per second. The high rate of vent discharges produces a distinct VHF signature that is sometimes referred to as 'continuous RF' radiation. VHF radiation from vent discharges has been observed at sensors placed as far as 100 km from the volcano. VHF and infrasound measurements have shown that vent discharges occur simultaneously with the onset of eruption, making their detection an unambiguous indicator of explosive volcanic activity. The fact that vent discharges are observed concurrent with explosive volcanic activity indicates that volcanic ejecta are charged upon eruption. VHF observations have shown that the intensity of vent discharges varies between eruptive events, suggesting that fluctuations in eruptive processes affect the electrification processes giving rise to vent discharges. These fluctuations may be variations in eruptive vigor or variations in the type of eruption; however, the data obtained so far do not show a clear relationship between eruption parameters and the intensity or occurrence of vent discharges. Further study is needed to clarify the link between vent discharges and eruptive behavior, such as more detailed lightning observations concurrent with tephra measurements and other measures of eruptive strength. Observations of vent discharges, and volcanic lightning observations in general, are a valuable tool for volcano monitoring, providing a
Lightning and radar observations of hurricane Rita landfall
Energy Technology Data Exchange (ETDEWEB)
Henderson, Bradley G [Los Alamos National Laboratory; Suszcynsky, David M [Los Alamos National Laboratory; Hamlin, Timothy E [Los Alamos National Laboratory; Jeffery, C A [Los Alamos National Laboratory; Wiens, Kyle C [TEXAS TECH U.; Orville, R E [TEXAS A& M
2009-01-01
Los Alamos National Laboratory (LANL) owns and operates an array of Very-Low Frequency (VLF) sensors that measure the Radio-Frequency (RF) waveforms emitted by Cloud-to-Ground (CG) and InCloud (IC) lightning. This array, the Los Alamos Sferic Array (LASA), has approximately 15 sensors concentrated in the Great Plains and Florida, which detect electric field changes in a bandwidth from 200 Hz to 500 kHz (Smith et al., 2002). Recently, LANL has begun development of a new dual-band RF sensor array that includes the Very-High Frequency (VHF) band as well as the VLF. Whereas VLF lightning emissions can be used to deduce physical parameters such as lightning type and peak current, VHF emissions can be used to perform precise 3d mapping of individual radiation sources, which can number in the thousands for a typical CG flash. These new dual-band sensors will be used to monitor lightning activity in hurricanes in an effort to better predict intensification cycles. Although the new LANL dual-band array is not yet operational, we have begun initial work utilizing both VLF and VHF lightning data to monitor hurricane evolution. In this paper, we present the temporal evolution of Rita's landfall using VLF and VHF lightning data, and also WSR-88D radar. At landfall, Rita's northern eyewall experienced strong updrafts and significant lightning activity that appear to mark a transition between oceanic hurricane dynamics and continental thunderstorm dynamics. In section 2, we give a brief overview of Hurricane Rita, including its development as a hurricane and its lightning history. In the following section, we present WSR-88D data of Rita's landfall, including reflectivity images and temporal variation. In section 4, we present both VHF and VLF lightning data, overplotted on radar reflectivity images. Finally, we discuss our observations, including a comparison to previous studies and a brief conclusion.
International Nuclear Information System (INIS)
Adachi, Michito; Sato, Takamichi; Kawakatsu, Shinobu; Ohshima, Fumi
2012-01-01
The aim of this study was to investigate whether the outline of the hippocampal body becomes rounded on coronal magnetic resonance imaging (MRI) as the volume of the hippocampal formation decreases in Alzheimer's disease (AD). Institutional review board approval of the study protocol was obtained, and all subjects provided informed consent for the mini-mental state examination (MMSE) and MRI. The MRI and MMSE were prospectively performed in all 103 subjects (27 men and 76 women; mean age ± standard deviation, 77.7 ± 7.8 years) who had AD or were concerned about having of dementia and who consulted our institute over 1 year. The subjects included 14 non-dementia cases (MMSE score ≥ 28) and 89 AD cases (MMSE score ≤ 27). The total volume of the bilateral hippocampal formation (VHF) was assessed with a tracing method, and the ratio of the VHF to the intracranial volume (RVHF) and the rounding ratio (RR) of the hippocampal body (mean ratio of its short dimension to the long dimension in the bilateral hippocampal body) were calculated. Using Spearman's correlation coefficient, the correlations between RR and VHF and between RR and RVHF were assessed. Correlation coefficients between RR and VHF and between RR and RVHF were -0.419 (p < 0.01) and -0.418 (p < 0.01), respectively. There was a significant negative correlation between RR and the volume of the hippocampal formation. The outline of the body of the hippocampal formation becomes rounded on coronal images as its volume decreases in AD. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Sobajima, Yasushi; Nishino, Mitsutoshi; Fukumori, Taiga; Kurihara, Masanori; Higuchi, Takuya; Nakano, Shinya; Toyama, Toshihiko; Okamoto, Hiroaki [Department of Systems Innovation, Graduate School of Engineering Science, Osaka University, Toyonaka, Machikaneyama-cho 1-3, Osaka 560-8531 (Japan)
2009-06-15
Microcrystalline silicon ({mu}c-Si) films deposited at high growth rates up to 8.1 nm/s prepared by very-high-frequency-plasma-enhanced chemical vapor deposition (VHF-PECVD) at 18-24 Torr have been investigated. The relation between the deposition rates and input power revealed the depletion of silane. Under high-pressure deposition (HPD) conditions, the structural properties were improved. Furthermore, applying {mu}c-Si to n-i-p solar cells, short-circuit current density (J{sub SC}) was increased in accordance with the improvement of microstructure of i-layer. As a result, a conversion efficiency of 6.30% has been achieved employing the i-layer deposited at 8.1 nm/s under the HPD conditions. (author)
Telescope Array Radar (TARA) observatory for Ultra-High Energy Cosmic Rays
Energy Technology Data Exchange (ETDEWEB)
Abbasi, R.; Othman, M. Abou Bakr [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Allen, C. [University of Kansas, Lawrence, KS 66045 (United States); Beard, L. [Purdue University, West Lafayette, IN 47907 (United States); Belz, J. [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Besson, D. [University of Kansas, Lawrence, KS 66045 (United States); Moscow Engineering and Physics Institute, 31 Kashirskaya Shosse, Moscow 115409 (Russian Federation); Byrne, M.; Farhang-Boroujeny, B.; Gardner, A. [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Gillman, W.H. [Gillman and Associates, Salt Lake City, UT 84106 (United States); Hanlon, W. [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Hanson, J. [University of Kansas, Lawrence, KS 66045 (United States); Jayanthmurthy, C. [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Kunwar, S. [University of Kansas, Lawrence, KS 66045 (United States); Larson, S.L. [Utah State University, Logan, Utah 84322 (United States); Myers, I., E-mail: isaac@cosmic.utah.edu [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Prohira, S.; Ratzlaff, K. [University of Kansas, Lawrence, KS 66045 (United States); Sokolsky, P. [University of Utah, 115 S 1400 E #201 JFB, Salt Lake City, UT 84112 (United States); Takai, H. [Brookhaven National Laboratory, Upton, NY 11973 (United States); and others
2014-12-11
Construction was completed during summer 2013 on the Telescope Array RAdar (TARA) bi-static radar observatory for Ultra-High Energy Cosmic Rays (UHECR). TARA is co-located with the Telescope Array, the largest “conventional” cosmic ray detector in the Northern Hemisphere, in radio-quiet Western Utah. TARA employs an 8 MW Effective Radiated Power (ERP) VHF transmitter and smart receiver system based on a 250 MS/s data acquisition system in an effort to detect the scatter of sounding radiation by UHECR-induced atmospheric ionization. TARA seeks to demonstrate bi-static radar as a useful new remote sensing technique for UHECRs. In this report, we describe the design and performance of the TARA transmitter and receiver systems.
Telescope Array Radar (TARA) observatory for Ultra-High Energy Cosmic Rays
International Nuclear Information System (INIS)
Abbasi, R.; Othman, M. Abou Bakr; Allen, C.; Beard, L.; Belz, J.; Besson, D.; Byrne, M.; Farhang-Boroujeny, B.; Gardner, A.; Gillman, W.H.; Hanlon, W.; Hanson, J.; Jayanthmurthy, C.; Kunwar, S.; Larson, S.L.; Myers, I.; Prohira, S.; Ratzlaff, K.; Sokolsky, P.; Takai, H.
2014-01-01
Construction was completed during summer 2013 on the Telescope Array RAdar (TARA) bi-static radar observatory for Ultra-High Energy Cosmic Rays (UHECR). TARA is co-located with the Telescope Array, the largest “conventional” cosmic ray detector in the Northern Hemisphere, in radio-quiet Western Utah. TARA employs an 8 MW Effective Radiated Power (ERP) VHF transmitter and smart receiver system based on a 250 MS/s data acquisition system in an effort to detect the scatter of sounding radiation by UHECR-induced atmospheric ionization. TARA seeks to demonstrate bi-static radar as a useful new remote sensing technique for UHECRs. In this report, we describe the design and performance of the TARA transmitter and receiver systems
Telescope Array Radar (TARA) observatory for Ultra-High Energy Cosmic Rays
Abbasi, R.; Othman, M. Abou Bakr; Allen, C.; Beard, L.; Belz, J.; Besson, D.; Byrne, M.; Farhang-Boroujeny, B.; Gardner, A.; Gillman, W. H.; Hanlon, W.; Hanson, J.; Jayanthmurthy, C.; Kunwar, S.; Larson, S. L.; Myers, I.; Prohira, S.; Ratzlaff, K.; Sokolsky, P.; Takai, H.; Thomson, G. B.; Von Maluski, D.
2014-12-01
Construction was completed during summer 2013 on the Telescope Array RAdar (TARA) bi-static radar observatory for Ultra-High Energy Cosmic Rays (UHECR). TARA is co-located with the Telescope Array, the largest "conventional" cosmic ray detector in the Northern Hemisphere, in radio-quiet Western Utah. TARA employs an 8 MW Effective Radiated Power (ERP) VHF transmitter and smart receiver system based on a 250 MS/s data acquisition system in an effort to detect the scatter of sounding radiation by UHECR-induced atmospheric ionization. TARA seeks to demonstrate bi-static radar as a useful new remote sensing technique for UHECRs. In this report, we describe the design and performance of the TARA transmitter and receiver systems.
Clark, Dan
2014-01-01
Understanding your company's data has never been easier than with Microsoft's new Power BI package for Excel 2013. Consisting of four powerful tools-Power Pivot, Power View, Power Query and Power Maps-Power BI makes self-service business intelligence a reality for a wide range of users, bridging the traditional gap between Excel users, business analysts and IT experts and making it easier for everyone to work together to build the data models that can give you game-changing insights into your business. Beginning Power BI with Excel 2013 guides you step by step through the process of analyzin
Wind Power - A Power Source Enabled by Power Electronics
DEFF Research Database (Denmark)
Blaabjerg, Frede; Chen, Zhe
2004-01-01
. The deregulation of energy has lowered the investment in bigger power plants, which means the need for new electrical power sources may be very high in the near future. Two major technologies will play important roles to solve the future problems. One is to change the electrical power production sources from......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. The production, distribution and the use of the energy should be as technological efficient as possible and incentives to save energy at the end-user should be set up...... the conventional, fossil (and short term) based energy sources to renewable energy sources. The other is to use high efficient power electronics in power systems, power production and end-user application. This paper discuss the most emerging renewable energy source, wind energy, which by means of power...
Power program and nuclear power
International Nuclear Information System (INIS)
Chernilin, Yu.F.
1990-01-01
Main points of the USSR power program and the role of nuclear power in fuel and power complex of the country are considered. Data on dynamics of economic indices of electric power generation at nuclear power plants during 1980-1988 and forecasts till 2000 are presented. It is shown that real cost of 1 kW/h of electric power is equal to 1.3-1.8 cop., and total reduced cost is equal to 1.8-2.4 cop
Tennessee Valley Total and Cloud-to-Ground Lightning Climatology Comparison
Buechler, Dennis; Blakeslee, R. J.; Hall, J. M.; McCaul, E. W.
2008-01-01
The North Alabama Lightning Mapping Array (NALMA) has been in operation since 2001 and consists often VHF receivers deployed across northern Alabama. The NALMA locates sources of impulsive VHF radio signals from total lightning by accurately measuring the time that the signals arrive at the different receiving stations. The sources detected are then clustered into flashes by applying spatially and temporally constraints. This study examines the total lightning climatology of the region derived from NALMA and compares it to the cloud-to-ground (CG) climatology derived from the National Lightning Detection Network (NLDN) The presentation compares the total and CG lightning trends for monthly, daily, and hourly periods.
Introduction to electrical power and power electronics
Patel, Mukund R
2012-01-01
Power Generation, Distribution, and Utilization AC Power Fundamentals Common Aspects of Power Equipments AC Generator AC and DC Motors Transformer Power Cable Power Distribution Fault Current Analysis System ProtectionEconomic Use of PowerElectrochemical BatteryPower Electronics and Motor Drives Power Electronics Devices DC-DC Converters AC-DC-AC Converters Variable-Frequency Drives Quality of Power Power Converter CoolingAppendixIndex
Power theories for improved power quality
Pasko, Marian
2012-01-01
Power quality describes a set of parameters of electric power and the load’s ability to function properly under specific conditions. It is estimated that problems relating to power quality costs the European industry hundreds of billions of Euros annually. In contrast, financing for the prevention of these problems amount to fragments of these costs. Power Theories for Improved Power Quality addresses this imbalance by presenting and assessing a range of methods and problems related to improving the quality of electric power supply. Focusing particularly on active compensators and the DSP based control algorithms, Power Theories for Improved Power Quality introduces the fundamental problems of electrical power. This introduction is followed by chapters which discuss: •‘Power theories’ including their historical development and application to practical problems, •operational principles of active compensator’s DSP control based algorithms using examples and results from laboratory research, and •t...
Numerical simulation of narrow bipolar electromagnetic pulses generated by thunderstorm discharges
Bochkov, E. I.; Babich, L. P.; Kutsyk, I. M.
2013-07-01
Using the concept of avalanche relativistic runaway electrons (REs), we perform numerical simulations of compact intracloud discharge (CID) as a generator of powerful natural electromagnetic pulses (EMPs) in the HF-VHF range, called narrow bipolar pulses (NBPs). For several values of the field overvoltage and altitude at which the discharge develops, the numbers of seed electrons initiating the avalanche are evaluated, with which the calculated EMP characteristics are consistent with the measured NBP parameters. We note shortcomings in the hypothesis assuming participation of cosmic ray air showers in avalanche initiation. The discharge capable of generating NBPs produces REs in numbers close to those in the source of terrestrial γ-ray flashes (TGFs), which can be an argument in favor of a unified NBP and TGF source.
Numerical simulation of narrow bipolar electromagnetic pulses generated by thunderstorm discharges
International Nuclear Information System (INIS)
Bochkov, E. I.; Babich, L. P.; Kutsyk, I. M.
2013-01-01
Using the concept of avalanche relativistic runaway electrons (REs), we perform numerical simulations of compact intracloud discharge (CID) as a generator of powerful natural electromagnetic pulses (EMPs) in the HF-VHF range, called narrow bipolar pulses (NBPs). For several values of the field overvoltage and altitude at which the discharge develops, the numbers of seed electrons initiating the avalanche are evaluated, with which the calculated EMP characteristics are consistent with the measured NBP parameters. We note shortcomings in the hypothesis assuming participation of cosmic ray air showers in avalanche initiation. The discharge capable of generating NBPs produces REs in numbers close to those in the source of terrestrial γ-ray flashes (TGFs), which can be an argument in favor of a unified NBP and TGF source
Characterizing Hypervelocity Impact Plasma Through Experiments and Simulations
Close, Sigrid; Lee, Nicolas; Fletcher, Alex; Nuttall, Andrew; Hew, Monica; Tarantino, Paul
2017-10-01
Hypervelocity micro particles, including meteoroids and space debris with masses produce a strong electromagnetic pulse (EMP) with a broad frequency spectrum. Subsequent plasma oscillations resulting from instabilities can also emit significant power and may be responsible for many reported satellite anomalies. We present theory and recent results from ground-based impact tests aimed at characterizing hypervelocity impact plasma. We also show results from particle-in-cell (PIC) and computational fluid dynamics (CFD) simulations that allow us to extend to regimes not currently possible with ground-based technology. We show that significant impact-produced radio frequency (RF) emissions occurred in frequencies ranging from VHF through L-band and that these emissions were highly correlated with fast (>20 km/s) impacts that produced a fully ionized plasma.
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
Development will be made on high-performance a-solar cells as part of developing practical application technology for a-solar cells for electric power use. Development will be also made on a low-cost process technology. This paper describes the achievements attained during fiscal 1997. Quality improvement has been realized by using a high RF power hydrogen dilution process on a-Si films for front cells of lamination type cells. Four times faster film forming speed was obtained even by using the VHF plasma CVD process, with film quality equivalent to those made by using the conventional RF process maintained. By optimizing the light enclosing construction, the short circuit current was enhanced by over 20%. Discussions were given on forming homogenous a-Si films by optimizing the conditions for forming films on large-area substrates, which resulted in forming film of 30 cm times 40 cm size with good homogeneity at a film forming speed three times faster than the conventional speed. A surface electrode was formed successfully with good uniformity on a substrate with a size of 60 cm times 90 cm. Productivity greater by over three times the conventional productivity was achieved in patterning of transparent electrodes by using high-output laser. Simultaneous and collective patterning and very small and long size collective patterning were realized in a-Si film selection patterning by using the plasma CVD process. (NEDO)
Wind power - a power source now enabled by power electronics
DEFF Research Database (Denmark)
Blaabjerg, Frede; Iov, Florin
2007-01-01
energy at the end-user should be set up. Deregulation of energy has lowered the investment in larger power plants, which means the need for new electrical power sources may be increased in the near future. Two major technologies will play important roles to solve the future problems. One is to change......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. It is expected that it has to be doubled within 20 years. The production, distribution and use of the energy should be as technological efficient as possible and incentives to save...... the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. Another is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most emerging...
Comparison between Different Power Sources for Emergency Power Supply at Nuclear Power Plants
International Nuclear Information System (INIS)
Lenasson, Magnus
2015-01-01
Currently the Swedish nuclear power plants are using diesel generator sets and to some extent gas turbines as their emergency AC power sources and batteries as their emergency DC power sources. In the laws governing Swedish nuclear activity, no specific power sources are prescribed. On the other hand, diversification of safety functions should be considered, as well as simplicity and reliability in the safety systems. So far the choices of emergency power sources have been similar between different power plants, and therefore this project investigated a number of alternative power sources and if they are suitable for use as emergency power on nuclear power plants. The goals of the project were to: - Define the parameters that are essential for rending a power source suitable for use at a nuclear power plant. - Present the characteristics of a number of power sources regarding the defined parameters. - Compile the suitability of the different power sources. - Make implementation suggestions for the less conventional of the investigated power sources. (unconventional in the investigated application) 10 different power sources in total have been investigated and to various degrees deemed suitable Out of the 10 power sources, diesel generators, batteries and to some extent gas turbines are seen as conventional technology at the nuclear power plants. In relation to them the other power sources have been assessed regarding diversification gains, foremost with regards to external events. The power sources with the largest diversification gains are: Internal steam turbine, Hydro power, Thermoelectric generators. The work should first and foremost put focus on the fact that under the right circumstances there are power sources that can complement conventional power sources and yield substantial diversification gains. This paper is a shortened version of the report 'Comparison between different power sources for emergency power supply at nuclear power plants'. The
The investigation of the ionosphere using Eiscat radar
International Nuclear Information System (INIS)
Gerwin, R.
1981-01-01
Eiscat (European Incoherent Scatter Association) is a research organisation based in Kiruna (Sweden) with the support of several North European nations and has transmitters working in Tromsoe (Norway) and receivers situated in Tromsoe, Kiruna and Sodankylae (Finland), all near the Arctic Circle. Wavelengths used are 22 cm (UHF) and 134 cm (VHF). Scatter results have been obtained from free electrons in the ionosphere and in the magnetosphere. In the UHF (250 kw) system there is a four segment concave reflector occupying the area of a football field. The VHF (650 kW) system uses a four segment parabolic reflector. Both systems have been employed to investigate plasma phenomena and especially the ''Northern Lights''. (G.C.)
Niamtu , J
2001-08-01
Carousel slide presentations have been used for academic and clinical presentations since the late 1950s. However, advances in computer technology have caused a paradigm shift, and digital presentations are quickly becoming standard for clinical presentations. The advantages of digital presentations include cost savings; portability; easy updating capability; Internet access; multimedia functions, such as animation, pictures, video, and sound; and customization to augment audience interest and attention. Microsoft PowerPoint has emerged as the most popular digital presentation software and is currently used by many practitioners with and without significant computer expertise. The user-friendly platform of PowerPoint enables even the novice presenter to incorporate digital presentations into his or her profession. PowerPoint offers many advanced options that, with a minimal investment of time, can be used to create more interactive and professional presentations for lectures, patient education, and marketing. Examples of advanced PowerPoint applications are presented in a stepwise manner to unveil the full power of PowerPoint. By incorporating these techniques, medical practitioners can easily personalize, customize, and enhance their PowerPoint presentations. Complications, pitfalls, and caveats are discussed to detour and prevent misadventures in digital presentations. Relevant Web sites are listed to further update, customize, and communicate PowerPoint techniques.
Opposite brain laterality in analogous auditory and visual tests.
Oltedal, Leif; Hugdahl, Kenneth
2017-11-01
Laterality for language processing can be assessed by auditory and visual tasks. Typically, a right ear/right visual half-field (VHF) advantage is observed, reflecting left-hemispheric lateralization for language. Historically, auditory tasks have shown more consistent and reliable results when compared to VHF tasks. While few studies have compared analogous tasks applied to both sensory modalities for the same participants, one such study by Voyer and Boudreau [(2003). Cross-modal correlation of auditory and visual language laterality tasks: a serendipitous finding. Brain Cogn, 53(2), 393-397] found opposite laterality for visual and auditory language tasks. We adapted an experimental paradigm based on a dichotic listening and VHF approach, and applied the combined language paradigm in two separate experiments, including fMRI in the second experiment to measure brain activation in addition to behavioural data. The first experiment showed a right-ear advantage for the auditory task, but a left half-field advantage for the visual task. The second experiment, confirmed the findings, with opposite laterality effects for the visual and auditory tasks. In conclusion, we replicate the finding by Voyer and Boudreau (2003) and support their interpretation that these visual and auditory language tasks measure different cognitive processes.
Water Power Research | Water Power | NREL
Water Power Research Water Power Research NREL conducts water power research; develops design tools ; and evaluates, validates, and supports the demonstration of innovative water power technologies. Photo of a buoy designed around the oscillating water column principle wherein the turbine captures the
Power control device of an atomic power plant
International Nuclear Information System (INIS)
Ootsuka, Shiro; Ito, Takero.
1980-01-01
Purpose: To improve the power controllability of an atomic power plant by improving the controllability, response and stability of the recirculation flow rate. Constitution: The power control device comprises a power detector of the reactor, which detects and operates the reactor power from the thermal power, neutron flux or the process quantity controlling the same, and a deviation detector which seeks deviation between the power signal of the power detector and the power set value of the reactor or power station. By use of the power control device constituted in this manner, the core flow rate is regulated by the power signal of the deviation detector thereby to control the power. (Aizawa, K.)
Naderi, F. (Editor)
1982-01-01
A conceptual system design for a satellite-aided land mobile service is described. A geostationary satellite which employs a large (55-m) UHF reflector to communicate with small inexpensive user antennas on mobile vehicles is discussed. It is shown that such a satellite system through multiple beam antennas and frequency reuse can provide thousands of radiotelephone and dispatch channels serving hundreds of thousands of users throughout the U.S.
DC power supplies power management and surge protection for power electronic systems
Kularatna, Nihal
2011-01-01
Modern electronic systems, particularly portable consumer electronic systems and processor based systems, are power hungry, compact, and feature packed. This book presents the most essential summaries of the theory behind DC-DC converter topologies of both linear and switching types. The text discusses power supply characteristics and design specifications based on new developments in power management techniques and modern semiconductors entering into the portable electronics market. The author also addresses off-the-line power supplies, digital control of power supply, power supply protection
Outbreak of viral hemorrhagic fever caused by dengue virus type 3 in Al-Mukalla, Yemen.
Madani, Tariq A; Abuelzein, El-Tayeb M E; Al-Bar, Hussein M S; Azhar, Esam I; Kao, Moujahed; Alshoeb, Haj O; Bamoosa, Alabd R
2013-03-14
Investigations were conducted by the authors to explore an outbreak of viral hemorrhagic fever (VHF) reported in 2010 from Al-Mukalla city, the capital of Hadramout in Yemen. From 15-17 June 2010, the outbreak investigation period, specimens were obtained within 7 days after onset of illness of 18 acutely ill patients hospitalized with VHF and 15 household asymptomatic contacts of 6 acute cases. Additionally, 189 stored sera taken from acutely ill patients with suspected VHF hospitalized in the preceding 12 months were obtained from the Ministry of Health of Yemen. Thus, a total of 222 human specimens were collected; 207 specimens from acute cases and 15 specimens from contacts. All samples were tested with RT-PCR for dengue (DENV), Alkhumra (ALKV), Rift Valley Fever (RVFV), Yellow Fever (YFV), and Chikungunya (CHIKV) viruses. Samples were also tested for DENV IgM, IgG, and NS1-antigen. Medical records of patients were reviewed and demographic, clinical, and laboratory data was collected. Of 207 patients tested, 181 (87.4%) patients were confirmed to have acute dengue with positive dengue NS1-antigen (97 patients, 46.9%) and/or IgM (163 patients, 78.7%). Of the 181 patients with confirmed dengue, 100 (55.2%) patients were IgG-positive. DENV RNA was detected in 2 (1%) patients with acute symptoms; both samples were molecularly typed as DENV type 3. No other VHF viruses were detected. For the 15 contacts tested, RT-PCR tests for the five viruses were negative, one contact was dengue IgM positive, and another one was dengue IgG positive. Of the 181 confirmed dengue patients, 120 (66.3%) patients were males and the median age was 24 years. The most common manifestations included fever (100%), headache (94.5%), backache (93.4%), malaise (88.4%), arthralgia (85.1%), myalgia (82.3%), bone pain (77.9%), and leukopenia (76.2%). Two (1.1%) patients died. DENV-3 was confirmed to be the cause of an outbreak of VHF in Al-Mukalla. It is important to use both IgM and NS1-antigen
Outbreak of viral hemorrhagic fever caused by dengue virus type 3 in Al-Mukalla, Yemen
2013-01-01
Background Investigations were conducted by the authors to explore an outbreak of viral hemorrhagic fever (VHF) reported in 2010 from Al-Mukalla city, the capital of Hadramout in Yemen. Methods From 15–17 June 2010, the outbreak investigation period, specimens were obtained within 7 days after onset of illness of 18 acutely ill patients hospitalized with VHF and 15 household asymptomatic contacts of 6 acute cases. Additionally, 189 stored sera taken from acutely ill patients with suspected VHF hospitalized in the preceding 12 months were obtained from the Ministry of Health of Yemen. Thus, a total of 222 human specimens were collected; 207 specimens from acute cases and 15 specimens from contacts. All samples were tested with RT-PCR for dengue (DENV), Alkhumra (ALKV), Rift Valley Fever (RVFV), Yellow Fever (YFV), and Chikungunya (CHIKV) viruses. Samples were also tested for DENV IgM, IgG, and NS1-antigen. Medical records of patients were reviewed and demographic, clinical, and laboratory data was collected. Results Of 207 patients tested, 181 (87.4%) patients were confirmed to have acute dengue with positive dengue NS1-antigen (97 patients, 46.9%) and/or IgM (163 patients, 78.7%). Of the 181 patients with confirmed dengue, 100 (55.2%) patients were IgG-positive. DENV RNA was detected in 2 (1%) patients with acute symptoms; both samples were molecularly typed as DENV type 3. No other VHF viruses were detected. For the 15 contacts tested, RT-PCR tests for the five viruses were negative, one contact was dengue IgM positive, and another one was dengue IgG positive. Of the 181 confirmed dengue patients, 120 (66.3%) patients were males and the median age was 24 years. The most common manifestations included fever (100%), headache (94.5%), backache (93.4%), malaise (88.4%), arthralgia (85.1%), myalgia (82.3%), bone pain (77.9%), and leukopenia (76.2%). Two (1.1%) patients died. Conclusions DENV-3 was confirmed to be the cause of an outbreak of VHF in Al
Power generation by nuclear power plants
International Nuclear Information System (INIS)
Bacher, P.
