WorldWideScience

Sample records for vhf radiotelephone power

  1. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  2. 47 CFR 22.727 - Power limits for conventional rural radiotelephone transmitters.

    Science.gov (United States)

    2010-10-01

    ... radiotelephone transmitters. 22.727 Section 22.727 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... this section. (a) Maximum ERP. The effective radiated power (ERP) of central office and rural... circumstances. Frequency range (MHz) Maximum ERP (watts) 152-153 1400 157-159 150 454-455 3500 459-460 150 (b...

  3. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  4. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  5. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  6. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  7. 46 CFR 169.669 - Radiotelephone equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Radiotelephone equipment. 169.669 Section 169.669 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS... of Less Than 100 Gross Tons § 169.669 Radiotelephone equipment. A separate circuit from the...

  8. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  9. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  10. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  11. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  12. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  13. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  14. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  15. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  16. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  17. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  18. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  19. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  20. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  1. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  2. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  3. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  4. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  5. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  6. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  7. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  8. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  9. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  10. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  11. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  12. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  13. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  14. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  15. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  16. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  17. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  18. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  19. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  20. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  1. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  2. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  3. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  4. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  5. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  6. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  7. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  8. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  9. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  10. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  11. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  12. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  13. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  14. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  15. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  16. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  17. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  18. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  19. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  20. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  1. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  2. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  3. 47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...

  4. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  5. 47 CFR 22.719 - Additional channel policy for rural radiotelephone stations.

    Science.gov (United States)

    2010-10-01

    ... applied for or been granted an authorization for other rural radiotelephone channel pairs in the same area... grade of service (blocking probability), and the applicant demonstrates that there will still be...

  6. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  7. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  8. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  9. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  10. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  11. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  12. 47 CFR 80.1015 - Power supply.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Power supply. 80.1015 Section 80.1015... MARITIME SERVICES Radiotelephone Installations Required by the Bridge-to-Bridge Act § 80.1015 Power supply. (a) There must be readily available for use under normal load conditions, a power supply sufficient...

  13. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  14. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  15. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  16. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  17. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  18. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  19. 47 CFR 22.709 - Rural radiotelephone service application requirements.

    Science.gov (United States)

    2010-10-01

    ... call signs, if any, of any fixed points of communication. (c) No landline facilities. Each application... authority to operate a new interoffice station or to add transmitters or points of communications to an... center frequency of each channel requested, the maximum effective radiated power, the effective radiated...

  20. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  1. 47 CFR 22.1013 - Effective radiated power limitations.

    Science.gov (United States)

    2010-10-01

    ... Section 22.1013 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES.... The effective radiated power (ERP) of transmitters in the Offshore Radiotelephone Service must not exceed the limits in this section. (a) Maximum power. The ERP of transmitters in this service must not...

  2. 47 CFR 22.913 - Effective radiated power limits.

    Science.gov (United States)

    2010-10-01

    ... radiated power (ERP) of transmitters in the Cellular Radiotelephone Service must not exceed the limits in this section. (a) Maximum ERP. In general, the effective radiated power (ERP) of base transmitters and... areas, as those areas are defined in § 22.949, the ERP of base transmitters and cellular repeaters of...

  3. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  4. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  5. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  6. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  7. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  8. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  9. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  10. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  11. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  12. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  13. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  14. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  15. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  16. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  17. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  18. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  19. 47 CFR 74.735 - Power limitations.

    Science.gov (United States)

    2010-10-01

    ... analog low power TV, TV translator, or TV booster station shall not exceed: (1) 3 kW for VHF channels 2-13; and (2) 150 kW for UHF channels 14-69. (b) The maximum ERP of a digital low power TV, TV..., AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES Low Power TV, TV Translator, and TV...

  20. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  1. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  2. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  3. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  4. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  5. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  6. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  7. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  8. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  9. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  10. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  11. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  12. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  13. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  14. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  15. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  16. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  17. 77 FR 50493 - Sam Rayburn Dam Project Power Rate

    Science.gov (United States)

    2012-08-21

    .... Procedures for Public Participation in Power and Transmission Rate Adjustments and Extensions of the Power... transmission facilities, which consist of 1,380 miles of high-voltage transmission lines, 25 substations, and 46 microwave and VHF radio sites. Costs associated ] with the Sam Rayburn and Robert D. Willis Dams...

  18. Power

    OpenAIRE

    Bowles, Samuel; Gintis, Herbert

    2007-01-01

    We consider the exercise of power in competitive markets for goods, labour and credit. We offer a definition of power and show that if contracts are incomplete it may be exercised either in Pareto-improving ways or to the disadvantage of those without power. Contrasting conceptions of power including bargaining power, market power, and consumer sovereignty are considered. Because the exercise of power may alter prices and other aspects of exchanges, abstracting from power may miss essential a...