2004-01-01
Nuclear power plays an important role in the world, European (33%) and French (75%) power generation. This article aims at presenting in a synthetic way the main reactor types with their respective advantages with respect to the objectives foreseen (power generation, resources valorization, waste management). It makes a fast review of 50 years of nuclear development, thanks to which the nuclear industry has become one of the safest and less environmentally harmful industry which allows to produce low cost electricity: 1 - simplified description of a nuclear power generation plant: nuclear reactor, heat transfer system, power generation system, interface with the power distribution grid; 2 - first historical developments of nuclear power; 3 - industrial development and experience feedback (1965-1995): water reactors (PWR, BWR, Candu), RBMK, fast neutron reactors, high temperature demonstration reactors, costs of industrial reactors; 4 - service life of nuclear power plants and replacement: technical, regulatory and economical lifetime, problems linked with the replacement; 5 - conclusion. (J.S.)
Autonomous power networks based power system
International Nuclear Information System (INIS)
Jokic, A.; Van den Bosch, P.P.J.
2006-01-01
This paper presented the concept of autonomous networks to cope with this increased complexity in power systems while enhancing market-based operation. The operation of future power systems will be more challenging and demanding than present systems because of increased uncertainties, less inertia in the system, replacement of centralized coordinating activities by decentralized parties and the reliance on dynamic markets for both power balancing and system reliability. An autonomous network includes the aggregation of networked producers and consumers in a relatively small area with respect to the overall system. The operation of an autonomous network is coordinated and controlled with one central unit acting as an interface between internal producers/consumers and the rest of the power system. In this study, the power balance problem and system reliability through provision of ancillary services was formulated as an optimization problem for the overall autonomous networks based power system. This paper described the simulation of an optimal autonomous network dispatching in day ahead markets, based on predicted spot prices for real power, and two ancillary services. It was concluded that large changes occur in a power systems structure and operation, most of them adding to the uncertainty and complexity of the system. The introduced concept of an autonomous power network-based power system was shown to be a realistic and consistent approach to formulate and operate a market-based dispatch of both power and ancillary services. 9 refs., 4 figs
An Enhanced Islanding Microgrid Reactive Power, Imbalance Power, and Harmonic Power Sharing Scheme
DEFF Research Database (Denmark)
He, Jinwei; Lin, Yun Wei; Blaabjerg, Frede
2015-01-01
To address inaccurate power sharing problems in autonomous islanding microgrids, an enhanced droop control method through online virtual impedance adjustment is proposed. First, a term associated with DG reactive power, imbalance power, or harmonic power is added to the conventional real power...
Electric power system / emergency power supply
International Nuclear Information System (INIS)
Dorn, P.G.
1980-01-01
One factor of reliability of reactor safety systems is the integrity of the power supply. The purpose of this paper is a review and a discussion of the safety objectives required for the planning, licensing, manufacture and erection of electrical power systems and components. The safety aspects and the technical background of the systems for - the electric auxiliary power supply system and - the emergency power supply system are outlined. These requirements result specially from the safety standards which are the framework for the studies of safety analysis. The overall and specific requirements for the electrical power supply of the safety systems are demonstrated on a 1300 MW standard nuclear power station with a pressurized water reactor. (orig.)
Wind power in modern power systems
DEFF Research Database (Denmark)
Chen, Zhe
2013-01-01
In recent years, wind power is experiencing a rapid growth, and large-scale wind turbines/wind farms have been developed and connected to power systems. However, the traditional power system generation units are centralized located synchronous generators with different characteristics compared...... with wind turbines. This paper presents an overview of the issues about integrating large-scale wind power plants into modern power systems. Firstly, grid codes are introduced. Then, the main technical problems and challenges are presented. Finally, some possible technical solutions are discussed....
Stockholm Power Tech. Power systems
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-01
The proceedings from this symposium is presented in six volumes: Invited speakers` sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume
Stockholm Power Tech. Power systems
International Nuclear Information System (INIS)
1995-01-01
The proceedings from this symposium is presented in six volumes: Invited speakers' sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume
Thermoelectric power generator for variable thermal power source
Bell, Lon E; Crane, Douglas Todd
2015-04-14
Traditional power generation systems using thermoelectric power generators are designed to operate most efficiently for a single operating condition. The present invention provides a power generation system in which the characteristics of the thermoelectrics, the flow of the thermal power, and the operational characteristics of the power generator are monitored and controlled such that higher operation efficiencies and/or higher output powers can be maintained with variably thermal power input. Such a system is particularly beneficial in variable thermal power source systems, such as recovering power from the waste heat generated in the exhaust of combustion engines.
Emergency power systems at nuclear power plants
International Nuclear Information System (INIS)
1982-01-01
This Guide applies to nuclear power plants for which the total power supply comprises normal power supply (which is electric) and emergency power supply (which may be electric or a combination of electric and non-electric). In its present form the Guide provides general guidance for all types of emergency power systems (EPS) - electric and non-electric, and specific guidance (see Appendix A) on the design principles and the features of the emergency electric power system (EEPS). Future editions will include a second appendix giving specific guidance on non-electric power systems. Section 3 of this Safety Guide covers information on considerations that should be taken into account relative to the electric grid, the transmission lines, the on-site electrical supply system, and other alternative power sources, in order to provide high overall reliability of the power supply to the EPS. Since the nuclear power plant operator does not usually control off-site facilities, the discussion of methods of improving off-site reliability does not include requirements for facilities not under the operator's control. Sections 4 to 11 of this Guide provide information, recommendations and requirements that would apply to any emergency power system, be it electric or non-electric
Power Burst Facility: power oscillation problem
International Nuclear Information System (INIS)
Lussie, W.G.; Wadkins, R.P.; Wells, R.A.
1975-01-01
In late 1973 PBF achieved a power level of 15 MW. During this period of operation fluctuations in reactor power were observed. Many possible causes of these fluctuations were considered and a number of nuclear and non-nuclear tests were conducted. Initial instrumentation installed in the core showed coolant outlet temperature variations of 10 0 F for several fuel cannisters and approximately 10 percent power variations at 15 MW. Power spectral density analysis showed a predominant frequency of 0.05 to 0.06 HZ. The testing program to determine the cause of the power oscillations is described
PowerFactory applications for power system analysis
Gonzalez-Longatt, Francisco
2014-01-01
This book presents a comprehensive set of guidelines and applications of DIgSILENT PowerFactory, an advanced power system simulation software package, for different types of power systems studies. Written by specialists in the field, it combines expertise and years of experience in the use of DIgSILENT PowerFactory with a deep understanding of power systems analysis. These complementary approaches therefore provide a fresh perspective on how to model, simulate and analyse power systems. It presents methodological approaches for modelling of system components, including both classical and non-
A Low Cost Single Chip VDL Compatible Transceiver ASIC
Becker, Robert
2004-01-01
Recent trends in commercial communications system components have focussed almost exclusively on cellular telephone technology. As many of the traditional sources of receiver components have discontinued non-cellular telephone products, the designers of avionics and other low volume radio applications find themselves increasingly unable to find highly integrated components. This is particularly true for low power, low cost applications which cannot afford the lavish current consumption of the software defined radio approach increasingly taken by certified device manufacturers. In this paper, we describe a low power transceiver chip targeting applications from low VHF to low UHF frequencies typical of avionics systems. The chip encompasses a selectable single or double conversion design for the receiver and a low power IF upconversion transmitter. All local oscillators are synthesized and integrated into the chip. An on-chip I-Q modulator and demodulator provide baseband modulation and demodulation capability allowing the use of low power, fixed point signal processing components for signal demodulation. The goal of this program is to demonstrate a low cost VDL mode-3 transceiver using this chip to receive text weather information sent using 4-slot TDMA with no support for voice. The data will be sent from an experimental ground station. This work is funded by NASA Glenn Research Center.
Cost of nuclear power generation judged by power rate
International Nuclear Information System (INIS)
Hirai, Takaharu
1981-01-01
According to estimation guidance, power rates in general are the proper cost plus the specific compensation and adjustment addition. However, the current system of power rates is of power-source development promotion type involving its tax. The structure of power rate determination must be restudied now especially in connection of nuclear power generation. The cost of nuclear power generation as viewed from power rate is discussed as follows: the fear of military application of power plants, rising plant construction costs, the loophole in fuel cost calculation, unreasonable unit power cost, depreciation and repair cost, business compensation, undue business compensation in nuclear power, the costs of nuclear waste management, doubt concerning nuclear power cost, personnel, pumping-up and power transmission costs in nuclear power, energy balance analysis, nuclear power viewed in entropy, the suppression of power consumption. (J.P.N.)
DEFF Research Database (Denmark)
He, Jinwei; Li, Yun Wei; Blaabjerg, Frede
2013-01-01
To address inaccurate power sharing problems in autonomous islanding microgrids, an enhanced droop control method through adaptive virtual impedance adjustment is proposed. First, a term associated with DG reactive power, imbalance power or harmonic power is added to the conventional real power...
47 CFR 87.171 - Class of station symbols.
2010-10-01
... RLO—VHF omni-range RLS—Surveillance radar RLT—Radionavigation land test RLW—Microwave landing system RNV—Radio Navigation Land/DME RPC—Ramp Control TJ—Aircraft earth station in the Aeronautical Mobile...
Naderi, F. (Editor)
1982-01-01
A system design for a satellite aided land mobile service is described. The advanced system is based on a geostationary satellite which employs a large UHF reflector to communicate with small user antennas on mobile vehicles. It is shown that the system through multiple beam antennas and frequency reuse provides for radiotelephone and dispatch channels. It is concluded that the system is technologically feasible to provide service to rural and remote regions.
Smart Power Supply for Battery-Powered Systems
Krasowski, Michael J.; Greer, Lawrence; Prokop, Norman F.; Flatico, Joseph M.
2010-01-01
A power supply for battery-powered systems has been designed with an embedded controller that is capable of monitoring and maintaining batteries, charging hardware, while maintaining output power. The power supply is primarily designed for rovers and other remote science and engineering vehicles, but it can be used in any battery alone, or battery and charging source applications. The supply can function autonomously, or can be connected to a host processor through a serial communications link. It can be programmed a priori or on the fly to return current and voltage readings to a host. It has two output power busses: a constant 24-V direct current nominal bus, and a programmable bus for output from approximately 24 up to approximately 50 V. The programmable bus voltage level, and its output power limit, can be changed on the fly as well. The power supply also offers options to reduce the programmable bus to 24 V when the set power limit is reached, limiting output power in the case of a system fault detected in the system. The smart power supply is based on an embedded 8051-type single-chip microcontroller. This choice was made in that a credible progression to flight (radiation hard, high reliability) can be assumed as many 8051 processors or gate arrays capable of accepting 8051-type core presently exist and will continue to do so for some time. To solve the problem of centralized control, this innovation moves an embedded microcontroller to the power supply and assigns it the task of overseeing the operation and charging of the power supply assets. This embedded processor is connected to the application central processor via a serial data link such that the central processor can request updates of various parameters within the supply, such as battery current, bus voltage, remaining power in battery estimations, etc. This supply has a direct connection to the battery bus for common (quiescent) power application. Because components from multiple vendors may have
Compensating active power imbalances in power system with large-scale wind power penetration
DEFF Research Database (Denmark)
Basit, Abdul; Hansen, Anca Daniela; Altin, Müfit
2016-01-01
Large-scale wind power penetration can affectthe supply continuity in the power system. This is a matterof high priority to investigate, as more regulating reservesand specified control strategies for generation control arerequired in the future power system with even more highwind power penetrat...
Military power requirements and backup power considerations
International Nuclear Information System (INIS)
Botts, T.E.
1986-01-01
All US Air Force (USAF) facilities have certain critical power requirements that must be met in order to carry out their mission successfully. Internal USAF studies have shown that the mission can degrade precipitously as the available power decreases below the mission critical level. Now, more than ever before, the military and private industry are finding that certain functions, such as automated data processing and automated process control, respond catastrophically to power reductions. Furthermore, increased reliance on electrical power means, in the case of the Air Force, that critical power requirements are anticipated to increase by half over the next 15 yr. For these reasons and others, the USAF is investigating several means of improving the availability of electric power under adverse conditions above that which can be provided by an off-base supplier. Among the approaches to this problem being pursued at this time are a program to improve all sorts of generator sets on a service-wide basis and the Multimegawatt Terrestrial Power (MTP) Program, which is pursuing the design and testing of a small dedicated nuclear power source to provide critical mission power. The purpose of this paper is to provide some insight into some of the issues associated with USAF power programs
DEFF Research Database (Denmark)
Basit, Abdul; Hansen, Anca Daniela; Sørensen, Poul Ejnar
2017-01-01
Highly wind power integrated power system requires continuous active power regulation to tackle the power imbalances resulting from the wind power forecast errors. The active power balance is maintained in real-time with the automatic generation control and also from the control room, where...... power system model. The power system model takes the hour-ahead regulating power plan from power balancing model and the generation and power exchange capacities for the year 2020 into account. The real-time impact of power balancing in a highly wind power integrated power system is assessed...
Hybrid wind power balance control strategy using thermal power, hydro power and flow batteries
Gelažanskas, Linas; Baranauskas, Audrius; Gamage, Kelum A.A.; Ažubalis, Mindaugas
2016-01-01
The increased number of renewable power plants pose threat to power system balance. Their intermittent nature makes it very difficult to predict power output, thus either additional reserve power plants or new storage and control technologies are required. Traditional spinning reserve cannot fully compensate sudden changes in renewable energy power generation. Using new storage technologies such as flow batteries, it is feasible to balance the variations in power and voltage within very short...
Power manager and method for managing power
Burchard, A.T.; Kersten, G.; Molnos, A.M.; Milutinovic, A.; Goossens, K.G.W.; Steffens, E.F.M.
2009-01-01
A power manager (106) and method for managing the power supplied to an electronic device is provided. Furthermore, a system wherein the power supplied to an electronic device is managed is provided. The power manager (106) is operative to monitor a hardware monitor (104) during a monitoring time
Wireless powering for low-power distributed sensors
Directory of Open Access Journals (Sweden)
Popović Zoya B.
2006-01-01
Full Text Available In this paper, an overview of the field of wireless powering is presented with an emphasis on low-power applications. Several rectenna elements and arrays are discussed in more detail: (1 a 10-GHz array for powering sensors in aircraft wings; (2 a single antenna in the 2.4-GHz ISM band for low-power assisted-living sensors; and (3 a broadband array for power harvesting in the 2-18GHz frequency range.
Original Research Original Research
African Journals Online (AJOL)
RAGHAVENDRA
models over predicted the path losses, while Ericsson. However, Hata, Davidson ... planning tools, required by the radio network designer ... variability in VHF and UHF frequency band ...... Electronics and Computer Science (SCEECS), 2014.
Impacts of Wind Power on Power System Stability
Vittal, E.; Keane, A.; Slootweg, J.G.; Kling, W.L.; Ackermann, T.
2012-01-01
This chapter examines how wind power will impact the stability of power systems. It focuses on the three aspects of power system stability: voltage stability, rotor angle stability and frequency stability. It completes a detailed analysis as to how wind power in power systems will impact the
Irregular ionization and scintillation of the ionosphere in equator region
International Nuclear Information System (INIS)
Shinno, Kenji
1974-01-01
The latest studies on the scintillation in satellite communication and its related irregularities of ionosphere are reviewed. They were made clear by means of spread-F, the direct measurement with scientific satellites, VHF radar observation, and radio wave propagation in equator region. The fundamental occurrence mechanism may be instability of plasma caused by the interaction of movement of neutral atmosphere and magnetic field. Comparison of the main characteristics of scintillation, namely the dependence on region, solar activity, season, local time, geomagnetic activity, movement in ionosphere, scattering source, frequency and transmission mode, was made and the correlation among spread-F, TEP and scintillation was summarized. The latest principal studies were the observations made by Intelsat and by ATS. Scintillation of Syncom-3 and Intelsat-II-F2 and spread-F by ionosphere observation were compared by Huang. It is reasonable to consider that the occurrence of scintillation is caused by the irregularities in ionosphere which are particular in equator region, because of the similar characteristics of spread-F and VHF propagation in the equator region. These three phenomena may occur in relation to the irregularities of ionosphere. Interpretation of spread-F and the abnormal propagation wave across the equator are given. The study using VHF radar and the movement of irregular ionization by the direct observation with artificial satellites are reviewd. (Iwakiri, K.)
Nuclear power/water pumping-up composite power plant
International Nuclear Information System (INIS)
Okamura, Kiyoshi.
1995-01-01
In a nuclear power/water pumping-up composite power plant, a reversible pump for pumping-up power generation connected to a steam turbine is connected to an upper water reservoir and a lower water reservoir. A pumping-up steam turbine for driving the turbine power generator, a hydraulic pump for driving water power generator by water flowing from the upper water reservoir and a steam turbine for driving the pumping-up pump by steams from a nuclear reactor are disposed. When power demand is small during night, the steam turbine is rotated by steams of the reactor, to pump up the water in the lower water reservoir to the upper water reservoir by the reversible pump. Upon peak of power demand during day time, power is generated by the steams of the reactor, as well as the reversible pump is rotated by the flowing water from the upper water reservoir to conduct hydraulic power generation. Alternatively, hydraulic power generation is conducted by flowing water from the upper reservoir. Since the number of energy conversion steps in the combination of nuclear power generation and pumping-up power generation is reduced, energy loss is reduced and utilization efficiency can be improved. (N.H.)
Comprehensive Power Losses Model for Electronic Power Transformer
DEFF Research Database (Denmark)
Yue, Quanyou; Li, Canbing; Cao, Yijia
2018-01-01
and considering the impact of the non-unity power factor and the three-phase unbalanced current, the overall power losses in the distribution network when using the EPT to replace the conventional transformer is analyzed, and the conditions in which the application of the EPT can cause less power losses...... reduced power losses in the distribution network require a comprehensive consideration when comparing the power losses of theEPT and conventional transformer. In this paper, a comprehensive power losses analysis model for the EPT in distribution networks is proposed. By analyzing the EPT self-losses......The electronic power transformer (EPT) has highe rpower losses than the conventional transformer. However, the EPT can correct the power factor, compensate the unbalanced current and reduce the line power losses in the distribution network.Therefore, the higher losses of the EPT and the consequent...
Comprehensive Power Losses Model for Electronic Power Transformer
DEFF Research Database (Denmark)
Yue, Quanyou; Li, Canbing; Cao, Yijia
2018-01-01
The electronic power transformer (EPT) has highe rpower losses than the conventional transformer. However, the EPT can correct the power factor, compensate the unbalanced current and reduce the line power losses in the distribution network.Therefore, the higher losses of the EPT and the consequent...... reduced power losses in the distribution network require a comprehensive consideration when comparing the power losses of theEPT and conventional transformer. In this paper, a comprehensive power losses analysis model for the EPT in distribution networks is proposed. By analyzing the EPT self......-losses and considering the impact of the non-unity power factor and the three-phase unbalanced current, the overall power losses in the distribution network when using the EPT to replace the conventional transformer is analyzed, and the conditions in which the application of the EPT can cause less power losses...
Selectivity of power system protections at power swings in power system
Directory of Open Access Journals (Sweden)
Jan Machowski
2012-12-01
Full Text Available The paper discusses out-of-step protection systems such as: generator pole slip protections, out of step tripping protections, distance protections of step-up transformer, distance protections of transmission lines and transformers, power swing blocking, and special out-of-step protection. It is shown that all these protections make up a protection system, to which a setting concept uniform for the entire power system has to be applied. If a power system is inappropriately equipped with these protections, or their settings are inappropriate, they may operate unselectively, thus contributing to the development of power system blackouts. In the paper the concepts for a real power system are given for the two stages: target stage fully compliant with selectivity criteria, and transitional stage between the current and target stages.
Power Ramp Limitation capabilities of Large PV Power Plants with Active Power Reserves
DEFF Research Database (Denmark)
Bogdan, Craciun; Kerekes, Tamas; Sera, Dezso
2017-01-01
Power Ramp Limitation (PRL) is likely to become a requirement for large scale photovoltaic power plants (LPVPPs) in order to allow the increase of PV penetration levels. Especially in islands with reduced inertia capability, this problem is more stringent: high power ramp can be caused by either...... fast irradiance changes or other participant generators for example wind power, or loads. In order to compensate for the power mismatch, LPVPPs must use Active Power Reserve (APR), by either curtailment or auxiliary storage. The paper proposes a PRL control structure for dynamic APR sizing...... and deployment. The selected test case is the power system of Puerto Rico (PREPA), modeled using the modified IEEE 12 bus benchmark system, with different levels of PV penetration. It is shown that LPVPP with PRL can effectively reduce the ramping rate of the participating generators. Considering that the large...
Temperature sheets and aspect sensitive radar echoes
Directory of Open Access Journals (Sweden)
H. Luce
Full Text Available here have been years of discussion and controversy about the existence of very thin and stable temperature sheets and their relationship to the VHF radar aspect sensitivity. It is only recently that very high-resolution in situ temperature observations have brought credence to the reality and ubiquity of these structures in the free atmosphere and to their contribution to radar echo enhancements along the vertical. Indeed, measurements with very high-resolution sensors are still extremely rare and rather difficult to obtain outside of the planetary boundary layer. They have only been carried out up to the lower stratosphere by Service d’A´ eronomie (CNRS, France for about 10 years. The controversy also persisted due to the volume resolution of the (Mesosphere-Stratosphere-Troposphere VHF radars which is coarse with respect to sheet thickness, although widely sufficient for meteorological or mesoscale investigations. The contribution within the range gate of many of these structures, which are advected by the wind, and decay and grow at different instants and could be distorted either by internal gravity waves or turbulence fields, could lead to radar echoes with statistical properties similar to those produced by anisotropic turbulence. Some questions thus remain regarding the manner in which temperature sheets contribute to VHF radar echoes. In particular, the zenithal and azimuthal angular dependence of the echo power may not only be produced by diffuse reflection on stable distorted or corrugated sheets, but also by extra contributions from anisotropic turbulence occurring in the stratified atmosphere. Thus, for several years, efforts have been put forth to improve the radar height resolution in order to better describe thin structures. Frequency interferometric techniques are widely used and have been recently further developed with the implementation of high-resolution data processings. We begin by reviewing briefly some characteristics
Temperature sheets and aspect sensitive radar echoes
Directory of Open Access Journals (Sweden)
H. Luce
2001-08-01
Full Text Available here have been years of discussion and controversy about the existence of very thin and stable temperature sheets and their relationship to the VHF radar aspect sensitivity. It is only recently that very high-resolution in situ temperature observations have brought credence to the reality and ubiquity of these structures in the free atmosphere and to their contribution to radar echo enhancements along the vertical. Indeed, measurements with very high-resolution sensors are still extremely rare and rather difficult to obtain outside of the planetary boundary layer. They have only been carried out up to the lower stratosphere by Service d’A´ eronomie (CNRS, France for about 10 years. The controversy also persisted due to the volume resolution of the (Mesosphere-Stratosphere-Troposphere VHF radars which is coarse with respect to sheet thickness, although widely sufficient for meteorological or mesoscale investigations. The contribution within the range gate of many of these structures, which are advected by the wind, and decay and grow at different instants and could be distorted either by internal gravity waves or turbulence fields, could lead to radar echoes with statistical properties similar to those produced by anisotropic turbulence. Some questions thus remain regarding the manner in which temperature sheets contribute to VHF radar echoes. In particular, the zenithal and azimuthal angular dependence of the echo power may not only be produced by diffuse reflection on stable distorted or corrugated sheets, but also by extra contributions from anisotropic turbulence occurring in the stratified atmosphere. Thus, for several years, efforts have been put forth to improve the radar height resolution in order to better describe thin structures. Frequency interferometric techniques are widely used and have been recently further developed with the implementation of high-resolution data processings. We begin by reviewing briefly some characteristics
Indian Academy of Sciences (India)
Hertz abbreviated Hz) experimentally produced electromag- netic waves .... factors. Radio waves with higher frequencies penetrate through ionosphere and escape from Earth. VHF/UHF ..... His Majesty, Edward VII, London, England. I n taking ...
Directory of Open Access Journals (Sweden)
Abdul Basit
2014-10-01
Full Text Available Transmission system operators have an increased interest in the active participation of wind power plants (WPP in the power balance control of power systems with large wind power penetration. The emphasis in this study is on the integration of WPPs into the automatic generation control (AGC of the power system. The present paper proposes a coordinated control strategy for the AGC between combined heat and power plants (CHPs and WPPs to enhance the security and the reliability of a power system operation in the case of a large wind power penetration. The proposed strategy, described and exemplified for the future Danish power system, takes the hour-ahead regulating power plan for generation and power exchange with neighbouring power systems into account. The performance of the proposed strategy for coordinated secondary control is assessed and discussed by means of simulations for different possible future scenarios, when wind power production in the power system is high and conventional production from CHPs is at a minimum level. The investigation results of the proposed control strategy have shown that the WPPs can actively help the AGC, and reduce the real-time power imbalance in the power system, by down regulating their production when CHPs are unable to provide the required response.
DEFF Research Database (Denmark)
Basit, Abdul; Hansen, Anca Daniela; Altin, Müfit
2014-01-01
Transmission system operators have an increased interest in the active participation of wind power plants (WPP) in the power balance control of power systems with large wind power penetration. The emphasis in this study is on the integration of WPPs into the automatic generation control (AGC......) of the power system. The present paper proposes a coordinated control strategy for the AGC between combined heat and power plants (CHPs) and WPPs to enhance the security and the reliability of a power system operation in the case of a large wind power penetration. The proposed strategy, described...... and exemplified for the future Danish power system, takes the hour-ahead regulating power plan for generation and power exchange with neighbouring power systems into account. The performance of the proposed strategy for coordinated secondary control is assessed and discussed by means of simulations for different...
A Review of Power Electronics for Wind Power
Institute of Scientific and Technical Information of China (English)
Zhe CHEN
2011-01-01
The paper reviews the power electronic applications for wind energy systems.Main wind turbine systems with different generators and power electronic converters are described.The electrical topologies of wind farms with power electronic conversion are discussed.Power electronic applications for improving the performance of wind turbines and wind farms in power systems have been illustrated.
DEFF Research Database (Denmark)
Elmholdt, Claus Westergård; Fogsgaard, Morten
2016-01-01
and creativity suggests that when managers give people the opportunity to gain power and explicate that there is reason to be more creative, people will show a boost in creative behaviour. Moreover, this process works best in unstable power hierarchies, which implies that power is treated as a negotiable....... It is thus a central point that power is not necessarily something that breaks down and represses. On the contrary, an explicit focus on the dynamics of power in relation to creativity can be productive for the organisation. Our main focus is to elaborate the implications of this for practice and theory...
Dynamic influences of wind power on the power system
Energy Technology Data Exchange (ETDEWEB)
Rosas, Pedro
2003-03-01
The thesis first presents the basics influences of wind power on the power system stability and quality by pointing out the main power quality issues of wind power in a small-scale case and following, the expected large-scale problems are introduced. Secondly, a dynamic wind turbine model that supports power quality assessment of wind turbines is presented. Thirdly, an aggregate wind farm model that support power quality and stability analysis from large wind farms is presented. The aggregate wind farm model includes the smoothing of the relative power fluctuation from a wind farm compared to a single wind turbine. Finally, applications of the aggregate wind farm model to the power systems are presented. The power quality and stability characteristics influenced by large-scale wind power are illustrated with three cases. In this thesis, special emphasis has been given to appropriate models to represent the wind acting on wind farms. The wind speed model to a single wind turbine includes turbulence and tower shadow effects from the wind and the rotational sampling turbulence due to the rotation of the blades. In a park scale, the wind speed model to the wind farm includes the spatial coherence between different wind turbines. Here the wind speed model is applied to a constant rotational speed wind turbine/farm, but the model is suitable to variable speed wind turbine/farm as well. The cases presented here illustrate the influences of the wind power on the power system quality and stability. The flicker and frequency deviations are the main power quality parameters presented. The power system stability concentrates on the voltage stability and on the power system oscillations. From the cases studied, voltage and the frequency variations were smaller than expected from the large-scale wind power integration due to the low spatial correlation of the wind speed. The voltage quality analysed in a Brazilian power system and in the Nordel power system from connecting large
AC Power Local Network with Multiple Power Routers
Directory of Open Access Journals (Sweden)
Ryo Takahashi
2013-12-01
Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.
Similarities and differences between conventional power and nuclear power
International Nuclear Information System (INIS)
Wang Yingrong
2011-01-01
As the implementation of the national guideline of 'proactively promoting nuclear power development', especially after China decided in 2006 to introduce Westinghouse's AP1000 technology, some of the power groups specialized in conventional power generation, have been participating in the preliminary work and construction of nuclear power projects in certain degrees. Meanwhile, such traditional nuclear power corporations as China National Nuclear Corporation (CNNC) and China Guangdong Nuclear Power Corporation (CGNPC) have also employed some employees with conventional power generation experience. How can these employees who have long been engaged in conventional power generation successfully adapt to the new work pattern, ideology, knowledge, thinking mode and proficiency of nuclear power, so that they can fit in with the work requirements of nuclear power and become qualified as soon as possible? By analyzing the technological, managerial and cultural features of nuclear power, as well as some issues to be kept in mind when engaged in nuclear power, this paper intends to make some contribution to the nuclear power development in the specific period. (author)
Tian, Y.; Zheng, Y.; Zheng, C.; Han, F., Sr.
2017-12-01
Physically based and fully-distributed integrated hydrological models (IHMs) can quantitatively depict hydrological processes, both surface and subsurface, with sufficient spatial and temporal details. However, the complexity involved in pre-processing data and setting up models seriously hindered the wider application of IHMs in scientific research and management practice. This study introduces our design and development of Visual HEIFLOW, hereafter referred to as VHF, a comprehensive graphical data processing and modeling system for integrated hydrological simulation. The current version of VHF has been structured to accommodate an IHM named HEIFLOW (Hydrological-Ecological Integrated watershed-scale FLOW model). HEIFLOW is a model being developed by the authors, which has all typical elements of physically based and fully-distributed IHMs. It is based on GSFLOW, a representative integrated surface water-groundwater model developed by USGS. HEIFLOW provides several ecological modules that enable to simulate growth cycle of general vegetation and special plants (maize and populus euphratica). VHF incorporates and streamlines all key steps of the integrated modeling, and accommodates all types of GIS data necessary to hydrological simulation. It provides a GIS-based data processing framework to prepare an IHM for simulations, and has functionalities to flexibly display and modify model features (e.g., model grids, streams, boundary conditions, observational sites, etc.) and their associated data. It enables visualization and various spatio-temporal analyses of all model inputs and outputs at different scales (i.e., computing unit, sub-basin, basin, or user-defined spatial extent). The above system features, as well as many others, can significantly reduce the difficulty and time cost of building and using a complex IHM. The case study in the Heihe River Basin demonstrated the applicability of VHF for large scale integrated SW-GW modeling. Visualization and spatial
Investigation of an isolated case of human Crimean–Congo hemorrhagic fever in Central Uganda, 2015
Directory of Open Access Journals (Sweden)
Stephen Balinandi
2018-03-01
Full Text Available Background: Crimean–Congo hemorrhagic fever (CCHF is the most geographically widespread tick-borne viral infection. Outbreaks of CCHF in sub-Saharan Africa are largely undetected and thus under-reported. On November 9, 2015, the National Viral Hemorrhagic Fever Laboratory at the Uganda Virus Research Institute received an alert for a suspect VHF case in a 33-year-old male who presented with VHF compatible signs and symptoms at Mengo Hospital in Kampala. Methods: A blood sample from the suspect patient was tested by RT-PCR for CCHF and found positive. Serological testing on sequential blood specimens collected from this patient showed increasing anti-CCHFV IgM antibody titers, confirming recent infection. Repeat sampling of the confirmed case post recovery showed high titers for anti-CCHFV-specific IgG. An epidemiological outbreak investigation was initiated following the initial RT-PCR positive detection to identify any additional suspect cases. Results: Only a single acute case of CCHF was detected from this outbreak. No additional acute CCHF cases were identified following field investigations. Environmental investigations collected 53 tick samples, with only 1, a Boophilus decoloratus, having detectable CCHFV RNA by RT-PCR. Full-length genomic sequencing on a viral isolate from the index human case showed the virus to be related to the DRC (Africa 2 lineage. Conclusions: This is the fourth confirmed CCHF outbreak in Uganda within 2 years after more than 50 years of no reported human CCHF cases in this country. Our investigations reaffirm the endemicity of CCHFV in Uganda, and show that exposure to ticks poses a significant risk for human infection. These findings also reflect the importance of having an established national VHF surveillance system and diagnostic capacity in a developing country like Uganda, in order to identify the first cases of VHF outbreaks and rapidly respond to reduce secondary cases. Additional efforts should focus on
Balancing modern Power System with large scale of wind power
DEFF Research Database (Denmark)
Basit, Abdul; Altin, Müfit; Hansen, Anca Daniela
2014-01-01
Power system operators must ensure robust, secure and reliable power system operation even with a large scale integration of wind power. Electricity generated from the intermittent wind in large propor-tion may impact on the control of power system balance and thus deviations in the power system...... frequency in small or islanded power systems or tie line power flows in interconnected power systems. Therefore, the large scale integration of wind power into the power system strongly concerns the secure and stable grid operation. To ensure the stable power system operation, the evolving power system has...... to be analysed with improved analytical tools and techniques. This paper proposes techniques for the active power balance control in future power systems with the large scale wind power integration, where power balancing model provides the hour-ahead dispatch plan with reduced planning horizon and the real time...
Eccles, William
2008-01-01
Pragmatic Power is focused on just three aspects of the AC electrical power system that supplies and moves the vast majority of electrical energy nearly everywhere in the world: three-phase power systems, transformers, and induction motors. The reader needs to have had an introduction to electrical circuits and AC power, although the text begins with a review of the basics of AC power. Balanced three-phase systems are studied by developing their single-phase equivalents. The study includes a look at how the cost of ""power"" is affected by reactive power and power factor. Transformers are cons
Power System Operation with Large Scale Wind Power Integration
DEFF Research Database (Denmark)
Suwannarat, A.; Bak-Jensen, B.; Chen, Z.
2007-01-01
to the uncertain nature of wind power. In this paper, proposed models of generations and control system are presented which analyze the deviation of power exchange at the western Danish-German border, taking into account the fluctuating nature of wind power. The performance of the secondary control of the thermal......The Danish power system starts to face problems of integrating thousands megawatts of wind power, which produce in a stochastic behavior due to natural wind fluctuations. With wind power capacities increasing, the Danish Transmission System Operator (TSO) is faced with new challenges related...... power plants and the spinning reserves control from the Combined Heat and Power (CHP) units to achieve active power balance with the increased wind power penetration is presented....
Investigating power control in autonomous power systems with increasing wind power penetration
Energy Technology Data Exchange (ETDEWEB)
Margaris, Ioannis D. [National Technical Univ. of Athens (Greece). Electric Energy Systems Lab.; Hansen, Anca D.; Sorensen, Poul [Risoe National Laboratory, Roskilde (Denmark). Wind Energy Dept.; Hatziargyriou, Nikos D. [National Technical Univ. of Athens (Greece). Electric Energy Systems Lab.; Public Power Corporation S.A., Athens (Greece)
2009-07-01
Increasing levels of wind penetration in autonomous power systems has set intensively high standards with respect to wind turbine technology during the last years. Special features of non-interconnected power systems make security issues rather critical, as the operation of large wind farms like conventional power plants is becoming a necessity. This paper includes the study case of Rhodos island, in Greece, where rapidly increasing wind penetration has started to impose serious security issues for the immediate future. The scenarios studied here correspond to reference year of study 2012 and include wind farms with three different wind turbine technologies - namely Doubly Fed Induction Generator (DFIG), Permanent Magnet Synchronous Generator (PMSG) and Active Stall Induction Generator (ASIG) based wind turbines. Aggregated models of the wind farms are being used and results for different load cases are being analyzed and discussed. The ability of wind farms to assist in some of the power system control services traditionally carried out by conventional synchronous generation is being investigated and discussed. The power grid of the island, including speed governors and automatic voltage regulators, is simulated in the dedicated power system simulation program Power Factory from DIgSILENT. (orig.)
Williams, Melissa J; Gruenfeld, Deborah H; Guillory, Lucia E
2017-02-01
Previous theorists have characterized sexually aggressive behavior as an expression of power, yet evidence that power causes sexual aggression is mixed. We hypothesize that power can indeed create opportunities for sexual aggression-but that it is those who chronically experience low power who will choose to exploit such opportunities. Here, low-power men placed in a high-power role showed the most hostility in response to a denied opportunity with an attractive woman (Studies 1 and 2). Chronically low-power men and women given acute power were the most likely to say they would inappropriately pursue an unrequited workplace attraction (Studies 3 and 4). Finally, having power over an attractive woman increased harassment behavior among men with chronic low, but not high, power (Study 5). People who see themselves as chronically denied power appear to have a stronger desire to feel powerful and are more likely to use sexual aggression toward that end. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Power system stabilizer control for wind power to enhance power system stability
Domínguez García, José Luís; Gomis Bellmunt, Oriol; Bianchi, Fernando Daniel; Sumper, Andreas
2011-01-01
The paper presents a small signal stability analysis for power systems with wind farm interaction. Power systems have damping oscillation modes that can be excited by disturbance or fault in the grid. The power converters of the wind farms can be used to reduce these oscillations and make the system more stable. These ideas are explored to design a power system stabilized (PSS) for a network with conventional generators and a wind farm in order to increase the damping of the oscillation...
Wind farm - A power source in future power systems
DEFF Research Database (Denmark)
Chen, Zhe; Blaabjerg, Frede
2009-01-01
wind turbines and wind farms, and then introduces the wind power development and wind farms. An optimization platform for designing electrical systems of offshore wind farms is briefed. The major issues related to the grid connection requirements and the operation of wind turbines/farms in power......The paper describes modern wind power systems, introduces the issues of large penetration of wind power into power systems, and discusses the possible methods of making wind turbines/farms act as a power source, like conventional power plants in power systems. Firstly, the paper describes modern...... systems are illustrated....
Low Power Design with High-Level Power Estimation and Power-Aware Synthesis
Ahuja, Sumit; Shukla, Sandeep Kumar
2012-01-01
Low-power ASIC/FPGA based designs are important due to the need for extended battery life, reduced form factor, and lower packaging and cooling costs for electronic devices. These products require fast turnaround time because of the increasing demand for handheld electronic devices such as cell-phones, PDAs and high performance machines for data centers. To achieve short time to market, design flows must facilitate a much shortened time-to-product requirement. High-level modeling, architectural exploration and direct synthesis of design from high level description enable this design process. This book presents novel research techniques, algorithms,methodologies and experimental results for high level power estimation and power aware high-level synthesis. Readers will learn to apply such techniques to enable design flows resulting in shorter time to market and successful low power ASIC/FPGA design. Integrates power estimation and reduction for high level synthesis, with low-power, high-level design; Shows spec...
A Review of Power Electronics for Wind Power
DEFF Research Database (Denmark)
Chen, Zhe
2011-01-01
The paper reviews the power electronic applications for wind energy systems. Main wind turbine systems with different generators and power electronic converters are described. The electrical topologies of wind farms with power electronic conversion are discussed. Power electronic applications...
Drewes, A M; Andreasen, A; Assentoft, J E; Nagel, O
1993-09-01
A seven-channel telemetry system for collection and display of biological data is presented. The system can amplify bioelectrical signals in the range of 2 microV to 200 mV and has a bandwidth of 0.1-80 Hz. After multiplexing, the signals are digitized with a resolution of 8 bits. The data are frequency modulated directly on a VHF transmitter. After receiving the data on a VHF receiver, they are routed directly to the RS232 input connector on the PC. Thereby the advantage of direct communication between the transmitter and the PC can be utilized. Expensive analog equipment is avoided and display of the signals on the PC screen as well as signal analysis can be performed. The system has been tested and was found to be stable and highly reliable.
Viral haemorrhagic fever and vascular alterations.
Aleksandrowicz, P; Wolf, K; Falzarano, D; Feldmann, H; Seebach, J; Schnittler, H
2008-02-01
Pathogenesis of viral haemorrhagic fever (VHF) is closely associated with alterations of the vascular system. Among the virus families causing VHF, filoviruses (Marburg and Ebola) are the most fatal, and will be focused on here. After entering the body, Ebola primarily targets monocytes/macrophages and dendritic cells. Infected dendritic cells are largely impaired in their activation potency, likely contributing to the immune suppression that occurs during filovirus infection. Monocytes/macrophages, however, immediately activate after viral contact and release reasonable amounts of cytokines that target the vascular system, particularly the endothelial cells. Some underlying molecular mechanisms such as alteration of the vascular endothelial cadherin/catenin complex, tyrosine phosphorylation, expression of cell adhesion molecules, tissue factor and the effect of soluble viral proteins released from infected cells to the blood stream will be discussed.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
This report on behalf of the Swiss Federal Office of Energy (SFOE) describes Phase IV of the project to test the feasibility and usefulness of Very High Frequency (VHF) plasma operation in large-area reactors suitable for the production of solar cell panels using thinly-deposited micro-crystalline silicon films. The report discusses the results of fast-deposition tests and trials using high-current DC arcs and VHF techniques to obtain deposition rates and film quality suitable for industrial processes for the production of thin-film solar cell panels. The effects of alternative plasma chemistry were also studied by adding silicon tetrafluoride to the standard silane/hydrogen mixtures. The report is concluded with calculations for optimum radio-frequency (RF) contact configuration for large area reactors with 1 m{sup 2} electrodes.
Power generation costs. Coal - nuclear power
International Nuclear Information System (INIS)
1979-01-01
This supplement volume contains 17 separate chapters investigating the parameters which determine power generation costs on the basis of coal and nuclear power and a comparison of these. A detailed calculation model is given. The complex nature of this type of cost comparison is shown by a review of selected parameter constellation for coal-fired and nuclear power plants. The most favourable method of power generation can only be determined if all parameters are viewed together. One quite important parameter is the load factor, or rather the hours of operation. (UA) 891 UA/UA 892 AMO [de
Initial Results from CASSIOPE/ePOP Satellite Overpasses above HAARP in 2014
Siefring, C. L.; Bernhardt, P. A.; Briczinski, S. J., Jr.; James, H. G.; Yau, A. W.; Knudsen, D. J.
2015-12-01
The High Frequency Active Auroral Research Program (HAARP) facility was operated in conjunction with overpasses of the enhanced Polar Outflow Probe (ePOP) instruments on the Canadian CASSIOPE satellite. During these overpasses HAARP was operated in several different heating modes and regimes as diagnosed by the characteristics of Stimulated Electromagnetic Emissions (SEE) using ground-based receivers while simultaneously ePOP monitored in-situ HF and VLF signals, looked for ion and electron heating, and provided VHF and UHF signals for propagation effects studies. The e-POP suite of instruments and particularly the ePOP Radio Receiver Instrument (RRI) offer a unique combination diagnostics appropriate for studying the non-linear plasma effects generated high-power HF waves in the ionosphere. In this presentation, the initial results from ePOP observations from two separate 2014 measurement campaigns at HAARP (April 16 to April 29 and May 25 to June 9) will be discussed. Several innovative experiments were performed during the campaign. Experiments explored a wide range of ionospheric effects. These include: 1) Penetration of HF pump waves into the ionosphere via large and small scale irregularities, 2) effects of gyro-harmonic heating and artificial ionization layers, 3) effects of HAARP beam shape with O- and X-mode transmissions, 4) coupling of Lower Hybrid modes into Whistler waves, 5) D/E-region VLF generation in the ionosphere using VLF modulation of the HF pump 6) scattering of VHF and UHF signals and 7) scattering and non-linear modulation of a 9.5 MHz probe wave propagating through the region of the ionosphere modified by HAARP. This work supported by the Naval Research Laboratory Base Program.
DEFF Research Database (Denmark)
Iov, Florin; Ciobotaru, Mihai; Blaabjerg, Frede
2008-01-01
is to change the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. The other is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most...... emerging renewable energy sources, wind energy, which by means of power electronics are changing from being a minor energy source to be acting as an important power source in the energy system. Power electronics is the enabling technology and the presentation will cover the development in wind turbine...... technology from kW to MW, discuss which power electronic solutions are most feasible and used today....
Nuclear and thermal power plant power ramping capability
International Nuclear Information System (INIS)
Golovach, E.A.
1983-01-01
The possibilities of step power increase by NPP and TPP units under emergency conditions of power grids operation are considered. The data analysis has shown that power units ramping capability with WWER-440, WWER-1000 and RBMK-1000 reactors is higher than that of 300 MW power units on fossil fuel, at the initial time interval (0-30 s). These NPP power units satisfy as to ramping capability the energy system requirements. Higher NPP power units ramping capability is explained by the fact that relative pressure before turbine valves is decreased less than in straight-through boilers while the steam volumes time constant of steam separator-superheaters is less than that of intermediate superheatings. Higher power unit ramping capability with WWER-440 and RBMK-1000 reactors as compared with the WWER-1000 reactor is pointed out as well as the increase of WWER-1000 power unit capability using high-speed turbines
Some power uprate issues in nuclear power plants
International Nuclear Information System (INIS)
Tipping, Philip
2008-01-01
Issues and themes concerned with nuclear power plant uprating are examined. Attention is brought to the fact that many candidate nuclear power plants for uprating have anyway been operated below their rated power for a significant part of their operating life. The key issues remain safety and reliability in operation at all times, irrespective of the nuclear power plant's chronological or design age or power rating. The effects of power uprates are discussed in terms of material aspects and expected demands on the systems, structures and components. The impact on operation and maintenance methods is indicated in terms of changes to the ageing surveillance programmes. Attention is brought to the necessity checking or revising operator actions after power up-rating has been implemented
Power market model with energy- and power dimension
International Nuclear Information System (INIS)
Johnsen, T.A.; Larsen, B.M.
1995-01-01
This report discusses a mathematical model of the Norwegian power market. The year is divided into three seasons. Each season is subdivided into a high-load period and a low-load period according to the demand. High-load occurs in daytime on workdays while low-load occurs at night and on holidays. The model is intended to be a tool for studying variations in prices, production, demand and trade throughout the year in a market of free competition. The model establishes equilibrium prices of electricity in Norway in high-load and low-load periods. Equilibrium prices with added transport tariffs and charges give customer an indication of the cost of using electricity. And the equilibrium prices indicate to the power producers the value of further energy or power capacity. Examples of calculations using the model show that extended export and import between Norway and other countries affect power prices and production in Norway. In the examples, power intensive industry and wood processing are subjected to market prices on energy. World market prices which give unilateral power export in the high-load periods cause the Norwegian power prices to rise strongly. If to the export from Norway in periods of high-load there corresponds import in periods of low-load, then the pressure on the prices in the power market is significantly reduced. A more extensive power exchange implies that foreign power producers may use the Norwegian power system to avoid large variations in their thermal power production. 23 refs., 21 figs., 1 tab
Fuel-cell based power generating system having power conditioning apparatus
Mazumder, Sudip K.; Pradhan, Sanjaya K.
2010-10-05
A power conditioner includes power converters for supplying power to a load, a set of selection switches corresponding to the power converters for selectively connecting the fuel-cell stack to the power converters, and another set of selection switches corresponding to the power converters for selectively connecting the battery to the power converters. The power conveners output combined power that substantially optimally meets a present demand of the load.
High impact data visualization with Power View, Power Map, and Power BI
Aspin, Adam
2014-01-01
High Impact Data Visualization with Power View, Power Map, and Power BI helps you take business intelligence delivery to a new level that is interactive, engaging, even fun, all while driving commercial success through sound decision-making. Learn to harness the power of Microsoft's flagship, self-service business intelligence suite to deliver compelling and interactive insight with remarkable ease. Learn the essential techniques needed to enhance the look and feel of reports and dashboards so that you can seize your audience's attention and provide them with clear and accurate information. Al
Nuclear power and other thermal power
International Nuclear Information System (INIS)
Bakke, J.
1978-01-01
Some philosophical aspects of mortality statistics are first briefly mentioued, then the environmental problems of, first, nuclear power plants, then fossil fuelled power plants are summarised. The effects of releases of carbon dioxide, sulphur dioxide and nitrogen oxides are briefly discussed. The possible health effects of radiation from nuclear power plants and those of gaseous and particulate effluents from fossil fuel plants are also discussed. It is pointed out that in choosing between alternative evils the worst course is to make no choice at all, that is, failure to install thermal power plants will lead to isolated domestic burning of fossil fuels which is clearly the worst situation regarding pollution. (JIW)
Directory of Open Access Journals (Sweden)
Zhongfu Tan
2018-01-01
Full Text Available For the virtual power plants containing energy storage power stations and photovoltaic and wind power, the output of PV and wind power is uncertain and virtual power plants must consider this uncertainty when they participate in the auction in the electricity market. In this context, this paper studies the bidding strategy of the virtual power plant with photovoltaic and wind power. Assuming that the upper and lower limits of the combined output of photovoltaic and wind power are stochastically variable, the fluctuation range of the day-ahead energy market and capacity price is stochastically variable. If the capacity of the storage station is large enough to stabilize the fluctuation of the output of the wind and photovoltaic power, virtual power plants can participate in the electricity market bidding. This paper constructs a robust optimization model of virtual power plant bidding strategy in the electricity market, which considers the cost of charge and discharge of energy storage power station and transmission congestion. The model proposed in this paper is solved by CPLEX; the example results show that the model is reasonable and the method is valid.
Power Quality in DC Power Distribution Systems and Microgrids
Directory of Open Access Journals (Sweden)
Stephen Whaite
2015-05-01
Full Text Available This review paper discusses power quality considerations for direct current (DC electric power distribution systems, particularly DC microgrids. First, four selected sample DC architectures are discussed to provide motivation for the consideration of power quality in DC systems. Second, a brief overview of power quality challenges in conventional alternating current (AC distribution systems is given to establish the field of power quality. Finally, a survey of literature addressing power quality issues in DC systems is presented, and necessary power quality considerations in DC distribution system design and operation are discussed.
Economic Operation of Power Systems with Significant Wind Power Penetration
DEFF Research Database (Denmark)
Farashbashi-Astaneh, Seyed-Mostafa
This dissertation addresses economic operation of power systems with high penetration of wind power. Several studies are presented to address the economic operation of power systems with high penetration of variable wind power. The main concern in such power systems is high variability...... and unpredictability. Unlike conventional power plants, the output power of a wind farm is not controllable. This brings additional complexity to operation and planning of wind dominant power systems. The key solution in face of wind power uncertainty is to enhance power system flexibility. The enhanced flexibility......, cooperative wind-storage operation is studied. Lithium-Ion battery units are chosen as storage units. A novel formulation is proposed to investigate optimal operation of a storage unit considering power system balancing conditions and wind power imbalances. An optimization framework is presented to increase...
Liberation of electric power and nuclear power generation
International Nuclear Information System (INIS)
Yajima, Masayuki
2000-01-01
In Japan, as the Rule on Electric Business was revised after an interval of 35 years in 1995, and a competitive bid on new electric source was adopted after 1996 fiscal year, investigation on further competition introduction to electric power market was begun by establishment of the Basic Group of the Electric Business Council in 1997. By a report proposed on January, 1999 by the Group, the Rule was revised again on March, 1999 to start a partial liberation or retail of the electric power from March, 2000. From a viewpoint of energy security and for solution of global environmental problem in Japan it has been decided to positively promote nuclear power in future. Therefore, it is necessary to investigate how the competition introduction affects to development of nuclear power generation and what is a market liberation model capable of harmonizing with the development on liberation of electric power market. Here was elucidated on effect of the introduction on previous and future nuclear power generation, after introducing new aspects of nuclear power problems and investigating characteristic points and investment risks specific to the nuclear power generation. And, by investigating some possibilities to development of nuclear power generation under liberation models of each market, an implication was shown on how to be future liberation on electric power market in Japan. (G.K.)
Balancing computation and communication power in power constrained clusters
Piga, Leonardo; Paul, Indrani; Huang, Wei
2018-05-29
Systems, apparatuses, and methods for balancing computation and communication power in power constrained environments. A data processing cluster with a plurality of compute nodes may perform parallel processing of a workload in a power constrained environment. Nodes that finish tasks early may be power-gated based on one or more conditions. In some scenarios, a node may predict a wait duration and go into a reduced power consumption state if the wait duration is predicted to be greater than a threshold. The power saved by power-gating one or more nodes may be reassigned for use by other nodes. A cluster agent may be configured to reassign the unused power to the active nodes to expedite workload processing.
Nigerian Journal of Technology - Vol 32, No 2 (2013)
African Journals Online (AJOL)
Alternative First Principle Approach for Determination of Elements of Beam Stiffness ... Characterization of Propagation Path Loss at Vhf/Uhf Bands for Ilorin City, ... of Spatial Distribution Properties of Mid-Infrared Quantum Cascade Lasers at 7 ...
Critical success factors for BOT electric power projects in China: Thermal power versus wind power
Energy Technology Data Exchange (ETDEWEB)
Zhao, Zhen-Yu. [School of Business Administration, North China Electric Power University, Beijing 102206 (China); Zuo, Jian; Zillante, George [School of Natural and Built Environments, University of South Australia, Adelaide 5001 (Australia); Wang, Xin-Wei [Shandong Nuclear Power Equipment Manufacturing Co. Ltd, Haiyang, Shandong 265118 (China)
2010-06-15
Chinese electric power industry has adopted Build-Operate-Transfer (BOT) approach in a number of projects to alleviate the pressure of sole state-owned investment. The Chinese government has taken enormous efforts to create an environment to facilitate the application of BOT approach in electric power projects. Moreover, the growing attention on the sustainability issues puts the traditional major source of electricity - thermal power project under more strict scrutiny. As a result, various renewable energy projects, particularly the wind power projects have involved private sector funds. Both thermal power and wind power projects via BOT approach have met with a varying degree of success. Therefore, it is imperative to understand the factors contributing towards the success of both types of BOT power projects. Using an extensive literature survey, this paper identifies 31 success factors under 5 categories for Chinese BOT electric power projects. This is followed by a questionnaire survey to exam relative significance of these factors. The results reveal the different levels of significance of success factors for BOT thermal power projects versus wind power projects. Finally, survey results were analyzed to explore the underlying construction and distributions among the identified success factors. This study provides a valuable reference for all involved parties that are interested in developing BOT electric power projects in China. (author)
An ecological solution in power development strategy: hydroelectric Power
International Nuclear Information System (INIS)
Ionescu, S.; Teodorescu, D.
1994-01-01
One of the fundamental criteria in establishing the power development strategy is represented by the environmental protection. Besides increasing the power efficiency for users, the hydro power stands for a handy alternative to generate thermal power. Comparatively, if hydro power is properly planed and developed, it could allow conservation of fossil fuel resources (as it makes use of a renewable resources) and avoids air and water pollution and in addition would lead to certain positive effects upon the natural and anthropic environment (flood routing, optimizes the power supply-demand relationship, and so on). By making use of the data available in the international specific literature and the information on the power development strategy in Romania the effects incurred by hydro power are both qualitatively and quantitatively emphasized as compared to alternative power generation by fossil fuel combustion. The proposal is made to adopt certain law regulations as well as a methodology to evaluate the general efficiency of various types of power generating devices suiting the particular conditions of Romania and taking into account the social cost as well as environmental effects. Hence a power development strategy could be undertaking at the national level provided it meets the requirements of both power system and environment protection. (Author)
Alternative off-site power supply improves nuclear power plant safety
International Nuclear Information System (INIS)
Gjorgiev, Blaže; Volkanovski, Andrija; Kančev, Duško; Čepin, Marko
2014-01-01
Highlights: • Additional power supply for mitigation of the station blackout event in NPP is used. • A hydro power plant is considered as an off-site alternative power supply. • An upgrade of the probabilistic safety assessment from its traditional use is made. • The obtained results show improvement of nuclear power plant safety. - Abstract: A reliable power system is important for safe operation of the nuclear power plants. The station blackout event is of great importance for nuclear power plant safety. This event is caused by the loss of all alternating current power supply to the safety and non-safety buses of the nuclear power plant. In this study an independent electrical connection between a pumped-storage hydro power plant and a nuclear power plant is assumed as a standpoint for safety and reliability analysis. The pumped-storage hydro power plant is considered as an alternative power supply. The connection with conventional accumulation type of hydro power plant is analysed in addition. The objective of this paper is to investigate the improvement of nuclear power plant safety resulting from the consideration of the alternative power supplies. The safety of the nuclear power plant is analysed through the core damage frequency, a risk measure assess by the probabilistic safety assessment. The presented method upgrades the probabilistic safety assessment from its common traditional use in sense that it considers non-plant sited systems. The obtained results show significant decrease of the core damage frequency, indicating improvement of nuclear safety if hydro power plant is introduced as an alternative off-site power source
DEFF Research Database (Denmark)
Angjelichinoski, Marko; Stefanovic, Cedomir; Popovski, Petar
2016-01-01
A standard way to realize communication in microgrid control is to use an external communication network, such as modems for wireless or power-line communication, whose implementation may be inefficient in terms of deployment cost, complexity, and system stability. In this chapter we present......, while its reliability and availability draw on the reliability and availability of the microgrid power transmission system....... a communication solution, denoted as power talk, which is solely based on the use of the existing microgrid power equipment (i.e., power electronics and buses). The pivotal idea is to modulate information in the power-related parameters of the microgrid buses by use of the flexibility of power electronic...