  19. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  20. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  1. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  2. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  3. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  4. US Mains Stacked Very High Frequency Self-oscillating Resonant Power Converter with Unified Rectifier

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Madsen, Mickey Pierre; Mønster, Jakob Døllner

    2016-01-01

    This paper describes a Very High Frequency (VHF) converter made with three Class-E inverters and a single ClassDE rectifier. The converter is designed for the US mains (120 V, 60 Hz) and can deliver 9 W to a 60 V LED. The converter has a switching frequency of 37 MHz and achieves an efficiency...... of 89.4%. With VHF converters the power density can be improved and the converter described in this paper has a power density of 2.14 W/cm3. The power factor (PF) requrements of mains connected equepment is fulfilled with a power factor of 0.96....

  5. Intrinsic Nonlinearities and Layout Impacts of 100 V Integrated Power MOSFETs in Partial SOI Process

    DEFF Research Database (Denmark)

    Fan, Lin; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Parasitic capacitances of power semiconductors are a part of the key design parameters of state-of-the-art very high frequency (VHF) power supplies. In this poster, four 100 V integrated power MOSFETs with different layout structures are designed, implemented, and analyzed in a 0.18 ȝm partial...

  6. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  7. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  8. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  9. A Low Power RC-Coupled VHF Amplifier Designed for Fabrication by Hybrid Microcircuit Techniques.

    Science.gov (United States)

    RADIOFREQUENCY AMPLIFIERS, HYBRID CIRCUITS, MICROMINIATURIZATION , VERY HIGH FREQUENCY, MODULES(ELECTRONICS), TRANSISTOR AMPLIFIERS, RADIO RECEIVERS, COMMUNICATION EQUIPMENT, SATELLITE COMMUNICATIONS.

  10. VHF radar observations of gravity waves at a low latitude

    Directory of Open Access Journals (Sweden)

    G. Dutta

    1999-08-01

    Full Text Available Wind observations made at Gadanki (13.5°N by using Indian MST Radar for few days in September, October, December 1995 and January, 1996 have been analyzed to study gravity wave activity in the troposphere and lower stratosphere. Horizontal wind variances have been computed for gravity waves of period (2-6 h from the power spectral density (PSD spectrum. Exponential curves of the form eZ/H have been fitted by least squares technique to these variance values to obtain height variations of the irregular winds upto the height of about 15 km, where Z is the height in kilometers. The value of H, the scale height, as determined from curve fitting is found to be less than the theoretical value of scale height of neutral atmosphere in this region, implying that the waves are gaining energy during their passage in the troposphere. In other words, it indicates that the sources of gravity waves are present in the troposphere. The energy densities of gravity wave fluctuations have been computed. Polynomial fits to the observed values show that wave energy density increases in the troposphere, its source region, and then decreases in the lower stratosphere.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; waves and tides

  11. Power

    DEFF Research Database (Denmark)

    Elmholdt, Claus Westergård; Fogsgaard, Morten

    2016-01-01

    In this chapter, we will explore the dynamics of power in processes of creativity, and show its paradoxical nature as both a bridge and a barrier to creativity in organisations. Recent social psychological experimental research (Slighte, de Dreu & Nijstad, 2011) on the relation between power...... and creativity suggests that when managers give people the opportunity to gain power and explicate that there is reason to be more creative, people will show a boost in creative behaviour. Moreover, this process works best in unstable power hierarchies, which implies that power is treated as a negotiable...... and floating source for empowering people in the organisation. We will explore and discuss here the potentials, challenges and pitfalls of power in relation to creativity in the life of organisations today. The aim is to demonstrate that power struggles may be utilised as constructive sources of creativity...

  12. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  13. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  14. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  15. Power

    OpenAIRE

    Hafford-Letchfield, Trish

    2015-01-01

    This chapter looks at the concept of power in social work by focusing on what this means as a ‘professional’ and theorizes competing discourses of empowerment in social work and its key concepts, drawing in particular on the explanatory powers of critical theorist Michel Foucault (1991). The chapter problematizes the concept of power by explicitly drawing on both users’ and carers’ accounts from the literature to demonstrate different external and internal influences on the root causes of dis...

  16. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  18. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  19. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  20. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  1. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  2. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  3. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  4. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  5. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  6. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  7. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  8. Very High Frequency Galvanic Isolated Offline Power Supply

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf

    inverters with a single combined rectifier. The converter designed to deliver 9 W to a 60 V LED load and is achieving an efficiency of 89.4% and a power density of 2.14 W3 . The development of this converter proof that offline VHF converter can be implemented with high efficiencies even for low power applications...... converters. During this Ph.D. thesis, different areas of an offline VHF converters are described, dur-ing the project different areas have been investigated such as, gate drive, synchronous rectifiers, PCB transformers, control of a resonant converter, galvanic isolation, EMC performance, power factor......During the last decades many researchers have turned their attention to raising the operation frequency of power converters to the very high frequency (VHF) range going from 30 MHz to 300 MHz. Increasing the operating frequency of a power converter leads to smaller energy storing components...