Switching power converters medium and high power
Neacsu, Dorin O
2013-01-01
An examination of all of the multidisciplinary aspects of medium- and high-power converter systems, including basic power electronics, digital control and hardware, sensors, analog preprocessing of signals, protection devices and fault management, and pulse-width-modulation (PWM) algorithms, Switching Power Converters: Medium and High Power, Second Edition discusses the actual use of industrial technology and its related subassemblies and components, covering facets of implementation otherwise overlooked by theoretical textbooks. The updated Second Edition contains many new figures, as well as
Power in Households: Disentangling Bargaining Power
Mabsout, Ramzi; Staveren, Irene
2009-01-01
textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher female incomes lead to higher bargaining power, which in turn tends to increase women’s relative wellbeing (Quisumbing, 2003). For assets, the empirical literature comes up with similar results, indic...
Self-Powered Functional Device Using On-Chip Power Generation
Hussain, Muhammad Mustafa
2012-01-26
An apparatus, system, and method for a self-powered device using on-chip power generation. In some embodiments, the apparatus includes a substrate, a power generation module on the substrate, and a power storage module on the substrate. The power generation module may include a thermoelectric generator made of bismuth telluride.
Self-Powered Functional Device Using On-Chip Power Generation
Hussain, Muhammad Mustafa
2012-01-01
An apparatus, system, and method for a self-powered device using on-chip power generation. In some embodiments, the apparatus includes a substrate, a power generation module on the substrate, and a power storage module on the substrate. The power generation module may include a thermoelectric generator made of bismuth telluride.
Power conditioning unit for photovoltaic power systems
Beghin, G.; Nguyen Phuoc, V. T.
Operational features and components of a power conditioning unit for interconnecting solar cell module powers with a utility grid are outlined. The two-stage unit first modifies the voltage to desired levels on an internal dc link, then inverts the current in 2 power transformers connected to a vector summation control to neutralize harmonic distortion up to the 11th harmonic. The system operates in parallel with the grid with extra inductors to absorb line-to-line voltage and phase differences, and permits peak power use from the PV array. Reactive power is gained internally, and a power system controller monitors voltages, frequencies, and currents. A booster preregulator adjusts the input voltage from the array to provide voltage regulation for the inverter, and can commutate 450 amps. A total harmonic distortion of less than 5 percent is claimed, with a rating of 5 kVA, 50/60 Hz, 3-phase, and 4-wire.
Overall, Nickola C.; Hammond, Matthew D.; McNulty, James K.; Finkel, Eli J.
2016-01-01
When does power in intimate relationships shape important interpersonal behaviors, such as psychological aggression? Five studies tested whether possessing low relationship power was associated with aggressive responses, but (1) only within power-relevant relationship interactions when situational power was low, and (2) only by men because masculinity (but not femininity) involves the possession and demonstration of power. In Studies 1 and 2, men lower in relationship power exhibited greater aggressive communication during couples’ observed conflict discussions, but only when they experienced low situational power because they were unable to influence their partner. In Study 3, men lower in relationship power reported greater daily aggressive responses toward their partner, but only on days when they experienced low situational power because they were either (a) unable to influence their partner or (b) dependent on their partner for support. In Study 4, men who possessed lower relationship power exhibited greater aggressive responses during couples’ support-relevant discussions, but only when they had low situational power because they needed high levels of support. Study 5 provided evidence for the theoretical mechanism underlying men’s aggressive responses to low relationship power. Men who possessed lower relationship power felt less manly on days they faced low situational power because their partner was unwilling to change to resolve relationship problems, which in turn predicted greater aggressive responses to their partner. These results demonstrate that fully understanding when and why power is associated with interpersonal behavior requires differentiating between relationship and situational power. PMID:27442766
Power oscillation suppression by robust SMES in power system with large wind power penetration
International Nuclear Information System (INIS)
Ngamroo, Issarachai; Cuk Supriyadi, A.N.; Dechanupaprittha, Sanchai; Mitani, Yasunori
2009-01-01
The large penetration of wind farm into interconnected power systems may cause the severe problem of tie-line power oscillations. To suppress power oscillations, the superconducting magnetic energy storage (SMES) which is able to control active and reactive powers simultaneously, can be applied. On the other hand, several generating and loading conditions, variation of system parameters, etc., cause uncertainties in the system. The SMES controller designed without considering system uncertainties may fail to suppress power oscillations. To enhance the robustness of SMES controller against system uncertainties, this paper proposes a robust control design of SMES by taking system uncertainties into account. The inverse additive perturbation is applied to represent the unstructured system uncertainties and included in power system modeling. The configuration of active and reactive power controllers is the first-order lead-lag compensator with single input feedback. To tune the controller parameters, the optimization problem is formulated based on the enhancement of robust stability margin. The particle swarm optimization is used to solve the problem and achieve the controller parameters. Simulation studies in the six-area interconnected power system with wind farms confirm the robustness of the proposed SMES under various operating conditions
Power oscillation suppression by robust SMES in power system with large wind power penetration
Ngamroo, Issarachai; Cuk Supriyadi, A. N.; Dechanupaprittha, Sanchai; Mitani, Yasunori
2009-01-01
The large penetration of wind farm into interconnected power systems may cause the severe problem of tie-line power oscillations. To suppress power oscillations, the superconducting magnetic energy storage (SMES) which is able to control active and reactive powers simultaneously, can be applied. On the other hand, several generating and loading conditions, variation of system parameters, etc., cause uncertainties in the system. The SMES controller designed without considering system uncertainties may fail to suppress power oscillations. To enhance the robustness of SMES controller against system uncertainties, this paper proposes a robust control design of SMES by taking system uncertainties into account. The inverse additive perturbation is applied to represent the unstructured system uncertainties and included in power system modeling. The configuration of active and reactive power controllers is the first-order lead-lag compensator with single input feedback. To tune the controller parameters, the optimization problem is formulated based on the enhancement of robust stability margin. The particle swarm optimization is used to solve the problem and achieve the controller parameters. Simulation studies in the six-area interconnected power system with wind farms confirm the robustness of the proposed SMES under various operating conditions.
Is power-space a continuum? Distance effect during power judgments.
Jiang, Tianjiao; Zhu, Lei
2015-12-01
Despite the increasing evidence suggesting that power processing can activate vertical space schema, it still remains unclear whether this power-space is dichotomic or continuous. Here we tested the nature of the power-space by the distance effect, a continuous property of space cognition. In two experiments, participants were required to judge the power of one single word (Experiment 1) or compare the power of two words presented in pairs (Experiment 2). The power distance was indexed by the absolute difference of power ratings. Results demonstrated that reaction time decreased with the power distance, whereas accuracy increased with the power distance. The findings indicated that different levels of power were presented as different vertical heights, implying that there was a common mechanism underlying space and power cognition. Copyright © 2015 Elsevier Inc. All rights reserved.
The electric power engineering handbook power systems
2012-01-01
Power Systems, Third Edition (part of the five-volume set, The Electric Power Engineering Handbook) covers all aspects of power system protection, dynamics, stability, operation, and control. Under the editorial guidance of L.L. Grigsby, a respected and accomplished authority in power engineering, and section editors Andrew Hanson, Pritindra Chowdhuri, Gerry Sheble, and Mark Nelms, this carefully crafted reference includes substantial new and revised contributions from worldwide leaders in the field. This content provides convenient access to overviews and detailed information on a diverse arr
Power electronics and control for wind power systems
DEFF Research Database (Denmark)
Iov, Florin; Blaabjerg, Frede
2009-01-01
energy at the end-user should be set up. Deregulation of energy has lowered the investment in larger power plants, which means the need for new electrical power sources may be increased in the near future. Two major technologies will play important roles to solve the future problems. One is to change......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. It is expected that it has to be doubled within 20 years. The production, distribution and use of the energy should be as technological efficient as possible and incentives to save...... the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. Another is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most emerging...
DEFF Research Database (Denmark)
's normative power than any other academic journal, including a special issue on "What Kind of Power?" in 2006. As the leading journal in the debate, this special issue brings together seven normative power articles published in JEPP since the 2006 special issue, together with Ian Manners' ‘Normative power......The social sciences have many different understandings of ‘normative power', but in European Union (EU) studies normative power has three particular meanings. The first meaning of normative power is its emphasis on normative theory, that is, how we judge and justify truth claims in social science...... effects of EU relations with the world in areas ranging from inter-regional relations, through traditional diplomacy, to environmental politics. Research areas of particular interest include the study of the interplay between physical, material and normative forms of power, as well as the constitutive...
Agent-based power sharing scheme for active hybrid power sources
Jiang, Zhenhua
The active hybridization technique provides an effective approach to combining the best properties of a heterogeneous set of power sources to achieve higher energy density, power density and fuel efficiency. Active hybrid power sources can be used to power hybrid electric vehicles with selected combinations of internal combustion engines, fuel cells, batteries, and/or supercapacitors. They can be deployed in all-electric ships to build a distributed electric power system. They can also be used in a bulk power system to construct an autonomous distributed energy system. An important aspect in designing an active hybrid power source is to find a suitable control strategy that can manage the active power sharing and take advantage of the inherent scalability and robustness benefits of the hybrid system. This paper presents an agent-based power sharing scheme for active hybrid power sources. To demonstrate the effectiveness of the proposed agent-based power sharing scheme, simulation studies are performed for a hybrid power source that can be used in a solar car as the main propulsion power module. Simulation results clearly indicate that the agent-based control framework is effective to coordinate the various energy sources and manage the power/voltage profiles.
Digital Repository Service at National Institute of Oceanography (India)
Joseph, A.; Desai, R.G.P.
Need of a disaster alert system (DAS) capable of online transmission of real-time integrated sea-level and surface meteorological data is discussed. In addition to INSAT platform transmit terminal, VHF, etc., the ubiquitous cellular phone network...
78 FR 70005 - Naval Base Ventura County, San Nicolas Island, California; Restricted Area
2013-11-22
... entities. c. Review Under the National Environmental Policy Act Due to the administrative nature of this... 2638 kHz and 2738 kHz or by contacting ``PLEAD CONTROL'' on VHF-FM radio channel 11 or 16. Closure...
Power in Bourdieu and Foucault: considerations about symbolic power and disciplinary power
Directory of Open Access Journals (Sweden)
Tiago Barros Rosa
2017-06-01
Full Text Available This article aims to present some of conceptions about power, which are present in the thoughts of two contemporary classics from Social Science: Pierre Bourdieu and Michel Foucault. Most specifically, we will analyze the foundations of the notions of symbolic power and disciplinary power, developed, respectively, on their work. Despite the theoretical and methodological differences in both authors, we attend to approach the distinct notions of power in their scientific projects and to confront them to the currently dominant tendency, whose fundamental assumption are supported by the Weberian theory. The idea of imposition of will, as discussed in Weber’s classic formulation of power, brings in itself, indelibly, the awareness, calculation and intentionality by the social actors. Both Foucault and Bordieu, the individuals - subjects and social agents – are conditioned and constrained by external relation and forces, which are often not consciously perceived.
Integrating wind power in the (French) power system
International Nuclear Information System (INIS)
Pellen, A.
2007-03-01
RTE and EDF have no other technological option than to restrain the contribution of the French wind power fleet to base-load generation where it comes in direct competition with the nuclear power plants. The author aims to explain this situation and answer the following questions. Why the fossil fueled reactor fleet in France will not be affected by an evolution of the wind power capacity? Why, in France electric power generation-demand SYSTEM wind power cannot be a substitute for fossil fueled thermal units? (A.L.B.)
Power quality in power systems and electrical machines
Fuchs, Ewald
2015-01-01
The second edition of this must-have reference covers power quality issues in four parts, including new discussions related to renewable energy systems. The first part of the book provides background on causes, effects, standards, and measurements of power quality and harmonics. Once the basics are established the authors move on to harmonic modeling of power systems, including components and apparatus (electric machines). The final part of the book is devoted to power quality mitigation approaches and devices, and the fourth part extends the analysis to power quality solutions for renewable
DEFF Research Database (Denmark)
Yang, Dongsheng; Wang, Xiongfei; Liu, Fangcheng
2018-01-01
with the unity power factor. Then, considering the reactive power compensation from PV inverters, the minimum SCR in respect to Power Factor (PF) is derived, and the optimized coordination of the active and reactive power is exploited. It is revealed that the power transfer capability of PV power plant under...... of a 200 MW PV power plant demonstrate that the proposed method can ensure the rated power transfer of PV power plant with the SCR of 1.25, provided that the PV inverters are operated with the minimal PF=0.9.......This paper analyzes the power transfer limitation of the PV power plant under the ultra-weak grid condition, i.e., when the Short-Circuit Ratio (SCR) is close to 1. It explicitly identifies that a minimum SCR of 2 is required for the PV power plant to deliver the rated active power when operating...
Control of power plants and power systems. Proceedings
International Nuclear Information System (INIS)
Canales-Ruiz, R.
1996-01-01
The 88 papers in this volume constitute the proceedings of the International Federation of Automatic Control Symposium held in Mexico in 1995. The broad areas which they cover are: self tuning control; power plant operations; dynamic stability; fuzzy logic applications; power plants modelling; artificial intelligence applications; power plants simulation; voltage control; control of hydro electric units; state estimation; fault diagnosis and monitoring systems; system expansion and operation planning; security assessment; economic dispatch and optimal load flow; adaptive control; distribution; transient stability and preventive control; modelling and control of nuclear plant; knowledge data bases for automatic learning methods applied to power system dynamic security assessment; control of combined cycle units; power control centres. Separate abstracts have been prepared for the three papers relating to nuclear power plants. (UK)
The development of Chinese power industry and its nuclear power
International Nuclear Information System (INIS)
Zhou Dabin
2002-01-01
The achievements and disparity of Chinese power industry development is introduced. The position and function of nuclear power in Chinese power industry is described. Nuclear power will play a role in ensuring the reliable and safe supply of primary energy in a long-term and economic way. The development prospects of power source construction in Chinese power industry is presented. Challenge and opportunity in developing nuclear power in China are discussed
Emergency power systems at nuclear power plants
International Nuclear Information System (INIS)
1991-01-01
This Safety Guide was prepared as part of the Nuclear Safety Standards programme for establishing Codes and Safety Guides relating to nuclear power plants (NPPs). The first edition of the present Safety Guide was developed in the early 1980s. The text has now been brought up-to-date, refined in several details and amended to include non-electrical diverse and independent power sources. This Guide applies to NPP for which the total power supply comprises a normal power supply and an emergency power supply (EPS), which may be electrical or a combination of electrical and non-electrical. The Guide provides general guidance for all types of EPS and specific guidance on the design safety requirements and the features of the electrical and non-electrical portions of the EPS. 9 figs, 2 tabs
Space solar power for powering a space elevator
Energy Technology Data Exchange (ETDEWEB)
Laubscher, B. E. (Bryan E.); Kellum, M. J. (Mervyn J.)
2004-01-01
The Space Elevator (SE) represents a major paradigm shift in space access. If the SE's promise of low cost access can be realized, everything becomes economically more feasible to accomplish in space. In this paper we describe a Space Solar Power (SSP) system capable of powering the climbers of an SE. The initial SE will use laser power beaming from floating platforms near the SE platform. This study outlines an SSP system, based near the SE at geosynchronous altitude (GEO), which powers the climbers traversing the elevator. Such a system would reduce the SE system's dependence on fuel supply from land for its power beaming facilities. Moreover, since deploying SSP systems is anticipated to be a major use for SE's, SSP's could represent an elegant solution to the problem of SE energy consumption. SSP systems for sending usable power to Earth have been designed for well over 30 years. Technologies pertinent to SSP systems are continually evolving. This slightly different application carries the added requirements of aiming the beamed power at a moving target and sending the power in a form the climbers can use. Systems considered include beaming power to the climbers directly from a traditional SSP and reflecting sunlight onto the climbers. One of our designs includes a very new technology, optical rectennas. Mars SEs are conceived as having space-based power systems. Therefore, it is important to consider the problems that will be encountered in these types of applications.
high power facto high power factor high power factor hybrid rectifier
African Journals Online (AJOL)
eobe
increase in the number of electrical loads that some kind of ... components in the AC power system. Thus, suppl ... al output power; assuring reliability in ... distribution systems. This can be ...... Thesis- Califonia Institute of Technology, Capitulo.
76 FR 74842 - RTCA Program Management Committee
2011-12-01
... Minimum Aviation System Performance Standards (MASPS) for Advanced VHF Digital Data Communications... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration RTCA Program Management Committee... RTCA Program Management Committee meeting. SUMMARY: The FAA is issuing this notice to advise the public...
O Electromagnetic Power Waves and Power Density Components.
Petzold, Donald Wayne
1980-12-01
On January 10, 1884 Lord Rayleigh presented a paper entitled "On the Transfer of Energy in the Electromagnetic Field" to the Royal Society of London. This paper had been authored by the late Fellow of Trinity College, Cambridge, Professor J. H. Poynting and in it he claimed that there was a general law for the transfer of electromagnetic energy. He argued that associated with each point in space is a quantity, that has since been called the Poynting vector, that is a measure of the rate of energy flow per unit area. His analysis was concerned with the integration of this power density vector at all points over an enclosing surface of a specific volume. The interpretation of this Poynting vector as a true measure of the local power density was viewed with great skepticism unless the vector was integrated over a closed surface, as the development of the concept required. However, within the last decade or so Shadowitz indicates that a number of prominent authors have argued that the criticism of the interpretation of Poynting's vector as a local power density vector is unjustified. The present paper is not concerned with these arguments but instead is concerned with a decomposition of Poynting's power density vector into two and only two components: one vector which has the same direction as Poynting's vector and which is called the forward power density vector, and another vector, directed opposite to the Poynting vector and called the reverse power density vector. These new local forward and reverse power density vectors will be shown to be dependent upon forward and reverse power wave vectors and these vectors in turn will be related to newly defined forward and reverse components of the electric and magnetic fields. The sum of these forward and reverse power density vectors, which is simply the original Poynting vector, is associated with the total electromagnetic energy traveling past the local point. Another vector which is the difference between the forward
Impact of advanced wind power ancillary services on power system
DEFF Research Database (Denmark)
Hansen, Anca Daniela; Altin, Müfit
The objective of this report is to illustrate and analyse, by means of simulation test cases, the impact of wind power advanced ancillary services, like inertial response (IR), power oscillation damping (POD) and synchronising power (SP) on the power system. Generic models for wind turbine, wind...... power plant and power system are used in the investigation....
Energy policy and nuclear power. Expectations of the power industry
International Nuclear Information System (INIS)
Harig, H.D.
1995-01-01
In the opinion of the power industry, using nuclear power in Germany is a responsible attitude, while opting out of nuclear power is not. Electricity utilities will build new nuclear power plants only if the structural economic and ecological advantages of nuclear power are preserved and can be exploited in Germany. The power industry will assume responsibility for new complex, capital-intensive nuclear plants only if a broad societal consensus about this policy can be reached in this country. The power industry expects that the present squandering of nuclear power resources in Germany will be stopped. The power industry is prepared to contribute to finding a speedy consensus in energy policy, which would leave open all decisions which must not be taken today, and which would not constrain the freedom of decision of coming generations. The electricity utilities remain committed proponents of nuclear power. However, what they sell to their customers is electricity, not nuclear power. (orig.) [de
Kang, Sonia K; Galinsky, Adam D; Kray, Laura J; Shirako, Aiwa
2015-05-01
The current research examines how power affects performance in pressure-filled contexts. We present low-power-threat and high-power-lift effects, whereby performance in high-stakes situations suffers or is enhanced depending on one's power; that is, the power inherent to a situational role can produce effects similar to stereotype threat and lift. Three negotiations experiments demonstrate that role-based power affects outcomes but only when the negotiation is diagnostic of ability and, therefore, pressure-filled. We link these outcomes conceptually to threat and lift effects by showing that (a) role power affects performance more strongly when the negotiation is diagnostic of ability and (b) underperformance disappears when the low-power negotiator has an opportunity to self-affirm. These results suggest that stereotype threat and lift effects may represent a more general phenomenon: When the stakes are raised high, relative power can act as either a toxic brew (stereotype/low-power threat) or a beneficial elixir (stereotype/high-power lift) for performance. © 2015 by the Society for Personality and Social Psychology, Inc.
Ownership structure and market power in the nordic power market
International Nuclear Information System (INIS)
Amundsen, E.S.; Bergman, L.
1999-01-01
The opening of Nord Pool in 1996 seriously constrained the power companies' ability to exercise market power within their national borders. Currently there is an integration process going on among the power companies in the Nord Pool area. It manifest itself in terms of take-over and reciprocal acquisition of shares in the power companies - nationally and abroad. This process may undo what the introduction of the common power market achieved in curtailing market power. The aim of this paper is to investigate the effects on market power of increased cross- ownership in the Nordic power market. (au)
Strategic wind power trading considering rival wind power production
DEFF Research Database (Denmark)
Exizidis, Lazaros; Kazempour, Jalal; Pinson, Pierre
2016-01-01
In an electricity market with high share of wind power, it is expected that wind power producers may exercise market power. However, wind producers have to cope with wind’s uncertain nature in order to optimally offer their generation, whereas in a market with more than one wind producers, uncert...... depending on the rival’s wind generation, given that its own expected generation is not high. Finally, as anticipated, expected system cost is higher when both wind power producers are expected to have low wind power generation......In an electricity market with high share of wind power, it is expected that wind power producers may exercise market power. However, wind producers have to cope with wind’s uncertain nature in order to optimally offer their generation, whereas in a market with more than one wind producers......, uncertainty of rival wind power generation should also be considered. Under this context, this paper addresses the impact of rival wind producers on the offering strategy and profits of a pricemaker wind producer. A stochastic day-ahead market setup is considered, which optimizes the day-ahead schedules...
Custom power - the utility solution to distribution power quality
Energy Technology Data Exchange (ETDEWEB)
Woodley, N H [Westinghouse Electric Corp., Pittsburgh, PA (United States)
1997-04-01
The design of custom power products for electric power distribution system was discussed. Problems with power quality that result in loss of production to critical processes are costly and create a problem for the customer as well as the electric utility. Westinghouse has developed power quality improvement equipment for customers and utilities, using new technologies based on power electronics concepts. The Distribution Static Compensator (DSTATCOM) is a fast response, solid-state power controller that provides flexible voltage control for improving power quality at the point of connection to the utility`s 4.16 to 69 kV distribution feeder. STATCOM is a larger version of the DSTATCOM that can be used to solve voltage flicker problems caused by electric arc furnaces. Westinghouse has also developed a Dynamic Voltage Restorer (DVR) which protects a critical customer plant load from power system voltage disturbances. Solid-State Breakers (SSB) have also been developed which offer a solution to many of the distribution system problems that result in voltage sags, swells, and power outages. 6 refs., 8 figs.
Liquid crystalline dihydroazulene photoswitches
DEFF Research Database (Denmark)
Petersen, Anne Ugleholdt; Jevric, Martyn; Mandle, Richard J.
2015-01-01
A large selection of photochromic dihydroazulene (DHA) molecules incorporating various substituents at position 2 of the DHA core was prepared and investigated for their ability to form liquid crystalline phases. Incorporation of an octyloxy-substituted biphenyl substituent resulted in nematic...... phase behavior and it was possible to convert one such compound partly into its vinylheptafulvene (VHF) isomer upon irradiation with light when in the liquid crystalline phase. This conversion resulted in an increase in the molecular alignment of the phase. In time, the meta-stable VHF returns...... to the DHA where the alignment is maintained. The systematic structural variation has revealed that a biaryl spacer between the DHA and the alkyl chain is needed for liquid crystallinity and that the one aromatic ring in the spacer cannot be substituted by a triazole. This work presents an important step...
Modern Radar Techniques for Geophysical Applications: Two Examples
Arokiasamy, B. J.; Bianchi, C.; Sciacca, U.; Tutone, G.; Zirizzotti, A.; Zuccheretti, E.
2005-01-01
The last decade of the evolution of radar was heavily influenced by the rapid increase in the information processing capabilities. Advances in solid state radio HF devices, digital technology, computing architectures and software offered the designers to develop very efficient radars. In designing modern radars the emphasis goes towards the simplification of the system hardware, reduction of overall power, which is compensated by coding and real time signal processing techniques. Radars are commonly employed in geophysical radio soundings like probing the ionosphere; stratosphere-mesosphere measurement, weather forecast, GPR and radio-glaciology etc. In the laboratorio di Geofisica Ambientale of the Istituto Nazionale di Geofisica e Vulcanologia (INGV), Rome, Italy, we developed two pulse compression radars. The first is a HF radar called AIS-INGV; Advanced Ionospheric Sounder designed both for the purpose of research and for routine service of the HF radio wave propagation forecast. The second is a VHF radar called GLACIORADAR, which will be substituting the high power envelope radar used by the Italian Glaciological group. This will be employed in studying the sub glacial structures of Antarctica, giving information about layering, the bed rock and sub glacial lakes if present. These are low power radars, which heavily rely on advanced hardware and powerful real time signal processing. Additional information is included in the original extended abstract.
On energy efficient power allocation for power-constrained systems
Sboui, Lokman
2014-09-01
Recently, the energy efficiency (EE) has become an important factor when designing new wireless communication systems. Due to economic and environmental challenges, new trends and efforts are oriented toward “green” communication especially for energy-constrained applications such as wireless sensors network and cognitive radio. To this end, we analyze the power allocation scheme that maximizes the EE defined as rate over the total power including circuit power. We derive an explicit expression of the optimal power with instantaneous channel gain based on EE criterion. We show that the relation between the EE and the spectral efficiency (SE) when the optimal power is adopted is strictly increasing in contrast with the SE-EE trade-off discussed in the literature. We also solve a non-convex problem and compute explicitly the optimal power for ergodic EE under either a peak or an average power constraint. When the instantaneous channel is not available, we provide the optimal power equation and compute simple sub-optimal power. In the numerical results, we show that the sup-optimal solution is very close to the optimal solution. In addition, we show that the absence of the channel state information (CSI) only affects the EE and the SE performances at high power regime compared to the full CSI case.
WhalePower tubercle blade power performance test report
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-07-15
Toronto-based WhalePower Corporation has developed turbine blades that are modeled after humpback whale flippers. The blades, which incorporate tubercles along the leading edge of the blade, have been fitted to a Wenvor 25 kW turbine installed in North Cape, Prince Edward Island at a test site for the Wind Energy Institute of Canada (WEICan). A test was conducted to characterize the power performance of the prototype wind turbine. This report described the wind turbine configuration with particular reference to turbine information, power rating, blade information, tower information, control systems and grid connections. The test site was also described along with test equipment and measurement procedures. Information regarding power output as a function of wind speed was included along with power curves, power coefficient and annual energy production. The results for the power curve and annual energy production contain a level of uncertainty. While measurements for this test were collected and analyzed in accordance with International Electrotechnical Commission (IEC) standards for performance measurements of electricity producing wind turbines (IEC 61400-12-1), the comparative performance data between the prototype WhalePower wind turbine blade and the Wenvor standard blade was not gathered to IEC data standards. Deviations from IEC-61400-12-1 procedures were listed. 6 tabs., 16 figs., 3 appendices.
Wireless Power Transmission Options for Space Solar Power
Potter, Seth; Davis, Dean; Born, Martin; Bayer, Martin; Howell, Joe; Mankins, John
2008-01-01
Space Solar Power (SSP), combined with Wireless Power Transmission (WPT), offers the far-term potential to solve major energy problems on Earth. In the long term, we aspire to beam energy to Earth from geostationary Earth orbit (GEO), or even further distances in space. In the near term, we can beam power over more moderate distances, but still stretch the limits of today s technology. In recent studies, a 100 kWe-class "Power Plug" Satellite and a 10 kWe-class Lunar Polar Solar Power outpost have been considered as the first steps in using these WPT options for SSP. Our current assessments include consideration of orbits, wavelengths, and structural designs to meet commercial, civilian government, and military needs. Notional transmitter and receiver sizes are considered for use in supplying 5 to 40 MW of power. In the longer term, lunar or asteroidal material can be used. By using SSP and WPT technology for near-term missions, we gain experience needed for sound decisions in designing and developing larger systems to send power from space to Earth.
Power import or domestic power generation using gas?
International Nuclear Information System (INIS)
Saettler, M.; Bohnenschaefer, W.; Schlesinger, M.
2001-01-01
This report for the Swiss Federal Office of Energy (SFOE) presents expert opinion on the question of how Switzerland could meet its demands for power in the future. The results of the analysis of two options - the import of electrical power or its generation using natural-gas-fired power stations - made in the light of gas market liberalisation are presented. These include the assessment of the use of 'GuD' (combined gas and steam-turbine) power stations in the 100 MW e l to 400 MW e l class regarding their cost, their emissions and primary energy consumption. The authors discuss the assessments from the political and economic points of view. An appendix supplies characteristic data for 'GuD' power stations and an example of a model calculation for a 400 MW e l 'GuD' power station
Power Electronics Control of Wind Energy in Distributed Power System
DEFF Research Database (Denmark)
Iov, Florin; Ciobotaru, Mihai; Blaabjerg, Frede
2008-01-01
is to change the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. The other is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most...... emerging renewable energy sources, wind energy, which by means of power electronics are changing from being a minor energy source to be acting as an important power source in the energy system. Power electronics is the enabling technology and the presentation will cover the development in wind turbine...... technology from kW to MW, discuss which power electronic solutions are most feasible and used today....
International Nuclear Information System (INIS)
Porter, Arthur.
1980-01-01
This chapter of the final report of the Royal Commission on Electric Power Planning in Ontario updates its interim report on nuclear power in Ontario (1978) in the light of the Three Mile Island accident and presents the commission's general conclusions and recommendations relating to nuclear power. The risks of nuclear power, reactor safety with special reference to Three Mile Island and incidents at the Bruce generating station, the environmental effects of uranium mining and milling, waste management, nuclear power economics, uranium supplies, socio-political issues, and the regulation of nuclear power are discussed. Specific recommendations are made concerning the organization and public control of Ontario Hydro, but the commission concluded that nuclear power is acceptable in Ontario as long as satisfactory progress is made in the disposal of uranium mill tailings and spent fuel wastes. (LL)
Power enhancement of piezoelectric transformers for power supplies
DEFF Research Database (Denmark)
Ekhtiari, Marzieh; Steenstrup, Anders Resen; Zhang, Zhe
2016-01-01
This paper studies power enhancement of piezoelectric transformers to be used in inductorless, half-bridge, piezoelecteric-based switch mode power supplies for driving a piezo actuator motor system in a high strength magnetic environment for magnetic resonance imaging and computed tomography...... applications. A new multi element-piezo transformer solution is proposed along with a dual mode piezo transformer, providing power scaling and potentially improving the internal heat-up of a high power piezo transformer system....
When power does not corrupt: superior individuation processes among powerful perceivers.
Overbeck, J R; Park, B
2001-10-01
To examine whether powerful people fail to individuate the less powerful, the authors assigned participants to either a high-power or low-power role for a computer E-mail role play. In 3 studies, participants in the high-power role made decisions and determined the outcomes of interactions; low-power role players had no power and relied on high-power targets for outcome decisions. Studies I and 2 found that high-power perceivers better individuated low-power targets. Study 3 demonstrated that high-power role players' superior judgment can be impaired by including a task that directs their responsibility toward organizational rather than interpersonal concerns. In all, results suggest that the effect of power on social judgment may be more complex and multifaceted than has previously been acknowledged.
Energy Technology Data Exchange (ETDEWEB)
Huertas-Hernando, Daniel [Department of Energy Systems, SINTEF, Trondheim Norway; Farahmand, Hossein [Department of Electric Power Engineering, Norwegian University of Science and Technology (NTNU), Trondheim Norway; Holttinen, Hannele [Department of Energy Systems, VTT Technical Research Centre of Finland, Espoo Finland; Kiviluoma, Juha [Department of Energy Systems, VTT Technical Research Centre of Finland, Espoo Finland; Rinne, Erkka [Department of Energy Systems, VTT Technical Research Centre of Finland, Espoo Finland; Söder, Lennart [Department of Electrical Engineering, KTH University, Stockholm Sweden; Milligan, Michael [Transmission and Grid Integration Group, National Renewable Energy Laboratory' s National Wind Technology Center, Golden CO USA; Ibanez, Eduardo [Transmission and Grid Integration Group, National Renewable Energy Laboratory' s National Wind Technology Center, Golden CO USA; Martínez, Sergio Martín [Department of Electrical Engineering, Electronics, Automation and Communications, Universidad de Castilla-La Mancha, Albacete Spain; Gomez-Lazaro, Emilio [Department of Electrical Engineering, Electronics, Automation and Communications, Universidad de Castilla-La Mancha, Albacete Spain; Estanqueiro, Ana [National Laboratory of Energy and Geology - LNEG, Lisbon Portugal; Rodrigues, Luis [National Laboratory of Energy and Geology - LNEG, Lisbon Portugal; Carr, Luis [Research Association for Energy Economics (FfE GmbH), Munich Germany; van Roon, Serafin [Research Association for Energy Economics (FfE GmbH), Munich Germany; Orths, Antje Gesa [Energinet.dk, Fredericia Denmark; Eriksen, Peter Børre [Energinet.dk, Fredericia Denmark; Forcione, Alain [Hydro Quebec, Montréal Canada; Menemenlis, Nickie [Hydro Quebec, Montréal Canada
2016-06-20
Hydro power is one of the most flexible sources of electricity production. Power systems with considerable amounts of flexible hydro power potentially offer easier integration of variable generation, e.g., wind and solar. However, there exist operational constraints to ensure mid-/long-term security of supply while keeping river flows and reservoirs levels within permitted limits. In order to properly assess the effective available hydro power flexibility and its value for storage, a detailed assessment of hydro power is essential. Due to the inherent uncertainty of the weather-dependent hydrological cycle, regulation constraints on the hydro system, and uncertainty of internal load as well as variable generation (wind and solar), this assessment is complex. Hence, it requires proper modeling of all the underlying interactions between hydro power and the power system, with a large share of other variable renewables. A summary of existing experience of wind integration in hydro-dominated power systems clearly points to strict simulation methodologies. Recommendations include requirements for techno-economic models to correctly assess strategies for hydro power and pumped storage dispatch. These models are based not only on seasonal water inflow variations but also on variable generation, and all these are in time horizons from very short term up to multiple years, depending on the studied system. Another important recommendation is to include a geographically detailed description of hydro power systems, rivers' flows, and reservoirs as well as grid topology and congestion.
The Pervasive Power of PowerPoint
DEFF Research Database (Denmark)
Schoeneborn, Dennis
2013-01-01
This paper examines the pervasive role of Microsoft’s presentation software PowerPoint as a genre of professional and organizational communication. Frequently, PowerPoint is not only used for the primary function it was initially designed for, i.e., facilitating live presentations, but also...... for alternative purposes such as project documentation. Its application in a neighboring domain, however, poses a functional dilemma: does the PowerPoint genre preserve the features of its primary function, i.e., presentation, or rather adapt to the new function, i.e., documentation? By drawing on a communication......-centered perspective, this paper examines PowerPoint’s role in the domain of project documentation as a clash between the constitutive affordances of professional and of organizational communication. To investigate this issue empirically, I conducted a case study at a multinational business consulting firm. The study...
Power fluctuation reduction methodology for the grid-connected renewable power systems
Aula, Fadhil T.; Lee, Samuel C.
2013-04-01
This paper presents a new methodology for eliminating the influence of the power fluctuations of the renewable power systems. The renewable energy, which is to be considered an uncertain and uncontrollable resource, can only provide irregular electrical power to the power grid. This irregularity creates fluctuations of the generated power from the renewable power systems. These fluctuations cause instability to the power system and influence the operation of conventional power plants. Overall, the power system is vulnerable to collapse if necessary actions are not taken to reduce the impact of these fluctuations. This methodology aims at reducing these fluctuations and makes the generated power capability for covering the power consumption. This requires a prediction tool for estimating the generated power in advance to provide the range and the time of occurrence of the fluctuations. Since most of the renewable energies are weather based, as a result a weather forecast technique will be used for predicting the generated power. The reduction of the fluctuation also requires stabilizing facilities to maintain the output power at a desired level. In this study, a wind farm and a photovoltaic array as renewable power systems and a pumped-storage and batteries as stabilizing facilities are used, since they are best suitable for compensating the fluctuations of these types of power suppliers. As an illustrative example, a model of wind and photovoltaic power systems with battery energy and pumped hydro storage facilities for power fluctuation reduction is included, and its power fluctuation reduction is verified through simulation.
14 CFR 27.695 - Power boost and power-operated control system.
2010-01-01
... Systems § 27.695 Power boost and power-operated control system. (a) If a power boost or power-operated... failure of all engines. (b) Each alternate system may be a duplicate power portion or a manually operated... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Power boost and power-operated control...
14 CFR 29.695 - Power boost and power-operated control system.
2010-01-01
... Systems § 29.695 Power boost and power-operated control system. (a) If a power boost or power-operated... failure of all engines. (b) Each alternate system may be a duplicate power portion or a manually operated... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Power boost and power-operated control...
POSSPOW: Possible Power of Offshore Wind Power Plants
DEFF Research Database (Denmark)
Giebel, Gregor; Göçmen, Tuhfe; Sørensen, Poul Ejnar
2013-01-01
Introduction In recent years, the very large offshore wind farms were designed as wind power plants, including possibilities to contribute to the stability of the grid by offering grid services (also called ancillary services). One of those services is reserve power, which is achieved by down......-regulating the wind farm from its maximum possible power. The power can be ramped up quite quickly, but the influence of wakes makes it difficult to assess the exact amount of down-regulation available to sell. Currently, Transmission System Operators (TSOs) have no real way to determine exactly the possible power...... will be verified on some of the large offshore wind farms owned by Vattenfall, and possibly in a DONG Energy wind farm too. Dedicated experiments to the wind flow in large offshore wind farms are planned. Main body of abstract Modern wind turbines have a SCADA signal called possible power. In normal operation...
Reactive Power Pricing Model Considering the Randomness of Wind Power Output
Dai, Zhong; Wu, Zhou
2018-01-01
With the increase of wind power capacity integrated into grid, the influence of the randomness of wind power output on the reactive power distribution of grid is gradually highlighted. Meanwhile, the power market reform puts forward higher requirements for reasonable pricing of reactive power service. Based on it, the article combined the optimal power flow model considering wind power randomness with integrated cost allocation method to price reactive power. Meanwhile, considering the advantages and disadvantages of the present cost allocation method and marginal cost pricing, an integrated cost allocation method based on optimal power flow tracing is proposed. The model realized the optimal power flow distribution of reactive power with the minimal integrated cost and wind power integration, under the premise of guaranteeing the balance of reactive power pricing. Finally, through the analysis of multi-scenario calculation examples and the stochastic simulation of wind power outputs, the article compared the results of the model pricing and the marginal cost pricing, which proved that the model is accurate and effective.
Power system stabilization by SMES using current-fed pwm power conditioner
International Nuclear Information System (INIS)
Ishikawa, T.; Akita, S.; Taniguchi, H.; Kosho, S.; Tanaka, T.
1988-01-01
A superconducting magnetic energy storage (SMES) unit, consisted of superconducting coil and AC/DC power conditioner, can be used to suppress various kinds of instability that may cause service interruption in electric power system as it has high controllability of input/output electric power. Power system stabilizing ability of SMES has been examined experimentally by using model power system and small SMES unit. Current-fed PWM power conditioner was used to obtain maximum stabilizing effect by controlling active and reactive power simultaneously and independently. Power conditioner configuration, operating characteristics and control scheme for power system stabilization are also described. Results from experiments show the effectiveness of SMES on power system stabilization
7 CFR 1710.303 - Power cost studies-power supply borrowers.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Power cost studies-power supply borrowers. 1710.303... AND GUARANTEES Long-Range Financial Forecasts § 1710.303 Power cost studies—power supply borrowers. (a... facilities shall be supported by a power cost study to demonstrate that the proposed generation and...
Nuclear power. Volume 2. Nuclear power project management
International Nuclear Information System (INIS)
Pedersen, E.S.
1978-01-01
NUCLEAR POWER PLANT DESIGN is intended to be used as a working reference book for management, engineers and designers, and as a graduate-level text for engineering students. The book is designed to combine theory with practical nuclear power engineering and design experience, and to give the reader an up-to-date view of the status of nuclear power and a basic understanding of how nuclear power plants function. Volume 2 contains the following chapters: (1) review of nuclear power plants; (2) licensing procedures; (3) safety analysis; (4) project professional services; (5) quality assurance and project organization; (6) construction, scheduling, and operation; (7) nuclear fuel handling and fuel management; (8) plant cost management; and (9) conclusion
Power in Households: Disentangling Bargaining Power
R. Mabsout (Ramzi); I.P. van Staveren (Irene)
2009-01-01
textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher
2010-07-01
... from all points of entry into the danger zone. The west flag pole is located on the southern berm at... Officer using a marine VHF-FM marine radio and by other means as necessary, to exit the danger zone and...
International Nuclear Information System (INIS)
Bacon, H.; Valentine, J.
1981-01-01
The subject is covered in chapters, entitled: radiation (hazards associated with nuclear power production); wastes (radioactive wastes); accidents (actual and postulated, resulting in the release of radiation); the FBR and the plutonium cycle; costs (economics of nuclear power); spent fuel transport; civil liberties; doing without nuclear power (UK power demand; low energy strategy; energy policy; government policies; alternative energy sources). (U.K.)
Growth of crystallized Ge films from VHF inductively-coupled plasma of H2-diluted GeH4
International Nuclear Information System (INIS)
Sakata, T.; Makihara, K.; Murakami, H.; Higashi, S.; Miyazaki, S.
2007-01-01
We have studied the Ge crystalline nucleation and film growth on quartz substrate at 250 deg. C from inductively-coupled plasma (ICP) of GeH 4 diluted with H 2 . The ICP was generated by supplying 60 MHz power to an external single-turn antenna which was placed on a quartz plate window of a stainless steel reactor and parallel to the substrate. We have found that the growth rate is significantly increased when the preferential growth of the (110) plane becomes pronounced after the formation of randomly-oriented crystalline network. The (110) oriented Ge films, of which average crystallinity is as high as 70%. The integrated intensity ratio of TO phonons in crystalline phase to those in disordered phase, were grown at a rate of ∼ 4.0 nm/s after the formation of amorphous incubation layer with a thickness of ∼ 0.1 μm on quartz
Power control of the Angra-2 Nuclear Power Plant
International Nuclear Information System (INIS)
Souza Mendes, J.E. de
1986-01-01
The systems for the power control of the Nuclear Power Plant Angra 2 have a high degree of automation so that few operator actions are required during power operation. The power control strategy and the operation principles of the control systems, here presented, make possible a great flexibility of the Plant operation. (Author) [pt
Calculation of Wind Power Limit adjusting the Continuation Power Flow
International Nuclear Information System (INIS)
Santos Fuentefria, Ariel; Castro Fernández, Miguel; Martínez García, Antonio
2012-01-01
The wind power insertion in the power system is an important issue and can create some instability problems in voltage and system frequency due to stochastic origin of wind. Know the Wind Power Limit is a very important matter. Existing in bibliography a few methods for calculation of wind power limit. The calculation is based in static constrains, dynamic constraints or both. In this paper is developed a method for the calculation of wind power limit using some adjust in the continuation power flow, and having into account the static constrains. The method is complemented with Minimal Power Production Criterion. The method is proved in the Isla de la Juventud Electric System. The software used in the simulations was the Power System Analysis Toolbox (PSAT). (author)
Reactor power control method upon accidents of electrical power system
International Nuclear Information System (INIS)
Hirose, Masao.
1983-01-01
Purpose: To enable to continue the operation of a BWR type reactor by avoiding the scram while suppressing the reactor power, just after the external disturbance such as earth-trouble in power-transmission network. Method: Steep power drop of an electrical generator is to be detected not only by a current-type power-load-unbalance relay but also with a power-type power-load-unbalance-relay. If steep power-drop was detected by the latter relay, a previously selected control rod is rapidly inserted into the reactor. In this way, in the case where there is a possibility of the reactor scram, the scram can be avoided by suppressing the reactor power, thus the reactor operation can be continued. (Kamimura, M.)
Possible Power Estimation of Down-Regulated Offshore Wind Power Plants
DEFF Research Database (Denmark)
Gögmen, Tuhfe
The penetration of offshore wind power is continuously increasing in the Northern European grids. To assure safety in the operation of the power system, wind power plants are required to provide ancillary services, including reserve power attained through down-regulating the wind farm from its...... power plant. The developed procedure, the PossPOW algorithm, can also be used in the wind farm control as it yields a real-time wind farm power curve. The modern wind turbines have a possible power signal at the turbine level and the current state of the art is to aggregate those signals to achieve...... the wind farm scale production capacity. However the summation of these individual signals is simply an over-estimation for the wind power plant, due to reduced wake losses during curtailment. The determination of the possible power with the PossPOW algorithm works as follows: firstly the second...
Research Developments on Power System Integration of Wind Power
DEFF Research Database (Denmark)
Chen, Zhe; Hansen, Jens Carsten; Wu, Qiuwei
2011-01-01
variability and prediction, wind power plant ancillary services, grid connection and operation, Smart grids and demand side management under market functionality. The topics of the first group of PhD program starting 2011 under the wind energy Sino-Danish Centre for Education & Research (SDC) are also......This paper presents an overview on the recent research activities and tendencies regarding grid integration of wind power in Denmark and some related European activities, including power electronics for enhancing wind power controllability, wind turbines and wind farms modeling, wind power...
Power, stability of power, and creativity
Sligte, Daniel J.; de Dreu, Carsten K. W.; Nijstad, Bernard A.
Power hierarchies are an essential aspect of social organization, create stability and social order, and provide individuals with incentives to climb the hierarchical ladder. Extending previous work on power and creativity, we put forward that this relationship critically depends on both the
Power, stability of power, and creativity
Sligte, D.J.; de Dreu, C.K.W.; Nijstad, B.A.
2011-01-01
Power hierarchies are an essential aspect of social organization, create stability and social order, and provide individuals with incentives to climb the hierarchical ladder. Extending previous work on power and creativity, we put forward that this relationship critically depends on both the
Power quality load management for large spacecraft electrical power systems
Lollar, Louis F.
1988-01-01
In December, 1986, a Center Director's Discretionary Fund (CDDF) proposal was granted to study power system control techniques in large space electrical power systems. Presented are the accomplishments in the area of power system control by power quality load management. In addition, information concerning the distortion problems in a 20 kHz ac power system is presented.
The electric power engineering handbook power system stability and control
Grisby, Leonard L
2012-01-01
With contributions from worldwide leaders in the field, Power System Stability and Control, Third Edition (part of the five-volume set, The Electric Power Engineering Handbook) updates coverage of recent developments and rapid technological growth in essential aspects of power systems. Edited by L.L. Grigsby, a respected and accomplished authority in power engineering, and section editors Miroslav Begovic, Prabha Kundur, and Bruce Wollenberg, this reference presents substantially new and revised content. Topics covered include: * Power System Protection * Power System Dynamics and Stability *
Self-powered detectors for power reactors: an overview
International Nuclear Information System (INIS)
Ma, J.
2006-01-01
In this paper, Self-Powered Detectors (SPDs) for applications in nuclear power reactors have been reviewed. Based on their responses to radiation, these detectors can be divided into delayed response Self-Powered Neutron Detector (SPND), prompt response SPND and Self-Powered Gamma Detector (SPGD). The operational principles of these detectors are presented and their distinctive characteristics are examined accordingly. The analytical models and Monte Carlo method to calculate the responses of these detectors to neutron flux and external gamma rays are reviewed. The paper has also considered some related signal processing techniques, such as detector calibrations and detector signal compensations. Furthermore, a couple of failure modes have also been analyzed. Finally, applications of SPD in nuclear power reactors are summarized. (author)
Nuclear power. Volume 1. Nuclear power plant design
International Nuclear Information System (INIS)
Pedersen, E.S.
1978-01-01
NUCLEAR POWER PLANT DESIGN is intended to be used as a working reference book for management, engineers and designers, and as a graduate-level text for engineering students. The book is designed to combine theory with practical nuclear power engineering and design experience, and to give the reader an up-to-date view of the status of nuclear power and a basic understanding of how nuclear power plants function. Volume 1 contains the following chapters; (1) nuclear reactor theory; (2) nuclear reactor design; (3) types of nuclear power plants; (4) licensing requirements; (5) shielding and personnel exposure; (6) containment and structural design; (7) main steam and turbine cycles; (8) plant electrical system; (9) plant instrumentation and control systems; (10) radioactive waste disposal (waste management) and (11) conclusion
Self-powered detectors for power reactors: an overview
Energy Technology Data Exchange (ETDEWEB)
Ma, J. [Univ. of Western Ontario, Dept. of Mechanical and Materials Engineering, London, Ontario (Canada)]. E-mail: jma64@uwo.ca
2006-07-01
In this paper, Self-Powered Detectors (SPDs) for applications in nuclear power reactors have been reviewed. Based on their responses to radiation, these detectors can be divided into delayed response Self-Powered Neutron Detector (SPND), prompt response SPND and Self-Powered Gamma Detector (SPGD). The operational principles of these detectors are presented and their distinctive characteristics are examined accordingly. The analytical models and Monte Carlo method to calculate the responses of these detectors to neutron flux and external gamma rays are reviewed. The paper has also considered some related signal processing techniques, such as detector calibrations and detector signal compensations. Furthermore, a couple of failure modes have also been analyzed. Finally, applications of SPD in nuclear power reactors are summarized. (author)
International Nuclear Information System (INIS)
Douglas-Hamilton, J.; Home Robertson, J.; Beith, A.J.
1987-01-01
In this debate the Government's policy on nuclear power is discussed. Government policy is that nuclear power is the safest and cleanest way of generating electricity and is cheap. Other political parties who do not endorse a nuclear energy policy are considered not to be acting in the people's best interests. The debate ranged over the risks from nuclear power, the UK safety record, safety regulations, and the environmental effects of nuclear power. The Torness nuclear power plant was mentioned specifically. The energy policy of the opposition parties is strongly criticised. The debate lasted just over an hour and is reported verbatim. (UK)
Reactive power management of power networks with wind generation
Amaris, Hortensia; Ortega, Carlos Alvarez
2012-01-01
As the energy sector shifts and changes to focus on renewable technologies, the optimization of wind power becomes a key practical issue. Reactive Power Management of Power Networks with Wind Generation brings into focus the development and application of advanced optimization techniques to the study, characterization, and assessment of voltage stability in power systems. Recent advances on reactive power management are reviewed with particular emphasis on the analysis and control of wind energy conversion systems and FACTS devices. Following an introduction, distinct chapters cover the 5 key
Wind power and the conditions at a liberalized power market
International Nuclear Information System (INIS)
Morthorst, P.E.
2003-01-01
Wind power is undergoing a rapid development nationally as well as globally and in a number of countries covers an increasing part of the power supply. At the same time an ongoing liberalization of power markets is taking place and to an increasing extent the owners of wind power plants will themselves have to be responsible for trading the power at the spot market and financially handling the balancing. In the western part of Denmark (Jutland/Funen area), wind-generated power from time to time covers almost 100% of total power consumption. Therefore some examples are chosen from this area to analyse in more detail how well large amounts of wind power in the short-term are handled at the power spot market. It turns out that there is a tendency that more wind power in the system in the short run leads to relatively lower spot prices, while less wind power implies relatively higher spot prices, although, with the exception of December 2002, in general no strong relationship is found. A stronger relationship is found at the regulating market, where there is a fairly clear tendency that the more wind power produced, the higher is the need for down-regulation, and, correspondingly, the less wind power produced, the higher is the need for up-regulation. In general for the Jutland/Funen area the average cost of down-regulation is calculated as 1 2 c euros/kWh regulated for 2002, while the cost of up-regulation amounts to 0 7 c euros/kWh regulated. (author)
International Nuclear Information System (INIS)
Wen, Huiqing; Su, Bin
2016-01-01
Highlights: • Four operating modes of Dual-Phase-Shift control for Dual Active Bridge converter are presented. • Effects of “minor parameters” such as the deadtime and power device voltage drops are analyzed. • Accurate power flow models with Dual-Phase-Shift control are developed and verified with experimental results. • Optimal operating mode is determined with respect to the efficiency improvement. • Measured efficiency of the Dual Active Bridge converter is improved up to 14%. - Abstract: Due to the intermittent nature of the renewable energy sources including photovoltaic and wind energy, the energy storage systems are essential to stabilize dc bus voltage. Considering the discharge depth of super-capacitors and energy-storage batteries, the bidirectional isolated power interface will operate for a wide range of voltage and power. This study focuses on in-depth analysis of the dual-active-bridge dc–dc converter that is controlled by the dual-phase-shift scheme to improve the conversion efficiency in distributed power system. The power flow of each operating mode with dual-phase-shift control is characterized based on a detailed analysis of the effects of “minor parameters”, including the deadtime and power device voltage drops. The complete output power plane of the dual-active-bridge converter with dual-phase-shift control is obtained and compared with experimental results. The optimal operating mode is determined according to the practical output power range and the power flow characteristics. Experimental evaluation shows the effectiveness of the proposed power flow model with dual-phase-shift control and significant efficiency improvement using the optimal mode of dual-phase-shift compared with the conventional phase shift control.
Strelan, Peter; Weick, Mario; Vasiljevic, Milica
2014-09-01
We took an individual differences approach to explain revenge tendencies in powerholders. Across four experimental studies, chronically powerless individuals sought more revenge than chronically powerful individuals following a high power episode (Studies 1 and 2), when striking a powerful pose (Study 3), and when making a powerful hand gesture (Study 4). This relationship vanished when participants were not exposed to incidental power. A meta-analysis revealed that, relative to a lack of power or a neutral context, exposure to incidental power increased vengeance among the chronically powerless and reduced vengeance among the chronically powerful. These findings add to previous research on relations between power and aggression, and underscore the role of individual differences as a determinant of powerholders' destructive responses. © 2013 The British Psychological Society.
International Nuclear Information System (INIS)
Sioshansi, F.P.; Altman, A.M.
1998-01-01
One of the most significant developments in the US electric power industry in recent years has been the phenomenal growth of power marketing. What was barely a blimp on the radar screen in 1992 has turned out to be a jumbo jet. This article explains what is power marketing who are power marketers, what role play these players and what will be their longer-term impact on the traditional industry [it
Active Power Controls from Wind Power: Bridging the Gaps
Energy Technology Data Exchange (ETDEWEB)
Ela, E. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gevorgian, V. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Fleming, P. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Zhang, Y. C. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Singh, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Muljadi, E. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Scholbrook, A. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Aho, J. [Univ. of Colorado, Boulder, CO (United States); Buckspan, A. [Univ. of Colorado, Boulder, CO (United States); Pao, L. [Univ. of Colorado, Boulder, CO (United States); Singhvi, V. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Tuohy, A. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Pourbeik, P. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Brooks, D. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Bhatt, N. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States)
2014-01-01
This paper details a comprehensive study undertaken by the National Renewable Energy Laboratory, Electric Power Research Institute, and the University of Colorado to understand how the contribution of wind power providing active power control (APC) can benefit the total power system economics, increase revenue streams, improve the reliability and security of the power system, and provide superior and efficient response while reducing any structural and loading impacts that may reduce the life of the wind turbine or its components. The study includes power system simulations, control simulations, and actual field tests using turbines at NREL's National Wind Technology Center (NWTC). The study focuses on synthetic inertial control, primary frequency control, and automatic generation control, and analyzes timeframes ranging from milliseconds to minutes to the lifetime of wind turbines, locational scope ranging from components of turbines to large wind plants to entire synchronous interconnections, and additional topics ranging from economics to power system engineering to control design.
Minimum critical power ratio control device for nuclear power plants
International Nuclear Information System (INIS)
Kurosawa, Tsuneo.
1991-01-01
Reactor core flowrate is determined by comparing a minimum critical power ratio calculated based on the status amount of a nuclear power plant and a control value for the minimum critical power ratio that depends on the reactor core flowrate. Further, the minimum critical power ratio and a control value for the minimum critical power ratio that depends on the reactor thermal power are compared to set a reactor thermal power converted to a reactor core flowrate. Deviation between the thus determined reactor core flowrate and the present reactor core flowrate is calculated. When the obtained deviation is lower than a rated value, a reactor core flowrate set signal is generated to a reactor flowrate control means, to control the reactor power by a recycling flowrate control system of the reactor. On the other hand, when the deviation exceeds the determined value, the reactor core flowrate set signal is converted into a reactor thermal power, to control the position of control rods and control the reactor power. Then, monitor and control can be conducted safely and automatically without depending on operator's individual ability over the entire operation range corresponding to load following operation. (N.H.)
Energy Technology Data Exchange (ETDEWEB)
Huser, A.
2005-07-01
This final report for the Swiss Federal Office of Energy (SFOE) takes a look at methods of supplying small equipment such as Internet telephones, web cams, hubs, hard discs, audio equipment, point-of-sale terminals, game consoles etc. with power via their Ethernet connections. A short comparison is presented between Power over Ethernet (PoE) and other methods of supplying power along with data, including Universal Serial Bus (USB), FireWire and Powerline systems. The advantages of PoE over the use of separate power supply units are discussed and recommendations are made to the manufacturers and users of small peripheral equipment regarding the dimensioning and loading of such power supply systems.
Synthesis of Silicon Nanocrystals in Microplasma Reactor
Nozaki, Tomohiro; Sasaki, Kenji; Ogino, Tomohisa; Asahi, Daisuke; Okazaki, Ken
Nanocrystalline silicon particles with a grain size of at least less than 10 nm are widely recognized as one of the key materials in optoelectronic devices, electrodes of lithium battery, bio-medical labels. There is also important character that silicon is safe material to the environment and easily gets involved in existing silicon technologies. To date, several synthesis methods such as sputtering, laser ablation, and plasma enhanced chemical vapor deposition (PECVD) based on low-pressure silane chemistry (SiH4) have been developed for precise control of size and density distributions of silicon nanocrystals. We explore the possibility of microplasma technologies for the efficient production of mono-dispersed nanocrystalline silicon particles in a micrometer-scale, continuous-flow plasma reactor operated at atmospheric pressure. Mixtures of argon, hydrogen, and silicon tetrachloride were activated using very high frequency (VHF = 144 MHz) power source in a capillary glass tube with a volume of less than 1 μ-liter. Fundamental plasma parameters of VHF capacitively coupled microplasma were characterized by optical emission spectroscopy, showing electron density of approximately 1015 cm-3 and rotational temperature of 1500 K, respectively. Such high-density non-thermal reactive plasma has a capability of decomposing silicon tetrachloride into atomic silicon to produce supersaturated atomic silicon vapor, followed by gas phase nucleation via three-body collision. The particle synthesis in high-density plasma media is beneficial for promoting nucleation process. In addition, further growth of silicon nuclei was able to be favorably terminated in a short-residence time reactor. Micro Raman scattering spectrum showed that as-deposited particles were mostly amorphous silicon with small fraction of silicon nanocrystals. Transmission electron micrograph confirmed individual silicon nanocrystals of 3-15 nm size. Although those particles were not mono-dispersed, they were
Multi-time scale dynamics in power electronics-dominated power systems
Yuan, Xiaoming; Hu, Jiabing; Cheng, Shijie
2017-09-01
Electric power infrastructure has recently undergone a comprehensive transformation from electromagnetics to semiconductors. Such a development is attributed to the rapid growth of power electronic converter applications in the load side to realize energy conservation and on the supply side for renewable generations and power transmissions using high voltage direct current transmission. This transformation has altered the fundamental mechanism of power system dynamics, which demands the establishment of a new theory for power system control and protection. This paper presents thoughts on a theoretical framework for the coming semiconducting power systems.
Modelling of electrical power systems for power flow analysis
Energy Technology Data Exchange (ETDEWEB)
Cogo, Joao Roberto [Escola Federal de Engenharia de Itajuba, MG (Brazil)
1994-12-31
The industry systems in Brazil are responsible for a consumption of over 50% (fifty per cent) of the total electrical power generated: therefore, they are import loads in power flow studies, and their modeling should be as much the best. Usually, in power flow studies, the industry systems are modeled by taking the influence of the power (active and reactive) and of the current on the voltage into account. Since the inducting motors, within the industry systems, represent at least 50% (fifty per cent) of the power consumption, and a large part of them is oversize, it is proposed to represent the industry systems as a function of the characteristic of power on shaft versus voltage into account. Since the induction motors, within the industry systems, represent at least 50% (fifty per cent) of the power consumption, and a large part of them is oversized, it is proposed to represent the industry systems as a function of the characteristics of power on shaft versus voltage for the analysis of power systems, aiming a load flow study. Thereafter, a model of an equivalent motor which has a basis the typical performance curve of an induction motor is present. This model is obtained from empirical parameters, surveyed from a population of over 1000 motors. (author) 3 refs., 1 fig., 4 tabs.
Mattsson, Markus; Summala, Heikki
2010-02-01
Current European legislation allows the EU member states to restrict the maximum power output of motorcycles to 74 kW even though evidence supporting the limit is scarce and has produced mixed results-perhaps because motorcycle performance has been measured by engine displacement, not engine power, in most of the previous studies. This study investigates the relationship of motorcycle engine power and power-to-weight ratio to risk of fatal and nonfatal crashes in Finland. The fatality rate (number of fatal accidents/number of registered motorbikes) for riders of different ages riding bikes belonging to different power and power-to-weight ratio classes was examined using a comprehensive in-depth database. Data on nonfatal accidents were acquired from a Web questionnaire (N = 2708), which also served as a basis for estimating riders' annual mileage. Mileage data allowed the calculation of accident risk per kilometer ridden for bikes differing in power and power-to-weight ratio. The fatality risk per number of registered motorcycles and per kilometer ridden increases both with power and power-to-weight ratio, independently of rider's age. No relationship between performance and risk of a less severe crash was found. The pre-accident speed of the most powerful bikes was 20 km/h or more over the speed limit in a large proportion of the fatal accidents (odds ratio = 4.8 for > 75 kW motorbikes; odds ratio = 6.2 for > 0.3 kW/kg motorbikes). The risk of being involved in a fatal crash is higher among the riders of powerful motorcycles. However, it is not clear whether the results are related to the riding habits of the riders that choose the most powerful bikes available or whether the high risk is due to the properties of the bikes themselves. Therefore, further research is needed before considering legal limits on motorcycle performance.
International Nuclear Information System (INIS)
Whitmore, J.; Bramley, M.; Holmes, R.
2004-09-01
Green power is defined as electricity produced from renewable sources, and whose production has low adverse impacts on the environment, human health and communities. Green power has near-zero greenhouse gas (GHG) emissions and includes sources such as wind, hydro, and solar power. It offers several environmental benefits, as well as the enhancement of energy security, regional development, economic diversification and the creation of skilled jobs. There are four categories of programs related to green power development in Canada: government green power policies, utility green power development programs, green power marketing initiatives, and green power certificate marketing initiatives. Most of the activities in Canada associated with these four categories in 2003 were discussed in this report. However, difficulties with quantification prevented the inclusion of some green power activities such as (1) the generation of green power not certified or identified by the generator as green power, (2) industry or residential self-generation, (3) net metering, and (4) small government programs. Green power generation facilities in 2003 totaled 775 MW of capacity compared to 539 MW in 2002. Hydro capacity represented 41 per cent, followed by wind capacity at 40 per cent and wood waste at 17 per cent. Most of the green power generation facilities in 2003 were located in Alberta, followed by British Columbia, Ontario and Quebec. 230 refs., 8 tabs., 1 fig
Non-power application as an entry point to nuclear power program
International Nuclear Information System (INIS)
Nahrul Khair Alang Md Rashid
2009-01-01
Nuclear power is usually viewed as the flagship of nuclear technology. A nuclear power plant complex, visible and prominence, is iconic of the technology. That image makes its presence common knowledge to the extent that nuclear technology is equated almost totally with nuclear power by the general public. The downside of this visibility is that it becomes easy target in public misinformation programs. The non-power applications however are not visible, and devoid of icon. The non-power applications, therefore, can grow quite smoothly, attracting only little attention in the negative and in the positive senses. According to a study conducted in the USA in 2000 and in Japan in 2002, the socio-economic impact of non-power and power applications of nuclear technology are comparable. Involvement in non-power applications can be a good grounding for moving into power applications. This paper discusses the non-power nuclear technology applications and in what manner it can serve to prepare the introduction of nuclear power program. (Author)
International Nuclear Information System (INIS)
Nunez, Anibal D.
2001-01-01
In the second half of twentieth century, nuclear power became an industrial reality. Now the operating 433 power plants, the 37 plants under construction, near 9000 years/reactor with only one serious accident with emission of radioactive material to the environment (Chernobyl) show the maturity of this technology. Today nuclear power contribute a 17% to the global generation and an increase of 75 % of the demand of electricity is estimated for 2020 while this demand is expected to triplicate by 2050. How this requirement can be satisfied? All the indicators seems to demonstrate that nuclear power will be the solution because of the shortage of other sources, the increase of the prices of the non renewable fuels and the scarce contribution of the renewable ones. In addition, the climatic changes produced by the greenhouse effect make even more attractive nuclear power. The situation of Argentina is analyzed and compared with other countries. The convenience of an increase of nuclear power contribution to the total national generation seems clear and the conclusion of the construction of the Atucha II nuclear power plant is recommended
O'Sullivan, George A.; O'Sullivan, Joseph A.
1999-01-01
In one embodiment, a power processor which operates in three modes: an inverter mode wherein power is delivered from a battery to an AC power grid or load; a battery charger mode wherein the battery is charged by a generator; and a parallel mode wherein the generator supplies power to the AC power grid or load in parallel with the battery. In the parallel mode, the system adapts to arbitrary non-linear loads. The power processor may operate on a per-phase basis wherein the load may be synthetically transferred from one phase to another by way of a bumpless transfer which causes no interruption of power to the load when transferring energy sources. Voltage transients and frequency transients delivered to the load when switching between the generator and battery sources are minimized, thereby providing an uninterruptible power supply. The power processor may be used as part of a hybrid electrical power source system which may contain, in one embodiment, a photovoltaic array, diesel engine, and battery power sources.
Credit Risk Evaluation of Large Power Consumers Considering Power Market Transaction
Fulin, Li; Erfeng, Xu; ke, Sun; Dunnan, Liu; Shuyi, Shen
2018-03-01
Large power users will participate in power market in various forms after power system reform. Meanwhile, great importance has always attached to the construction of the credit system in power industry. Due to the difference between the awareness of performance and the ability to perform, credit risk of power customer will emerge accordingly. Therefore, it is critical to evaluate credit risk of large power customers in the new situation of power market. Firstly, this paper constructs index system of credit risk of large power customers, and establishes evaluation model of interval number and AHP-entropy weight method.
Dynamic Influences of Wind Power on The Power System
DEFF Research Database (Denmark)
Rosas, Pedro Andrè Carvalho
2004-01-01
between different wind turbines.Here the wind speed model is applied to a constant rotational speed wind turbine/farm, but the model is suit-able to variable speed wind turbine/farm as well. The cases presented here illustrate the influences of the wind power on the power systemquality and stability...... integration due to the low spatial correlation of the wind speed. The voltage quality analysed in a Brazilian power system and in the Nordel power system from connecting largeamount of wind power showed very small voltage variations. The frequency variations analysed from the Nordel showed also small varia...
Will cross-ownership reestablish market power in the Nordic power market?
International Nuclear Information System (INIS)
Amundsen, Eirik S.; Bergman, Lars
2000-01-01
The integration of the power markets in Norway and Sweden in 1996 significantly constrained the major power companies' ability to exercise market power within their national borders. In recent years, however, mergers and reciprocal acquisition of shares have reduced the number of independent players on the Norwegian-Swedish power market. The aim of this paper is to explore to what extent increasing cross-ownership among major power companies in Norway and Sweden might re-establish the market power that was lost when the two national power markets were integrated. The analysis is based on a numerical model, assuming Cournot quantity setting behaviour, of the Norwegian-Swedish power market. The simulation results suggest that partial ownership relations between major generators and other power-producing firms tend to increase horizontal market power and thus the market price of electricity. (author)
High power fast ramping power supplies
Energy Technology Data Exchange (ETDEWEB)
Marneris,I.; Bajon, E.; Bonati, R.; Sandberg, J.; Roser, T.; Tsoupas, N.
2009-05-04
Hundred megawatt level fast ramping power converters to drive proton and heavy ion machines are under research and development at accelerator facilities in the world. This is a leading edge technology. There are several topologies to achieve this power level. Their advantages and related issues will be discussed.
Characterization of power IGBTs under pulsed power conditions
Energy Technology Data Exchange (ETDEWEB)
Dale, Gregory E [Los Alamos National Laboratory; Vangordon, James [UNIV OF MISSOURI; Kovaleski, Scott [UNIV OF MISSOURI
2009-01-01
The power insulated gate bipolar transistor (IGBT) is used in many types of applications. Although the use of the power IGBT has been well characterized for many continuous operation power electronics applications, little published information is available regarding the performance of a given IGBT under pulsed power conditions. Additionally, component libraries in circuit simulation software packages have a finite number of IGBTs. This paper presents a process for characterizing the performance of a given power IGBT under pulsed power conditions. Specifically, signals up to 3.5 kV and 1 kA with 1-10 {micro}s pulse widths have been applied to a Powerex QIS4506001 IGBT. This process utilizes least squares curve fitting techniques with collected data to determine values for a set of modeling parameters. These parameters were used in the Oziemkiewicz implementation of the Hefner model for the IGBT that is utilized in some circuit simulation software packages. After the nominal parameter values are determined, they can be inserted into the Oziemkiewicz implementation to simulate a given IGBT.
International Nuclear Information System (INIS)
Bramley, M.; Boustie, S.; Vadgama, J.; Wieler, C.; Pape-Salmon, A.; Holmes, R.
2003-11-01
Green power is generally defined as electricity produced from renewable sources, and whose production has low adverse impacts on the environment, human health and communities. Green power has near-zero greenhouse gas (GHG) emissions and includes sources such as wind, hydro, and solar power. Green power offers several environmental benefits, as well as the enhancement of energy security, regional development, economic diversification and the creation of skilled jobs. There are four categories of programs related to green power development in Canada: government green power policies, utility green power development programs, green power marketing initiatives, and green power certificate marketing initiatives. Most of the activities associated with these four categories in 2002 were discussed in this report. However, difficulties with quantification prevented the inclusion of some green power activities in the report, such as (1) the generation of green power not certified or identified by the generator as green power, (2) industry or residential self-generation, (3) net metering, and (4) small government programs. Each category was presented in detail. The information included in the report was based on surveys sent to each program proponent. Follow-up communications and other publicly available information was also included. New programs operating in 2003 or currently under development were listed. refs., 8 tabs
Felt power explains the link between position power and experienced emotions.
Bombari, Dario; Schmid Mast, Marianne; Bachmann, Manuel
2017-02-01
The approach/inhibition theory by Keltner, Gruenfeld, and Anderson (2003) predicts that powerful people should feel more positive and less negative emotions. To date, results of studies investigating this prediction are inconsistent. We fill this gap with four studies in which we investigated the role of different conceptualizations of power: felt power and position power. In Study 1, participants were made to feel more or less powerful and we tested how their felt power was related to different emotional states. In Studies 2, 3, and 4, participants were assigned to either a high or a low power role and engaged in an interaction with a virtual human, after which participants reported on how powerful they felt and the emotions they experienced during the interaction. We meta-analytically combined the results of the four studies and found that felt power was positively related to positive emotions (happiness and serenity) and negatively to negative emotions (fear, anger, and sadness), whereas position power did not show any significant overall relation with any of the emotional states. Importantly, felt power mediated the relationship between position power and emotion. In summary, we show that how powerful a person feels in a given social interaction is the driving force linking the person's position power to his or her emotional states. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
... Publications Emergency Alerts Preparedness Portal Preparedness Messaging Calendar Social Media Preparedness Toolkits Preparedness News Languages About Us Build a Kit Close Search Enter Search Term(s): Main Content Home Be Informed Power Outages Power Outages Extended power outages may impact ...
Electric Vehicles in Power Systems with 50% Wind Power Penetration
DEFF Research Database (Denmark)
Østergaard, Jacob; Foosnæs, Anders; Xu, Zhao
2009-01-01
will be an important balancing measure to enable the Danish government’s energy strategy, which implies 50% wind power penetration in the electric power system. An EV will be a storage device for smoothing power fluctuations from renewable resources especially wind power and provide valuable system services...... for a reliable power system operation. Cost-benefit analysis shows that intelligent bidirectional charging – vehicle to grid (V2G) – provides a socio-economic profit of 150 million Euro/year in the Danish electric power system in 2025 assuming that 15% of the Danish road transport need is supplied by electricity....... This paper analyse the potential for using EVs in Denmark and identify the benefits of the electric power system with high wind power generation by intelligent charging of the EVs. Based on the analysis important technology gabs are identified, and the corresponding research and development initiatives...
Power control strategy of a photovoltaic power plant for microgrid applications
Energy Technology Data Exchange (ETDEWEB)
Li, Peng [Ecole Centrale de Lille, Cite Scientifique, Villeneuve d' Ascq (FR). Laboratoire d' Electrotechnique et d' Electronique de Puissance de Lille (L2EP); Ecole Nationale Superieure d' Arts et Metiers, Lille (FR). Laboratoire d' Electrotechnique et d' Electronique de Puissance de Lille (L2EP); Francois, Bruno [Ecole Centrale de Lille, Cite Scientifique, Villeneuve d' Ascq (FR). Laboratoire d' Electrotechnique et d' Electronique de Puissance de Lille (L2EP); Degobert, Philippe [Ecole Nationale Superieure d' Arts et Metiers, Lille (FR). Laboratoire d' Electrotechnique et d' Electronique de Puissance de Lille (L2EP); Robyns, Benoit [Hautes Etudes d' Ingenieur, Lille (FR). Laboratoire d' Electrotechnique et d' Electronique de Puissance de Lille (L2EP)
2008-07-01
Photovoltaic power plants operates currently maximal power point tracking (MPPT). For microgrid applications, however, a PV power plant can not operate in the MPPT mode in all conditions. When a microgrid is islanded from the grid with few loads, a limitation of the produced power by PV plants is required and prescribed by the Distribution System Operator. This paper proposes a power control technique integrated into a dynamic model of a PV power plant by using equivalent continuous models of power electronic converters. The power limitation mode of the PV is performed by applying the correct PV terminal voltage, which corresponds to the prescribed power reference. The proposed global model is validated by simulations with the help of Matlab-Simulink trademark. (orig.)
How to Integrate Variable Power Source into a Power Grid
Asano, Hiroshi
This paper discusses how to integrate variable power source such as wind power and photovoltaic generation into a power grid. The intermittent renewable generation is expected to penetrate for less carbon intensive power supply system, but it causes voltage control problem in the distribution system, and supply-demand imbalance problem in a whole power system. Cooperative control of customers' energy storage equipment such as water heater with storage tank for reducing inverse power flow from the roof-top PV system, the operation technique using a battery system and the solar radiation forecast for stabilizing output of variable generation, smart charging of plug-in hybrid electric vehicles for load frequency control (LFC), and other methods to integrate variable power source with improving social benefits are surveyed.
Yoon, David J; Farmer, Steven M
2018-01-02
Building on the approach/inhibition theory of power and the situated focus theory of power, we examine the roles of positional and personal power on altruism and incivility in workplace dyads. Results from a field study in daycare centers showed that legitimate power (a dimension of positional power) was positively associated with incivility. In contrast, personal power-referent power and expert power-was positively associated altruism and was negatively associated with incivility. Referent power was a stronger predictor of both altruism and incivility for individuals with low humility than those with high humility. Coercive power was a stronger predictor of incivility for individuals with high humility than those with low humility.
76 FR 77963 - Oglethorpe Power Corporation; Proposed Biomass Power Plant
2011-12-15
... Service Oglethorpe Power Corporation; Proposed Biomass Power Plant AGENCY: Rural Utilities Service, USDA... related to possible financial assistance to Oglethorpe Power Corporation's (Oglethorpe) for the... online at the following Web site: http://www.rurdev.usda.gov/UWP-OglethorpePower.html and at the: Warren...
Impact of Wind Power Generation on European Cross-Border Power Flows
DEFF Research Database (Denmark)
Zugno, Marco; Pinson, Pierre; Madsen, Henrik
2013-01-01
analysis is employed in order to reduce the problem dimension. Then, nonlinear relationships between forecast wind power production as well as spot price in Germany, by far the largest wind power producer in Europe, and power flows are modeled using local polynomial regression. We find that both forecast...... wind power production and spot price in Germany have substantial nonlinear effects on power transmission on a European scale.......A statistical analysis is performed in order to investigate the relationship between wind power production and cross-border power transmission in Europe. A dataset including physical hourly cross-border power exchanges between European countries as dependent variables is used. Principal component...
Material Proximities and Hotspots: Toward an Anthropology of Viral Hemorrhagic Fevers
Brown, Hannah; Kelly, Ann H
2014-01-01
This article outlines a research program for an anthropology of viral hemorrhagic fevers (collectively known as VHFs). It begins by reviewing the social science literature on Ebola, Marburg, and Lassa fevers and charting areas for future ethnographic attention. We theoretically elaborate the hotspot as a way of integrating analysis of the two routes of VHF infection: from animal reservoirs to humans and between humans. Drawing together recent anthropological investigations of human–animal entanglements with an ethnographic interest in the social production of space, we seek to enrich conceptualizations of viral movement by elaborating the circumstances through which viruses, humans, objects, and animals come into contact. We suggest that attention to the material proximities—between animals, humans, and objects—that constitute the hotspot opens a frontier site for critical and methodological development in medical anthropology and for future collaborations in VHF management and control. PMID:24752909
System, method, and apparatus for remote measurement of terrestrial biomass
Johnson, Patrick W [Jefferson, MD
2011-04-12
A system, method, and/or apparatus for remote measurement of terrestrial biomass contained in vegetative elements, such as large tree boles or trunks present in an area of interest, are provided. The method includes providing an airborne VHF radar system in combination with a LiDAR system, overflying the area of interest while directing energy toward the area of interest, using the VHF radar system to collect backscatter data from the trees as a function of incidence angle and frequency, and determining a magnitude of the biomass from the backscatter data and data from the laser radar system for each radar resolution cell. A biomass map is generated showing the magnitude of the biomass of the vegetative elements as a function of location on the map by using each resolution cell as a unique location thereon. In certain preferred embodiments, a single frequency is used with a linear array antenna.
Gray Wolf (Canis lupus) dyad monthly association rates by demographic group.
Barber-Meyer, Shannon M.; Mech, L. David
2015-01-01
Preliminary data from GPS-collared wolves (Canis lupus) in the Superior National Forest of northeastern Minnesota indicated wolves had low association rates with packmates during summer. However, aerial-telemetry locations of very high frequency (VHF)-radioed wolves in this same area showed high associations among packmates during winter. We analyzed aerial-telemetry-location data from VHF-collared wolves in several packs (n=18 dyads) in this same area from 1994-2012 by month, and found lowest association rates occurred during June. While other studies have found low association among wolf packmates during summer, information on differences in association patterns depending on the wolf associates’ demographics is sparse. During May-July, association rates were greatest for breeding pairs, followed by sibling dyads, and lowest for parent– offspring dyads. Our findings improve our understanding of how individual wolf relationships affect monthly association rates. We highlight some important remaining questions regarding wolf packmate associations.
Instantaneous power theory and applications to power conditioning
Akagi, Hirofumi; Aredes, Mauricio
2017-01-01
This new edition, written by a team of experts in the field, is fully updated with information on the latest electric power technology. The instantaneous power theory, or “the p-q theory,” makes clear the physical meaning of what instantaneous real and imaginary power is in a three-phase circuit. Moreover, it provides insight into how energy flows from a source to a load, or circulates between phases, in a three-phase circuit. This theory can be used in the design and understanding of FACTS (Flexible AC Transmission System) compensators. The book introduces many concepts in the field of active filtering that are unique to this edition. It provides a study tool for final year undergraduate students, graduate students and engineers dealing ith harmonic pollution problems, reactive power compensation or power quality in general.
Power from waste. [Power plant at landfill site
Energy Technology Data Exchange (ETDEWEB)
Anon,
1991-01-01
Base Load Systems Ltd, a company in the United Kingdom, has just commissioned a power plant in Leicestershire which uses waste gases from a landfill site. The gases power two specially modified turbo charged engine and generator packages. The plant will use approximately 100 cu meters of landfill gas per hour and is expected to feed 1.5MW of electrical power into the supply network of East Midlands Electricity. Once the landfill site has been completely filled and capped with clay, it is estimated that the electrical power output will be 4 MW. At present, since their are no customers for heat in the vicinity, 100 KW of the electricity produced are used to run fans to dissipate the 2.5 MW of waste heat. Base load is also involved elsewhere in combined heat and power projects. (UK).
International Nuclear Information System (INIS)
Kangas, H.
2001-01-01
The frost in February increased the power demand in Finland significantly. The total power consumption in Finland during January-February 2001 was about 4% higher than a year before. In January 2001 the average temperature in Finland was only about - 4 deg C, which is nearly 2 degrees higher than in 2000 and about 6 degrees higher than long term average. Power demand in January was slightly less than 7.9 TWh, being about 0.5% less than in 2000. The power consumption in Finland during the past 12 months exceeded 79.3 TWh, which is less than 2% higher than during the previous 12 months. In February 2001 the average temperature was - 10 deg C, which was about 5 degrees lower than in February 2000. Because of this the power consumption in February 2001 increased by 5%. Power consumption in February was 7.5 TWh. The maximum hourly output of power plants in Finland was 13310 MW. Power consumption of Finnish households in February 2001 was about 10% higher than in February 2000, and in industry the increase was nearly zero. The utilization rate in forest industry in February 2001 decreased from the value of February 2000 by 5%, being only about 89%. The power consumption of the past 12 months (Feb. 2000 - Feb. 2001) was 79.6 TWh. Generation of hydroelectric power in Finland during January - February 2001 was 10% higher than a year before. The generation of hydroelectric power in Jan. - Feb. 2001 was nearly 2.7 TWh, corresponding to 17% of the power demand in Finland. The output of hydroelectric power in Finland during the past 12 months was 14.7 TWh. The increase from the previous 12 months was 17% corresponding to over 18% of the power demand in Finland. Wind power generation in Jan. - Feb. 2001 was exceeded slightly 10 GWh, while in 2000 the corresponding output was 20 GWh. The degree of utilization of Finnish nuclear power plants in Jan. - Feb. 2001 was high. The output of these plants was 3.8 TWh, being about 1% less than in Jan. - Feb. 2000. The main cause for the
Dynamic Reactive Power Compensation of Large Scale Wind Integrated Power System
DEFF Research Database (Denmark)
Rather, Zakir Hussain; Chen, Zhe; Thøgersen, Paul
2015-01-01
wind turbines especially wind farms with additional grid support functionalities like dynamic support (e,g dynamic reactive power support etc.) and ii) refurbishment of existing conventional central power plants to synchronous condensers could be one of the efficient, reliable and cost effective option......Due to progressive displacement of conventional power plants by wind turbines, dynamic security of large scale wind integrated power systems gets significantly compromised. In this paper we first highlight the importance of dynamic reactive power support/voltage security in large scale wind...... integrated power systems with least presence of conventional power plants. Then we propose a mixed integer dynamic optimization based method for optimal dynamic reactive power allocation in large scale wind integrated power systems. One of the important aspects of the proposed methodology is that unlike...
Vehicle-to-Grid Power in Danish Electric Power Systems
DEFF Research Database (Denmark)
Pillai, Jayakrishnan Radhakrishna; Bak-Jensen, Birgitte
2009-01-01
The integration of renewable energy systems is often constrained by the variable nature of their output. This demands for the services of storing the electricity generated from most of the renewable energy sources. Vehicle-to-grid (V2G) power could use the inherent energy storage of electric...... vehicles and its quick response time to balance and stabilize a power system with fluctuating power. This paper outlines the use of battery electric vehicles in supporting large-scale integration of renewable energy in the Danish electric power systems. The reserve power requirements for a high renewable...... energy penetration could be met by an amount of V2G based electric vehicles less than 10% of the total vehicle need in Denmark. The participation of electric vehicle in ancillary services would earn significant revenues to the vehicle owner. The power balancing services of electric vehicles...
Kranichfeld, Marion L.
1987-01-01
Men's power is emphasized in the family power literature on marital decision making. Little attention has been paid to women's power, accrued through their deeper embeddedness in intrafamilial roles. Micro-level analysis of family power demonstrates that women's positions in the family power structure rest not on the horizontal marital tie but…
Thermoelectric self-cooling for power electronics: Increasing the cooling power
International Nuclear Information System (INIS)
Martinez, Alvaro; Astrain, David; Aranguren, Patricia
2016-01-01
Thermoelectric self-cooling was firstly conceived to increase, without electricity consumption, the cooling power of passive cooling systems. This paper studies the combination of heat pipe exchangers and thermoelectric self-cooling, and demonstrates its applicability to the cooling of power electronics. Experimental tests indicate that source-to-ambient thermal resistance reduces by around 30% when thermoelectric self-cooling system is installed, compared to that of the heat pipe exchanger under natural convection. Neither additional electric power nor cooling fluids are required. This thermal resistance reaches 0.346 K/W for a heat flux of 24.1 kW/m"2, being one order of magnitude lower than that obtained in previous designs. In addition, the system adapts to the cooling demand, reducing this thermal resistance for increasing heat. Simulation tests have indicated that simple system modifications allow relevant improvements in the cooling power. Replacement of a thermoelectric module with a thermal bridge leads to 33.54 kW/m"2 of top cooling power. Likewise, thermoelectric modules with shorter legs and higher number of pairs lead to a top cooling power of 44.17 kW/m"2. These results demonstrate the applicability of thermoelectric self-cooling to power electronics. - Highlights: • Cooling power of passive systems increased. • No electric power consumption. • Applicable for the cooling of power electronics. • Up to 44.17 kW/m"2 of cooling power, one order of magnitude higher. • Source-to-ambient thermal resistance reduces by 30%.
Operating experience feedback on lose of offsite power supply for nuclear power plant
International Nuclear Information System (INIS)
Jiao Feng; Hou Qinmai; Che Shuwei
2013-01-01
The function of the service power system of a nuclear power plant is to provide safe and reliable power supply for the nuclear power plant facilities. The safety of nuclear power plant power supply is essential for nuclear safety. The serious accident of Fukushima Daiichi nuclear power plant occurred due to loss of service power and the ultimate heat sink. The service power system has two independent offsite power supplies as working power and auxiliary power. This article collected events of loss of offsite power supply in operating nuclear power plants at home and abroad, and analyzed the plant status and cause of loss of offsite power supply events, and proposed improvement measures for dealing with loss of offsite power supply. (authors)
Power System Operation with Large-Scale Wind Power in Liberalised Environments
International Nuclear Information System (INIS)
Ummels, B.C.
2009-01-01
The disadvantages of producing electricity from fossil fuels are that their supply is finite and unevenly distributed across the earth. Conventional power stations also emit greenhouse gases. Therefore, sustainable alternatives must be developed, such as wind power. The disadvantages of wind are that it may or may not blow and that it is unpredictable. Th generation of electricity must however always equal the consumption. This makes the integration of wind power in the electricity system more difficult. This thesis investigates the integration of wind power into the existing power system. Simulation models are developed and used to explore the operation of power systems with a lot of wind power. The simulations provide a picture of the reliability, cost and emission of CO2 of the generation of electricity, with and without wind power. The research also takes into account electricity exchange on international markets. Possible solutions for integrating wind power, such as flexible power plants and energy storage, are investigated as well
International Nuclear Information System (INIS)
1985-01-01
Data concerning the existing nuclear power plants in the world are presented. The data was retrieved from the SIEN (Nuclear and Energetic Information System) data bank. The information are organized in table forms as follows: nuclear plants, its status and type; installed nuclear power plants by country; nuclear power plants under construction by country; planned nuclear power plants by country; cancelled nuclear power plants by country; shut-down nuclear power plants by country. (E.G.) [pt
SNS AC Power Distribution and Reliability of AC Power Supply
Holik, Paul S
2005-01-01
The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*
Wireless power pad with local power activation for portable devices
Waffenschmidt, E.; Zheglov, V.
2007-01-01
Wireless power transfer by magnetic induction offers a simple to use way to recharge mobile devices like e.g. mobile phone, music players or medical sensors. As shown by a previous report and an existing Power Pad demonstrator, wireless inductive power transfer is possible with a good power
Power quality improvement of unbalanced power system with distributed generation units
DEFF Research Database (Denmark)
Hu, Y.; Chen, Zhe; Excell, P.
2011-01-01
This paper presents a power electronic system for improving the power quality of the unbalanced distributed generation units in three-phase four-wire system. In the system, small renewable power generation units, such as small PV generator, small wind turbines may be configured as single phase...... and control of the converter are described. Simulation results have demonstrated that the system can effectively correct the unbalance and enhance the system power quality....... generation units. The random nature of renewable power sources may result in significant unbalance in the power network and affect the power quality. An electronic converter system is proposed to correct the system unbalance and harmonics so as to deal with the power quality problems. The operation...
Impact of Offshore Wind Power Integrated by VSC-HVDC on Power Angle Stability of Power Systems
Lu, Haiyang; Tang, Xisheng
2017-05-01
Offshore wind farm connected to grid by VSC-HVDC loses frequency support for power system, so adding frequency control in wind farm and VSC-HVDC system is an effective measure, but it will change wind farm VSC-HVDC’s transient stability on power system. Through theoretical analysis, concluding the relationship between equivalent mechanical power and electromagnetic power of two-machine system with the active power of wind farm VSC-HVDC, then analyzing the impact of wind farm VSC-HVDC with or without frequency control and different frequency control parameters on angle stability of synchronous machine by EEAC. The validity of theoretical analysis has been demonstrated through simulation in PSCAD/EMTDC.
International Nuclear Information System (INIS)
Fathi, H.M.E.
2012-01-01
The electrical power systems are exposed to different types of power quality disturbances problems. Assessment of power quality is necessary for maintaining accurate operation of sensitive equipment's especially for nuclear installations, it also ensures that unnecessary energy losses in a power system are kept at a minimum which lead to more profits. With advanced in technology growing of industrial / commercial facilities in many region. Power quality problems have been a major concern among engineers; particularly in an industrial environment, where there are many large-scale type of equipment. Thus, it would be useful to investigate and mitigate the power quality problems. Assessment of Power quality requires the identification of any anomalous behavior on a power system, which adversely affects the normal operation of electrical or electronic equipment. The choice of monitoring equipment in a survey is also important to ascertain a solution to these power quality problems. A power quality assessment involves gathering data resources; analyzing the data (with reference to power quality standards); then, if problems exist, recommendation of mitigation techniques must be considered. The main objective of the present work is to investigate and mitigate of power quality problems in nuclear installations. Normally electrical power is supplied to the installations via two sources to keep good reliability. Each source is designed to carry the full load. The Assessment of power quality was performed at the nuclear installations for both sources at different operation conditions. The thesis begins with a discussion of power quality definitions and the results of previous studies in power quality monitoring. The assessment determines that one source of electricity was deemed to have relatively good power quality; there were several disturbances, which exceeded the thresholds. Among of them are fifth harmonic, voltage swell, overvoltage and flicker. While the second
Dynamic Reactive Power Control in Offshore HVDC Connected Wind Power Plants
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain
2016-01-01
This paper presents a coordinated reactive power control for a HVDC connected cluster of offshore wind power plants (WPPs). The reactive power reference for the WPP cluster is estimated by an optimization algorithm aiming at minimum active power losses in the offshore AC Grid. For each optimal......, such as wind turbine (WT) terminal, collector cable, and export cable, on the dynamic voltage profile of the offshore grid is investigated. Furthermore, the dynamic reactive power contribution from WTs from different WPPs of the cluster for such faults has also been studied....... reactive power set point, the OWPP cluster controller generates reactive power references for each WPP which further sends the AC voltage/ reactive power references to the associated WTs based on their available reactive power margin. The impact of faults at different locations in the offshore grid...
International Nuclear Information System (INIS)
King, P.
1990-01-01
Written from the basis of neutrality, neither for nor against nuclear power this book considers whether there are special features of nuclear power which mean that its development should be either promoted or restrained by the State. The author makes it dear that there are no easy answers to the questions raised by the intervention of nuclear power but calls for openness in the nuclear decision making process. First, the need for energy is considered; most people agree that energy is the power to progress. Then the historicalzed background to the current position of nuclear power is given. Further chapters consider the fuel cycle, environmental impacts including carbon dioxide emission and the greenhouse effect, the costs, safety and risks and waste disposal. No conclusion either for or against nuclear power is made. The various shades of opinion are outlined and the arguments presented so that readers can come to their own conclusions. (UK)
Directory of Open Access Journals (Sweden)
Jiunn-Ming Sheen
2016-04-01
Full Text Available Increasing evidence has shown that many chronic diseases originate from early life, even before birth, through what are termed as fetal programming effects. Glucocorticoids are frequently used prenatally to accelerate the maturation of the lungs of premature infants. High-fat diets are associated with insulin resistance, but the effects of prenatal glucocorticoid exposure plus a postnatal high-fat diet in diabetes mellitus remain unclear. We administered pregnant Sprague-Dawley rats’ intraperitoneal dexamethasone (0.1 mg/kg body weight or vehicle at gestational days 14–20. Male offspring were administered a normal or high-fat diet starting from weaning. We assessed the effects of prenatal steroid exposure plus postnatal high-fat diet on the liver, pancreas, muscle and fat at postnatal day 120. At 15 and 30 min, sugar levels were higher in the dexamethasone plus high-fat diet (DHF group than the vehicle plus high-fat diet (VHF group in the intraperitoneal glucose tolerance test (IPGTT. Serum insulin levels at 15, 30 and 60 min were significantly higher in the VHF group than in the vehicle and normal diet group. Liver insulin receptor and adenosine monophosphate-activated protein kinase mRNA expressions and protein levels were lower in the DHF group. Insulin receptor and insulin receptor substrate-1 mRNA expressions were lower in the epididymal adipose tissue in the VHF and DHF groups. “Programming” of liver or epididymal adipose tissue resulted from prenatal events. Prenatal steroid exposure worsened insulin resistance in animals fed a high-fat diet.
Bhattacharyya, A.; Kakad, B.; Gurram, P.; Sripathi, S.; Sunda, S.
2017-01-01
An important aspect of the development of intermediate-scale length (approximately hundred meters to few kilometers) irregularities in an equatorial plasma bubble (EPB) that has not been considered in the schemes to predict the occurrence pattern of L-band scintillations in low-latitude regions is how these structures develop at different heights within an EPB as it rises in the postsunset equatorial ionosphere due to the growth of the Rayleigh-Taylor instability. Irregularities at different heights over the dip equator map to different latitudes, and their spectrum as well as the background electron density determine the strength of L-band scintillations at different latitudes. In this paper, VHF and L-band scintillations recorded at different latitudes together with theoretical modeling of the scintillations are used to study the implications of this structuring of EPBs on the occurrence and strength of L-band scintillations at different latitudes. Theoretical modeling shows that while S4 index for scintillations on a VHF signal recorded at an equatorial station may be >1, S4 index for scintillations on a VHF signal recorded near the crest of the equatorial ionization anomaly (EIA) generally does not exceed the value of 1 because the intermediate-scale irregularity spectrum at F layer peak near the EIA crest is shallower than that found in the equatorial F layer peak. This also explains the latitudinal distribution of L-band scintillations. Thus, it is concluded that there is greater structuring of an EPB on the topside of the equatorial F region than near the equatorial F layer peak.
Sheen, Jiunn-Ming; Hsieh, Chih-Sung; Tain, You-Lin; Li, Shih-Wen; Yu, Hong-Ren; Chen, Chih-Cheng; Tiao, Miao-Meng; Chen, Yu-Chieh; Huang, Li-Tung
2016-04-08
Increasing evidence has shown that many chronic diseases originate from early life, even before birth, through what are termed as fetal programming effects. Glucocorticoids are frequently used prenatally to accelerate the maturation of the lungs of premature infants. High-fat diets are associated with insulin resistance, but the effects of prenatal glucocorticoid exposure plus a postnatal high-fat diet in diabetes mellitus remain unclear. We administered pregnant Sprague-Dawley rats' intraperitoneal dexamethasone (0.1 mg/kg body weight) or vehicle at gestational days 14-20. Male offspring were administered a normal or high-fat diet starting from weaning. We assessed the effects of prenatal steroid exposure plus postnatal high-fat diet on the liver, pancreas, muscle and fat at postnatal day 120. At 15 and 30 min, sugar levels were higher in the dexamethasone plus high-fat diet (DHF) group than the vehicle plus high-fat diet (VHF) group in the intraperitoneal glucose tolerance test (IPGTT). Serum insulin levels at 15, 30 and 60 min were significantly higher in the VHF group than in the vehicle and normal diet group. Liver insulin receptor and adenosine monophosphate-activated protein kinase mRNA expressions and protein levels were lower in the DHF group. Insulin receptor and insulin receptor substrate-1 mRNA expressions were lower in the epididymal adipose tissue in the VHF and DHF groups. "Programming" of liver or epididymal adipose tissue resulted from prenatal events. Prenatal steroid exposure worsened insulin resistance in animals fed a high-fat diet.
Reactor power control systems in nuclear power plants
International Nuclear Information System (INIS)
Nakajima, Kazuo.
1980-01-01
Purpose: To enable power control by automatic control rod operation based on the calculated amounts of operation for the control rods determined depending on a power set value from reactor operators or on power variation amounts from other devices. Constitution: When an operator designates an automatic selection by way of a control rod operation panel, automatic signals are applied to a manual-automatic switching circuit and the mode judging circuit of a rod pattern control device. Then, mode signals such as for single operation, load setting, load following and the like produced by the operator are judged in a circuit, wherein a control rod pattern operation circuit calculates the designation for the control rods and the operation amounts for the control rods depending on the designated modes and automatic control is conducted for the control rods by a rod position control circuit, a rod drive control device and the like connected at a rod position monitor device. The reactor power is thus controlled automatically to reduce the operator's labours. The automatic power control can also be conducted in the same manner by the amount of power variations applied to the device from the external device. (Yoshino, Y.)
Reactor power control device in BWR power plant
International Nuclear Information System (INIS)
Kurosawa, Tsuneo.
1997-01-01
The present invention provides a device for controlling reactor power based on a start-up/shut down program in a BWR type reactor, as well as for detecting deviation, if occurs, of the power from the start-up/shut down program, to control a recycling flow rate control system or control rod drive mechanisms. Namely, a power instruction section successively executes the start-up/shut down program and controls the coolant recycling system and the control rod driving mechanisms to control the power. A current state monitoring and calculation section receives a process amount, calculates parameters showing the plant state, compares/monitors them with predetermined values, detecting the deviation, if occurs, of the plant state from the start-up/shut down program, and prevents output of a power increase control signal which leads to power increase. A forecasting and monitoring/calculation section forecasts and calculates the plant state when not yet executed steps of the start-up/shut down program are performed, stops the execution of the start-up/shut down program in the next step in a case of forecasting that the results of the calculation will deviate from the start-up/shut down program. (I.S.)
Wind power and market power in competitive markets
International Nuclear Information System (INIS)
Twomey, Paul; Neuhoff, Karsten
2010-01-01
Average market prices for intermittent generation technologies are lower than for conventional generation. This has a technical reason but can be exaggerated in the presence of market power. When there is much wind smaller amounts of conventional generation technologies are required, and prices are lower, while at times of little wind prices are higher. This effect reflects the value of different generation technologies to the system. But under conditions of market power, conventional generators with market power can further depress the prices if they have to buy back energy at times of large wind output and can increase prices if they have to sell additional power at times of little wind output. This greatly exaggerates the effect. Forward contracting does not reduce the effect. An important consequence is that allowing market power profit margins as a support mechanism for generation capacity investment is not a technologically neutral policy.
TinyPower – Power conversion on a tiny scale
DEFF Research Database (Denmark)
Han, Anpan; Jørgensen, Anders Michael
2014-01-01
The world surrounding us is filled with devices relying on electrical power and the rise of internet-of-thingswill mean that powering devices will remain important in the future. The size and cost of the power supplyhas become a dominant factor in many applications. At the same time, most of the ...... project is an ambitious approach to taking miniature power converters into a new domainand the trickle-down effect on micro fabricated inductors can hopefully benefit other projects....
A battery-powered high-current power supply for superconductors
Wake, M; Suda, K
2002-01-01
Since superconductors do not require voltages, a high-current power supply could run with low power if the voltage is sufficiently reduced. Even a battery-powered power supply could give as much as 2,000A for a superconductor. To demonstrate this hypothesis, a battery-powered 2,000A power supply was constructed. It uses an IGBT chopper and Schottky diode together with a specially arranged transformer to produce a high current with low voltage. Testing of 2,000A operation was performed for about 1.5 hr using 10 car batteries. Charging time for this operation was 8 hr. Ramping control was smooth and caused no trouble. Although the IGBT frequency ripple of 16.6 kHz was easily removed using a passive filter, spike noise remained in the output voltage. This ripple did not cause any trouble in operating a pancake-type inductive superconducting load. (author)
Two wind power prognosis criteria and regulating power costs
DEFF Research Database (Denmark)
Nielsen, Claus S.; Ravn, Hans F.; Schaumburg-Müller, Camilla
2003-01-01
. Basically, the choice is between focusing on predicting the energy content of the wind and focusing on the cost of buying regulating power to compensate for the prognosis errors. It will be shown that it can be expected that the two power curves thus estimated will differ, and that therefore also the hourly......The objective of the present work is to investigate the consequences of the choice of criterion in short-term wind power prognosis. This is done by investigating the consequences of choice of objective function in relation to the estimation of the power curve that is applied in the prognoses...... wind power production predicted will differ. In turn this will influence the operation and economics of the system. The consequences of this are illustrated by application to the integration of wind power in the Danish parts of the Nordpool area, using recent data. Using a regression analysis...
International Nuclear Information System (INIS)
Kitada, Atsuko
2004-01-01
The shutdown of a number of nuclear power stations of the Tokyo Electric Power Company in the summer of 2003 caused a power shortage problem in the Tokyo Metropolitan area. To examine the effects of the power shortage, in September 2003 a survey was conducted in the service areas of the Kansai Electric Power Company (Kansai region) and the Tokyo Electric Power Company (Kanto region). This survey was part of a wider opinion survey begun in 1993 concerning nuclear power generation. The results of the September 2003 survey are as follows: The degree of recognition of the power shortage problem in the Metropolitan area was high, with 40% of respondents in the Kansai region and nearly 70% in the Kanto region understanding that the shortage was caused by the shutdown of several nuclear power station. The overall awareness of nuclear power generation was little affected in both the Kansai and Kanto regions, though the sense of a shortage of the generating capacity had been raised slightly. Once respondents knew about the power shortage problem, they estimated the likelihood of an occurrence of large-scale service interruption to be low, nearly at an even chance, and they had been only slightly worried about it, essentially viewing the problem optimistically. In the Kanto region, where public relations activities for power savings had been actively pursued, the frequency of experiencing exposure to such public relations activities was remarkably higher than in the Kansai region. The relation between exposure to public relations activities for power savings and power savings behavior was analyzed using quantification method II. Analysis results suggest that public relations activities for power savings in the Kanto region had the effect of urging power savings behavior. However, the difference in the rate of putting power savings behavior into practice was small between the Kanto and Kansai regions, indicating that public relation activities for power savings in the Kanto
Power system damping - Structural aspects of controlling active power
Energy Technology Data Exchange (ETDEWEB)
Samuelsson, O.
1997-04-01
Environmental and economical aspects make it difficult to build new power lines and to reinforce existing ones. The continued growth in demand for electric power must therefore to a great extent be met by increased loading of available lines. A consequence is that power system damping is reduced, leading to a risk of poorly damped power oscillations between the generators. This thesis proposes the use of controlled active loads to increase damping of such electro-mechanical oscillations. The focus is on structural aspects of controller interaction and of sensor and actuator placement. On-off control based on machine frequency in a single machine infinite bus system is analysed using energy function analysis and phase plane plots. An on-off controller with estimated machine frequency as input has been implemented. At a field test it damped oscillations of a 0.9 MW hydro power generator by controlling a 20kW load. The linear analysis uses two power system models with three and twenty-three machines respectively. Each damper has active power as output and local bus frequency or machine frequency as input. The power system simulator EUROSTAG is used both for generation of the linearized models and for time simulations. Measures of active power mode controllability and phase angle mode observability are obtained from the eigenvectors of the differential-algebraic models. The geographical variation in the network of these quantities is illustrated using the resemblance to bending modes of flexible mechanical structures. Eigenvalue sensitivities are used to determine suitable damper locations. A spring-mass equivalent to an inter-area mode provides analytical expressions, that together with the concept of impedance matching explain the structural behaviour of the power systems. For large gains this is investigated using root locus plots. 64 refs, 99 figs, 20 tabs
Financing the electric power utilities, especially the nuclear power in Japan
International Nuclear Information System (INIS)
Tajima, T.
1975-04-01
Electric power demands in Japan have shown a remarkable growth at an annual rate of 12% since 1965. Nine electric power companies have invested large amounts of money so far, amounting to over 1 trillion yen every year since 1972. A survey of the electric power supply system and an estimation of the electric power demands in 1980 and in 1985 are given. It is expected that the main portion of electric power in the future will gradually be generated by nuclear plants. Financial features of the electrical power utilities, the credit risk of the electric power utilities, and the raising of funds by electric power utilities are discussed. It is concluded that it will be necessary (1) to expand the capital market, (2) to enable the electric power companies to issue a sufficient amount of bonds, (3) to make the Government financing institutions, such as the Japan Development Bank, provide the electric power companies with larger funds on a long-term and low-interest rate basis, and (4) even to take such drastic steps as subsidizing interest on private loans to the electric power companies. (B.P.)
International Nuclear Information System (INIS)
Mayer, M.
2006-01-01
Whether the People's Republic of China may develop to an economical super-government in future depends on the amount of power and resources of this land. The security of power supply is in an extremely prominent position in the Agenda of the Chinese government. Under this aspect the author of the contribution under consideration reports on the power policy of China. The main aspects of this contribution are: (a) Trends of power consumption, productions and imports of power; (b) Power political targets, measures and instruments of China; (c) Characteristics, national and international impacts of the power policy of China. Due to the economical activities of the chinese oil industry worldwide as well as due to the increasing dependence from imports of petroleum and natural oil, China becomes a global player. Thus, one may expect an intensification of Beijing's economical activities with an increased military component. Nevertheless, the power policy of China is an important factor in the global competition according to fossil resources. In order to understand the future behaviour of China's power policy, one may have to take notice of the strategies relating the power policy and relating to foreign affairs. Furthermore, trends and problematic areas concerning the securitization of the power supply in the national area have to be observed
On grid-connected power electronic systems: power quality improvement application
International Nuclear Information System (INIS)
Etxeberria-Otadui, I.
2003-09-01
The present PhD thesis deals with distribution grid-connected power electronic devices. The main focus has been power quality improvement with power electronic devices. The theoretical aspects and the power quality improvement techniques are presented and discussed. Power electronic devices are then presented, modelled and controlled. Original disturbance identification, power management and current/voltage control methods have been proposed, tested and analysed. A flexible test-bench, composed of a series and a shunt compensator, has been designed and built in order to test the studied control algorithms. These tests have permitted to experimentally evaluate and validate the proposed control algorithms and to make evident several problems that are not always visible on the theory. The conclusions outline the main short and mid term objectives and challenges in the field of power quality improvement devices. (author)
Energy Technology Data Exchange (ETDEWEB)
Wiart, J.; Ghanmi, A.; Picon, O.; Conil, E.; Varsier, N.; Hadjem, A.; Sudret, B.; Magne, I.; Souques, M.; Gaudaire, F.; De Seze, R.; Jawad, O.; Lautru, D.; Dricot, J.M.; Horlin, F.; De Doncker, P.; Drissaoui, A.; Musy, F.; Nicolas, L.; Perrussel, R.; Scorretti, R.; Voyer, D.; Jala, M.; Moulines, E.; Levy-Leduc, C.; Mahfouz, Z.; Gati, A.; Fouad Hanna, V.; Leveque, P.; Arnaud-Cormos, D.; Zhadobov, M.; Jarrige, P.; Gaborit, G.; Kohler, S.; Ticaud, N.; Duvillaret, L.; Guelilia, Z.; Loison, R.; Gillard, R.; Laisne, A.; Favet, D.; Benadhira, R.; Mir, L.; Nadi, M.; Kourtiche, D.; Gazeau, F.; Wilhelm, C.; Delemotte, L.; Breton, M.; Tarek, M.; Marc-Vergnes, J.P.; Yardin, C.; Perrin, A.; Le Drean, Y.; Sauleau, R.; Lambrozo, J.; Selmaoui, B.; Ghosn, R.; Thuroczy, G.; Villegier, A.S.; Loos, N.; Brenet-Dufour, V.; Liabeuf, S.; Bach, V.; Moretti, D.; Lewis, N.; Garenne, A.; Poulletier De Gannes, F.; Haro, E.; Lagroye, I.; Bornat, Y.; Boutaib, Y.; Saighi, S.; Renaud, S.; Veyre, B.; Schuz, J.; Deltour, I.; Van Deventer, E.; Vecchia, P.; Merckel, O.; Bellaouel, A.; Demaret, P.; Donati, P.; Jovanovic, D.; Chauvin, S.; Desreumaux, J.P.; Fouquet, L.; Picard, D.; Massardier-Pilonchery, A.; Hours, M.; Bergeret, A.; Person, C.; Toutain, Y.; Butet, R.; Berrahma, K.; Balderelli, I.; Stelmaszyk, V.; Cretallaz, C.; Lamproglou, I.; Amourette, C.; Diserbo, M.; Fauquette, W.; Martigne, P.; Collin, A.; Lagroye, I.; Ait Aissa, S.; Hurtier, A.; Taxile, M.; Le Montagner, L.; Athane, A.; Duleu, S.; Percherancier, Y.; Geffard, M.; Ruffie, G.; Billaudel, B.; Veyret, B.; Pelletier, A.; Delanaud, S.; Libert, J.P.; Schunck, T.; Bieth, F.; Soubere Mahamoud, Y.; Le Quement, C.; Ferrand, G.; Le Guevel, R.; Carton, P.H.; Luong, M.; Tanvir, S.; Selmaoui, B.; Silva Pires-Antonietti, V.; Sonnet, P.; Pulvin, S.; Kuster, O.; Tetelin, C.
2012-04-15
- Electromagnetic interferences and cardiac implants; 24 - RF effects on central nervous system: sleep, cognition, Electro-encephalography, vascularisation; 25 - Specific effects of an exposure to mobile phone RF waves on the autonomous nervous control of the cutaneous vasomotor tone; 26 - The ERNAM project: exposure of neuronal networks to the GSM-1800 signal; 27 - Mobile phones, power lines and cancer: the epidemiological evidence leading to classification as possible carcinogens; 28 - EMF Risk Assessment and Management: A WHO Perspective; 29 - Evolution of ICNIRP guidelines; 30 - Assessment of RF-linked risks at the Anses: from dialogue management recommendations; 31 - Characterization of mobile phone-absorbing medium interactions for non-invasive dosimetry; 32 - Status of electromagnetic radiation exposures and evaluation of prevention means; 33 - General public exposure to RF in France; 34 - Power emitted by a mobile phone in voice communication: from 2G to 3G VoIP; 35 - Digital dosimetry in HF/VHF range; 36 - Professional exposure of mobile phone maintenance technicians; 37 - Robot-less multi-sensors dosimetry for real time SAR measurement; 38 - High performance SAR meter for the characterization of 3G mobile phones exposure; 39 - RF dosemeters and user's body diffraction; 40 - RF waves and health: summary of 2007-2011 scientific publications; 41 - Behaviour of adult male wistar rats during high power pulsed electromagnetic waves (3 GHz); 42 - Wi-Fi effects: results of IMS Lab studies; 43 - Effects on the energy fluxes of young rats homeostasis during a chronic exposure to RF fields; 44 - Biological effects of very-high power and ultra-large range radiations: ISL's research programme; 45 - Study of cell-scale biological effects of pulsed RF fields used in high-resolution NMR-imaging; 46 - Effects of cell phone radiofrequency exposure on the human cytochrome P450 reductase; 47 - CEA's 'electromagnetic safety' working group; 48 - In situ evaluation of
Scientific days on electromagnetic fields: from dosimetry to human health - Conference proceedings
International Nuclear Information System (INIS)
Wiart, J.; Ghanmi, A.; Picon, O.; Conil, E.; Varsier, N.; Hadjem, A.; Sudret, B.; Magne, I.; Souques, M.; Gaudaire, F.; De Seze, R.; Jawad, O.; Lautru, D.; Dricot, J.M.; Horlin, F.; De Doncker, P.; Drissaoui, A.; Musy, F.; Nicolas, L.; Perrussel, R.; Scorretti, R.; Voyer, D.; Jala, M.; Moulines, E.; Levy-Leduc, C.; Mahfouz, Z.; Gati, A.; Fouad Hanna, V.; Leveque, P.; Arnaud-Cormos, D.; Zhadobov, M.; Jarrige, P.; Gaborit, G.; Kohler, S.; Ticaud, N.; Duvillaret, L.; Guelilia, Z.; Loison, R.; Gillard, R.; Laisne, A.; Favet, D.; Benadhira, R.; Mir, L.; Nadi, M.; Kourtiche, D.; Gazeau, F.; Wilhelm, C.; Delemotte, L.; Breton, M.; Tarek, M.; Marc-Vergnes, J.P.; Yardin, C.; Perrin, A.; Le Drean, Y.; Sauleau, R.; Lambrozo, J.; Selmaoui, B.; Ghosn, R.; Thuroczy, G.; Villegier, A.S.; Loos, N.; Brenet-Dufour, V.; Liabeuf, S.; Bach, V.; Moretti, D.; Lewis, N.; Garenne, A.; Poulletier De Gannes, F.; Haro, E.; Lagroye, I.; Bornat, Y.; Boutaib, Y.; Saighi, S.; Renaud, S.; Veyre, B.; Schuz, J.; Deltour, I.; Van Deventer, E.; Vecchia, P.; Merckel, O.; Bellaouel, A.; Demaret, P.; Donati, P.; Jovanovic, D.; Chauvin, S.; Desreumaux, J.P.; Fouquet, L.; Picard, D.; Massardier-Pilonchery, A.; Hours, M.; Bergeret, A.; Person, C.; Toutain, Y.; Butet, R.; Berrahma, K.; Balderelli, I.; Stelmaszyk, V.; Cretallaz, C.; Lamproglou, I.; Amourette, C.; Diserbo, M.; Fauquette, W.; Martigne, P.; Collin, A.; Lagroye, I.; Ait Aissa, S.; Hurtier, A.; Taxile, M.; Le Montagner, L.; Athane, A.; Duleu, S.; Percherancier, Y.; Geffard, M.; Ruffie, G.; Billaudel, B.; Veyret, B.; Pelletier, A.; Delanaud, S.; Libert, J.P.; Schunck, T.; Bieth, F.; Soubere Mahamoud, Y.; Le Quement, C.; Ferrand, G.; Le Guevel, R.; Carton, P.H.; Luong, M.; Tanvir, S.; Selmaoui, B.; Silva Pires-Antonietti, V.; Sonnet, P.; Pulvin, S.; Kuster, O.; Tetelin, C.
2012-04-01
- Electromagnetic interferences and cardiac implants; 24 - RF effects on central nervous system: sleep, cognition, Electro-encephalography, vascularisation; 25 - Specific effects of an exposure to mobile phone RF waves on the autonomous nervous control of the cutaneous vasomotor tone; 26 - The ERNAM project: exposure of neuronal networks to the GSM-1800 signal; 27 - Mobile phones, power lines and cancer: the epidemiological evidence leading to classification as possible carcinogens; 28 - EMF Risk Assessment and Management: A WHO Perspective; 29 - Evolution of ICNIRP guidelines; 30 - Assessment of RF-linked risks at the Anses: from dialogue management recommendations; 31 - Characterization of mobile phone-absorbing medium interactions for non-invasive dosimetry; 32 - Status of electromagnetic radiation exposures and evaluation of prevention means; 33 - General public exposure to RF in France; 34 - Power emitted by a mobile phone in voice communication: from 2G to 3G VoIP; 35 - Digital dosimetry in HF/VHF range; 36 - Professional exposure of mobile phone maintenance technicians; 37 - Robot-less multi-sensors dosimetry for real time SAR measurement; 38 - High performance SAR meter for the characterization of 3G mobile phones exposure; 39 - RF dosemeters and user's body diffraction; 40 - RF waves and health: summary of 2007-2011 scientific publications; 41 - Behaviour of adult male wistar rats during high power pulsed electromagnetic waves (3 GHz); 42 - Wi-Fi effects: results of IMS Lab studies; 43 - Effects on the energy fluxes of young rats homeostasis during a chronic exposure to RF fields; 44 - Biological effects of very-high power and ultra-large range radiations: ISL's research programme; 45 - Study of cell-scale biological effects of pulsed RF fields used in high-resolution NMR-imaging; 46 - Effects of cell phone radiofrequency exposure on the human cytochrome P450 reductase; 47 - CEA's 'electromagnetic safety' working group; 48 - In situ evaluation of electromagnetic fields
Power quality enhancement of renewable energy source power network using SMES system
International Nuclear Information System (INIS)
Seo, H.R.; Kim, A.R.; Park, M.; Yu, I.K.
2011-01-01
Power quality enhancement of a renewable energy source power network is performed by a real-toroidal-type SMES coil. SMES unit charges and discharges the HTS coil to mitigate the fluctuation of PV system output power. The grid connected PV and SMES system has been modeled and simulated using power-hard-in-the-loop simulation. The PHILS results demonstrated the effectiveness of the SMES system for enhancing power quality. This paper deals with power quality enhancement of renewable energy source power network using SMES system and describes the operation characteristics of HTS SMES system using real-toroidal-type SMES coil for smoothening the fluctuation of large-scale renewable energy source such as photovoltaic (PV) power generation system. It generates maximum power of PV array under various weather conditions. SMES unit charges and discharges the HTS coil to mitigate the fluctuation of PV system output power. The SMES unit is controlled according to the PV array output and the utility power quality conditions. The grid connected PV and SMES system has been modeled and simulated using power-hard-in-the-loop simulation (PHILS). The PHILS results demonstrated the effectiveness of the SMES system for enhancing power quality in power network including large-scale renewable energy source, especially PV power generation system.
Omerzel, Aleš
2014-01-01
The power domination problem is an optimization problem that has emerged together with the development of the power networks. It is important to control the voltage and current in all the nodes and links in a power network. Measuring devices are expensive, which is why there is a tendency to place a minimum number of devices in a power network so that the network remains fully supervised. The k-power domination is a generalization of the power domination. The thesis represents the rules of th...
Power Quality Issues on Wind Power Installations in Denmark
DEFF Research Database (Denmark)
Sørensen, Poul Ejnar; Cutululis, Nicolaos Antonio; Lund, Torsten
2007-01-01
offshore wind farms connected at transmission level. In this perspective, the power quality issues are divided into local issues particularly related to the voltage quality in the distribution systems and global issues related to the power system control and stability. Power quality characteristics of wind...
The electric power engineering handbook electric power generation, transmission, and distribution
Grigsby, Leonard L
2012-01-01
Featuring contributions from worldwide leaders in the field, the carefully crafted Electric Power Generation, Transmission, and Distribution, Third Edition (part of the five-volume set, The Electric Power Engineering Handbook) provides convenient access to detailed information on a diverse array of power engineering topics. Updates to nearly every chapter keep this book at the forefront of developments in modern power systems, reflecting international standards, practices, and technologies. Topics covered include: * Electric Power Generation: Nonconventional Methods * Electric Power Generation
Damping of Low Frequency Power System Oscillations with Wind Power Plants
DEFF Research Database (Denmark)
Adamczyk, Andrzej Grzegorz
of wind power plants on power system low frequency oscillations and identify methods and limitations for potential contribution to the damping of such oscillations. Consequently, the first part of the studies focuses on how the increased penetration of wind power into power systems affects their natural...... oscillatory performance. To do so, at first a generic test grid displaying a complex inter-area oscillation pattern is introduced. After the evaluation of the test grid oscillatory profile for various wind power penetration scenarios, it is concluded that full-converter based wind power plant dynamics do......-synchronous power source. The main body of the work is devoted to the damping control design for wind power plants with focus on the impact of such control on the plant operation. It can be expected that the referred impact is directly proportional to the control effort, which for power processing devices should...
Green Power Partnership 100 Green Power Users
EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. Partners on this list use green power to meet 100 of their U.S. organization-wide electricity use.
A high-power versatile wireless power transfer for biomedical implants.
Jiang, Hao; Zhang, Jun Min; Liou, Shy Shenq; Fechter, Richard; Hirose, Shinjiro; Harrison, Michael; Roy, Shuvo
2010-01-01
Implantable biomedical actuators are highly desired in modern medicine. However, how to power up these biomedical implants remains a challenge since most of them need more than several hundreds mW of power. The air-core based radio-frequency transformer (two face-to-face inductive coils) has been the only non-toxic and non-invasive power source for implants for the last three decades [1]. For various technical constraints, the maximum delivered power is limited by this approach. The highest delivered power reported is 275 mW over 1 cm distance [2]. Also, the delivered power is highly vulnerable to the coils' geometrical arrangement and the electrical property of the medium around them. In this paper, a novel rotating-magnets based wireless power transfer that can deliver ∼10 W over 1 cm is demonstrated. The delivered power is significantly higher than the existing start-of-art. Further, the new method is versatile since there is no need to have the impedance matching networks that are highly susceptible to the operating frequency, the coil arrangement and the environment.
Space power plants and power-consuming industrial systems
International Nuclear Information System (INIS)
Latyshev, L.; Semashko, N.
1996-01-01
An opportunity to create the space power production on the basis of solar, nuclear and fusion energies is analyzed. The priority of solar power production as the most accessible and feasible in comparison with others is emphasized. However, later on, it probably will play an auxiliary role. The possibilities of fusion power production, as a basic one in future, are also considered. It is necessary to create reactors using the fueling cycle with helium-3 (instead of tritium and deuterium, later on). The reaction products--charged particles, mainly--allow one to organize the system of direct fusion energy conversion into electricity. The produced energy is expected not to be transmitted to Earth, but an industry in space is expected to be produced on its basis. The industrial (power and science-consuming) objects located on a whole number of space apparatus will form a single complex with its own basic power plant. The power transmission within the complex will be realized with high power density fluxes of microwave radiation to short distances with their receivers at the objects. The necessary correction of the apparatus positions in the complex will be done with ion and plasma thrusters. The materials present on the Moon, asteroids and on other planets can serve as raw materials for industrial objects. Such an approach will help to improve the ecological state on Earth, to eliminate the necessity in the fast energy consumption growth and to reduce the hazard of global thermal crisis
Methods for Estimation of Market Power in Electric Power Industry
Turcik, M.; Oleinikova, I.; Junghans, G.; Kolcun, M.
2012-01-01
The article is related to a topical issue of the newly-arisen market power phenomenon in the electric power industry. The authors point out to the importance of effective instruments and methods for credible estimation of the market power on liberalized electricity market as well as the forms and consequences of market power abuse. The fundamental principles and methods of the market power estimation are given along with the most common relevant indicators. Furthermore, in the work a proposal for determination of the relevant market place taking into account the specific features of power system and a theoretical example of estimating the residual supply index (RSI) in the electricity market are given.
Handbook of power systems engineering with power electronics applications
Hase, Yoshihide
2012-01-01
Formerly known as Handbook of Power System Engineering, this second edition provides rigorous revisions to the original treatment of systems analysis together with a substantial new four-chapter section on power electronics applications. Encompassing a whole range of equipment, phenomena, and analytical approaches, this handbook offers a complete overview of power systems and their power electronics applications, and presents a thorough examination of the fundamental principles, combining theories and technologies that are usually treated in separate specialised fields, in a single u
High average power solid state laser power conditioning system
International Nuclear Information System (INIS)
Steinkraus, R.F.
1987-01-01
The power conditioning system for the High Average Power Laser program at Lawrence Livermore National Laboratory (LLNL) is described. The system has been operational for two years. It is high voltage, high power, fault protected, and solid state. The power conditioning system drives flashlamps that pump solid state lasers. Flashlamps are driven by silicon control rectifier (SCR) switched, resonant charged, (LC) discharge pulse forming networks (PFNs). The system uses fiber optics for control and diagnostics. Energy and thermal diagnostics are monitored by computers
Fehr, Ralph
2016-01-01
In this fully updated version of Industrial Power Distribution, the author addresses key areas of electric power distribution from an end-user perspective for both electrical engineers, as well as students who are training for a career in the electrical power engineering field. Industrial Power Distribution, Second Edition, begins by describing how industrial facilities are supplied from utility sources, which is supported with background information on the components of AC power, voltage drop calculations, and the sizing of conductors and transformers. Important concepts and discussions are featured throughout the book including those for sequence networks, ladder logic, motor application, fault calculations, and transformer connections. The book concludes with an introduction to power quality, how it affects industrial power systems, and an expansion of the concept of power factor, including a distortion term made necessary by the existence of harmonic.
Power control and management of the grid containing largescale wind power systems
Aula, Fadhil Toufick
The ever increasing demand for electricity has driven many countries toward the installation of new generation facilities. However, concerns such as environmental pollution and global warming issues, clean energy sources, high costs associated with installation of new conventional power plants, and fossil fuels depletion have created many interests in finding alternatives to conventional fossil fuels for generating electricity. Wind energy is one of the most rapidly growing renewable power sources and wind power generations have been increasingly demanded as an alternative to the conventional fossil fuels. However, wind power fluctuates due to variation of wind speed. Therefore, large-scale integration of wind energy conversion systems is a threat to the stability and reliability of utility grids containing these systems. They disturb the balance between power generation and consumption, affect the quality of the electricity, and complicate load sharing and load distribution managing and planning. Overall, wind power systems do not help in providing any services such as operating and regulating reserves to the power grid. In order to resolve these issues, research has been conducted in utilizing weather forecasting data to improve the performance of the wind power system, reduce the influence of the fluctuations, and plan power management of the grid containing large-scale wind power systems which consist of doubly-fed induction generator based energy conversion system. The aims of this research, my dissertation, are to provide new methods for: smoothing the output power of the wind power systems and reducing the influence of their fluctuations, power managing and planning of a grid containing these systems and other conventional power plants, and providing a new structure of implementing of latest microprocessor technology for controlling and managing the operation of the wind power system. In this research, in order to reduce and smooth the fluctuations, two
DEFF Research Database (Denmark)
Yang, Dongsheng; Wang, Xiongfei; Liu, Fangcheng
2017-01-01
The Photovoltaic (PV) power plants are usually deployed in remote areas with the high solar irradiance, and their power transfer capabilities can be greatly limited by the large impedance of long-distance transmission lines. This paper investigates first the power transfer limit of the PV power p...
Weedy, B M; Jenkins, N; Ekanayake, J B; Strbac, G
2012-01-01
The definitive textbook for Power Systems students, providing a grounding in essential power system theory while also focusing on practical power engineering applications. Electric Power Systems has been an essential book in power systems engineering for over thirty years. Bringing the content firmly up-to-date whilst still retaining the flavour of Weedy's extremely popular original, this Fifth Edition has been revised by experts Nick Jenkins, Janaka Ekanayake and Goran Strbac. This wide-ranging text still covers all of the fundamental power systems subjects but is now e
Estimation of power system variability due to wind power
Papaefthymiou, G.; Verboomen, J.; Van der Sluis, L.
2007-01-01
The incorporation of wind power generation to the power system leads to an increase in the variability of the system power flows. The assessment of this variability is necessary for the planning of the necessary system reinforcements. For the assessment of this variability, the uncertainty in the
African Journals Online (AJOL)
Administrator
propose research questions to generate evidence to mitigate future epidemics. Methods: A case definition for a VHF was developed. A frequency distribution of symptoms of confirmed and probable cases was done. Descriptive analyses of reported cases using simple percentages, percent distributions and computation of.
Dihydroazulene-buckminsterfullerene conjugates
DEFF Research Database (Denmark)
Santella, Marco; Mazzanti, Virginia; Jevric, Martyn
2012-01-01
The dihydroazulene (DHA)/vinylheptafulvene (VHF) photo/thermoswitch has recently attracted interest as a molecular switch for molecular electronics. In this field, Buckminsterfullerene, C(60), has been shown to be a useful anchoring group for adhering a molecular wire to an electrode. Here we hav...
78 FR 47047 - Proposed Policy for Discontinuance of Certain Instrument Approach Procedures
2013-08-02
... the cancellation of certain Non-directional Beacon (NDB) and Very High Frequency (VHF) Omnidirectional... approach procedures. The FAA proposes specific criteria to guide the identification and selection of... selection of potential NDB and VOR procedures for cancellation. Once the criteria are established and the...
Power generation using photovoltaic induction in an isolated power network
International Nuclear Information System (INIS)
Kalantar, M.; Jiang, J.
2001-01-01
Owing to increased emphasis on renewable resources, the development of suitable isolated power generators driven by energy sources, the development of suitable isolated power generators driven by energy sources such as photovoltaic, wind, small hydroelectric, biogas and etc. has recently assumed greater significance. A single phase capacitor self excited induction generator has emerged as a suitable candidate of isolated power sources. This paper presents performance analysis of a single phase self-excited induction generator driven by photovoltaic (P V) system for low power isolated stand-alone applications. A single phase induction machine can work as a self-excited induction generator when its rotor is driven at suitable speed by an photovoltaic powered do motor. Its excitation is provided by connecting a single phase capacitor bank at a stator terminals. Either to augment grid power or to get uninterrupted power during grid failure stand-alone low capacity ac generators are used. These are driven by photovoltaic, wind power or I C engines using kerosene, diesel, petrol or biogas as fuel. Self-excitation with capacitors at the stator terminals of the stator terminals of the induction machines is well demonstrated experimentally on a P V powered dc motor-induction machine set. The parameters and the excitation requirements of the induction machine run in self-excited induction generator mode are determined. The effects of variations in prime mover speed,terminal capacitance and load power factor on the machine terminal voltage are studied
Reusing balanced power flow object components for developing harmonic power flow
Energy Technology Data Exchange (ETDEWEB)
Nadarajah, S. [Peninsular Malaysia Electric Utility Co., Kuala Lumpur (Malaysia). Tenaga Nasional Berhad; Nor, K.M.; Abdel-Akher, M. [Malaysia Univ., Kuala Lumpur (Malaysia). Dept. of Electrical Engineering
2005-07-01
Harmonic power flows are used to examine the effects of nonlinear loads on power systems. In this paper, component technology was re-used for the development of a harmonic power flow. The object-oriented power system model (OO-PSM) was developed separately from a solution algorithm. Nodes, lines, and transformers were modelled as entity objects by classes. Power flow solution algorithms were modelled as control objects and encapsulated inside independent software components within the power system component software architecture (PS-COM). Both the OO-PSM and the PS-COM of the balanced power flow were re-used for developing the proposed harmonic power flow. A no-interaction hypothesis was used to consider both fundamental voltages and nonlinear device data dependence. A direct solution voltage node method was also used. The accuracy of the method was demonstrated using IEEE 14 bus and 30 bus test systems. It was concluded that component technology can be used to develop harmonic power flow programs. 7 refs., 2 tabs., 9 figs.
Software-Based Wireless Power Transfer Platform for Various Power Control Experiments
Directory of Open Access Journals (Sweden)
Sun-Han Hwang
2015-07-01
Full Text Available In this paper, we present the design and evaluation of a software-based wireless power transfer platform that enables the development of a prototype involving various open- and closed-loop power control functions. Our platform is based on a loosely coupled planar wireless power transfer circuit that uses a class-E power amplifier. In conjunction with this circuit, we implement flexible control functions using a National Instruments Data Acquisition (NI DAQ board and algorithms in the MATLAB/Simulink. To verify the effectiveness of our platform, we conduct two types of power-control experiments: a no-load or metal detection using open-loop power control, and an output voltage regulation for different receiver positions using closed-loop power control. The use of the MATLAB/Simulink software as a part of the planar wireless power transfer platform for power control experiments is shown to serve as a useful and inexpensive alternative to conventional hardware-based platforms.
Synthesizing modeling of power generation and power limits in energy systems
International Nuclear Information System (INIS)
Sieniutycz, Stanislaw
2015-01-01
Applying the common mathematical procedure of thermodynamic optimization the paper offers a synthesizing or generalizing modeling of power production in various energy generators, such as thermal, solar and electrochemical engines (fuel cells). Static and dynamical power systems are investigated. Dynamical models take into account the gradual downgrading of a resource, caused by power delivery. Analytical modeling includes conversion efficiencies expressed in terms of driving fluxes. Products of efficiencies and driving fluxes determine the power yield and power maxima. While optimization of static systems requires using of differential calculus and Lagrange multipliers, dynamic optimization involves variational calculus and dynamic programming. In reacting mixtures balances of mass and energy serve to derive power yield in terms of an active part of chemical affinity. Power maximization approach is also applied to fuel cells treated as flow engines driven by heat flux and fluxes of chemical reagents. The results of power maxima provide limiting indicators for thermal, solar and SOFC generators. They are more exact than classical reversible limits of energy transformation. - Highlights: • Systematic evaluation of power limits by optimization. • Common thermodynamic methodology for engine systems. • Original, in-depth study of power maxima. • Inclusion of fuel cells to a class of thermodynamic power systems
Power Constrained High-Level Synthesis of Battery Powered Digital Systems
DEFF Research Database (Denmark)
Nielsen, Sune Fallgaard; Madsen, Jan
2003-01-01
We present a high-level synthesis algorithm solving the combined scheduling, allocation and binding problem minimizing area under both latency and maximum power per clock-cycle constraints. Our approach eliminates the large power spikes, resulting in an increased battery lifetime, a property...... of utmost importance for battery powered embedded systems. Our approach extends the partial-clique partitioning algorithm by introducing power awareness through a heuristic algorithm which bounds the design space to those of power feasible schedules. We have applied our algorithm on a set of dataflow graphs...
Satrio, Reza Indra; Subiyanto
2018-03-01
The effect of electric loads growth emerged direct impact in power systems distribution. Drop voltage and power losses one of the important things in power systems distribution. This paper presents modelling approach used to restructrure electrical network configuration, reduce drop voltage, reduce power losses and add new distribution transformer to enhance reliability of power systems distribution. Restructrure electrical network was aimed to analyse and investigate electric loads of a distribution transformer. Measurement of real voltage and real current were finished two times for each consumer, that were morning period and night period or when peak load. Design and simulation were conduct by using ETAP Power Station Software. Based on result of simulation and real measurement precentage of drop voltage and total power losses were mismatch with SPLN (Standard PLN) 72:1987. After added a new distribution transformer and restructrured electricity network configuration, the result of simulation could reduce drop voltage from 1.3 % - 31.3 % to 8.1 % - 9.6 % and power losses from 646.7 watt to 233.29 watt. Result showed, restructrure electricity network configuration and added new distribution transformer can be applied as an effective method to reduce drop voltage and reduce power losses.
International Nuclear Information System (INIS)
Nealey, S.
1990-01-01
The objective of this study is to examine factors and prospects for a resumption in growth of nuclear power in the United States over the next decade. The focus of analysis on the likelihood that current efforts in the United States to develop improved and safer nuclear power reactors will provide a sound technical basis for improved acceptance of nuclear power, and contribute to a social/political climate more conducive to a resumption of nuclear power growth. The acceptability of nuclear power and advanced reactors to five social/political sectors in the U.S. is examined. Three sectors highly relevant to the prospects for a restart of nuclear power plant construction are the financial sector involved in financing nuclear power plant construction, the federal nuclear regulatory sector, and the national political sector. For this analysis, the general public are divided into two groups: those who are knowledgeable about and involved in nuclear power issues, the involved public, and the much larger body of the general public that is relatively uninvolved in the controversy over nuclear power
Lifescience Database Archive (English)
Full Text Available MTYF9_FA... 33 7.5 CP000568_3082( CP000568 |pid:none) Clostridium thermocellum ATCC 2... 33 9.8 AY698035_1(... AY698035 |pid:none) Desmognathus marmoratus isolate 69... 33 9.8 protein update 2009. 3. 3 PSORT psg: 0.69
Lifescience Database Archive (English)
Full Text Available ce. 72 3e-12 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower... Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 3e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle
VHF spectrum monitoring using Meraka cognitive radio platform
CSIR Research Space (South Africa)
Aderonmu, AI
2012-11-01
Full Text Available discuss the Meraka Cognitive Radio Platform (MCRP) developed using the second version of the Universal Serial Radio Peripheral (USRP2) hardware and the GNU Radio software. We also discussed how the spectrum monitoring system is being implemented...
Lifescience Database Archive (English)
Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi
Lifescience Database Archive (English)
Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid
Lifescience Database Archive (English)
Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic
Lifescience Database Archive (English)
Full Text Available d sequence lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqam gdwqrklsdy*hstnafgfwvipnniadrgfifdks...siqagkkkrddianinrkasa Translated Amino Acid sequence (All Frames) Frame A: lvdpasshmlvskikpcmskykflydetadgsl
Lifescience Database Archive (English)
Full Text Available 03667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP1...nsertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434.1 Forward stran...d read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 CR023...465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 BX990136 |BX990136.1 Forwar
Indian Academy of Sciences (India)
They cover a wide spectrum of areas from power supplies to power system ... Ramanarayanan describe the modelling and design of a family of soft transition ... of power when the drive is operating in the braking mode and fast dynamic response. ... time models are extremely important, as they can be included in real time ...
Review of Power System Stability with High Wind Power Penetration
DEFF Research Database (Denmark)
Hu, Rui; Hu, Weihao; Chen, Zhe
2015-01-01
analyzing methods and stability improvement approaches. With increasing wind power penetration, system balancing and the reduced inertia may cause a big threaten for stable operation of power systems. To mitigate or eliminate the wind impacts for high wind penetration systems, although the practical......This paper presents an overview of researches on power system stability with high wind power penetration including analyzing methods and improvement approaches. Power system stability issues can be classified diversely according to different considerations. Each classified issue has special...... and reliable choices currently are the strong outside connections or sufficient reserve capacity constructions, many novel theories and approaches are invented to investigate the stability issues, looking forward to an extra-high penetration or totally renewable resource based power systems. These analyzing...
Directory of Open Access Journals (Sweden)
Rachid DEHINI
2010-12-01
Full Text Available In this paper, the main aim is to confront the performance of shunt active power filter (SAPF and the shunt hybrid active power filter (SHAPF to achieve flexibility and reliability of the filter devices. Both of the two devices used the classical proportional-integral controller for pulse generation to trigger the inventers MOSFETs. In the adopted hybrid active filter there is a passive power filter with high power rating to filter the low order harmonies and one active filter with low power rating to filter the other high order harmonies. In order to investigate the effectiveness of (SHAPF, the studies have been accomplished using simulation with the MATLAB-SIMULINK. The results show That (SHAPF is more effective than (SAPF, and has lower cost.