  9. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  10. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  11. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  12. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  13. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  14. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  15. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  16. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  17. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  18. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  19. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  20. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  1. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  2. Embedded Solenoid Transformer for Power Conversion

    DEFF Research Database (Denmark)

    2015-01-01

    A resonant power converter for operation in the radio frequency range, preferably in the VHF, comprises at least one PCB-embedded transformer. The transformer is configured for radio frequency operation and comprises a printed circuit board defining a horizontal plane, the printed circuit board...... comprising at least two horizontal conductive layers separated by an isolating layer, a first embedded solenoid forming a primary winding of the transformer and a second embedded solenoid being arranged parallel to the first solenoid and forming a secondary winding of the transformer, wherein the first...

  3. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  4. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  5. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  6. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  7. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  8. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  9. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  10. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  11. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  12. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  13. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  14. Low-cost detection of RC-IED activation signals in VHF band

    Science.gov (United States)

    Camargo Suarez, Victor Hugo; Marulanda B., Jose Ignacio

    2014-05-01

    The proliferation of Radio Controlled Improvised Explosive Devices (RC-IED) is a growing threat around the world. The ease of construction and low cost of these devices are transforming common things in lethal tramps. The fight against this threats normally involves the use of sophisticated and expensive equipment of Electronic Warfare based on high speed DSP systems, just to detect the presence of detonation signals. In this work is showed how to find activation signals based on the characteristic of the power in a specific band and the previous knowledge about the detonation signals. As proof of concept we have taken the information about the RC-IEDs used in the Colombian conflict and develop an algorithm to find detonation signals based on the measured power in frequencies between 136 MHz and 174 MHz (2 meter civil band)

  15. Experimental Determination of the Static Properties of a Towable VHF-UHF Horizontal Electrode Antenna

    Science.gov (United States)

    1979-05-04

    The analytical procedure is documented in detail by Flath and Norgorden r3l and, in somewhat Its& detail, by Fessenden and Cheng f44 , and ’envick and...the formulation of Flath and I Horgorden to compute the frequency dependence of the impedance for the horizontal electrode antenna. The results are...Lincoln Laboratories Technical Note 1976-5, January 1976. 3. E. H. Flath , Jr. and 0. Norgorden, "Expressions for the Input Impedance and Power

  16. VHF Series-Input Parallel-Output Interleaved Self-Oscillating Resonant SEPIC Converter

    DEFF Research Database (Denmark)

    Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.

    2013-01-01

    If the switches of two resonant SEPIC converters are capacitively coupled, it is possible to obtain a self-oscillating converter in which the two power stages operate in interleaved mode. This paper describes a topology where the inputs of two SEPIC converters are connected in series, thereby sha....... Design considerations and challenges are investigated. To verify the proposed design, a 70 V input, 37 MHz prototype was built using low-cost switching and passive components, and experimental results are presented. Peak observed efficiency was 82%....

  17. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  18. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  19. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  20. Spectral characteristics of ionospheric scintillations of VHF radiosignal near magnetic zenith

    Science.gov (United States)

    Vasilyev, Roman; Globa, Mariia; Kushnarev, Dmitry; Medvedev, Andrey; Ratovsky, Konstantin

    2017-07-01

    We present the results of observing the Cygnus-A radio source scintillation in the Earth's ionosphere under quiet and disturbed geomagnetic conditions by using the Irkutsk incoherent scattering radar (IISR). The scintillation method applied for ionosphere testing at IISR confidently determines the Fresnel frequency and power cutoff, the spectral characteristics usually related to the velocities and spatial spectra of ionospheric plasma irregularities. We also use the IGRF magnetic field model to show the relation between the shape of discrete radio source scintillation spectra and the direction to the radio source with respect to the geomagnetic field. The S4 index increase within the magnetic zenith is observed to be conditioned by the scintillation spectrum widening. We also evaluate the zonal velocity of observed ionospheric irregularities as ∼10 m/sec assuming the irregularity height to be equal to the F2-layer maximum height in the ionosphere.

  1. On the angular dependence and scattering model of polar mesospheric summer echoes at VHF

    Science.gov (United States)

    Sommer, Svenja; Stober, Gunter; Chau, Jorge L.

    2016-01-01

    We present measurements of the angular dependence of polar mesospheric summer echoes (PMSE) with the Middle Atmosphere Alomar Radar System in Northern Norway (69.30° N, 16.04° E). Our results are based on multireceiver and multibeam observations using beam pointing directions with off-zenith angles up to 25° as well as on spatial correlation analysis (SCA) from vertical beam observations. We consider a beam filling effect at the upper and lower boundaries of PMSE in tilted beams, which determines the effective mean angle of arrival. Comparing the average power of the vertical beam to the oblique beams suggests that PMSE are mainly not as aspect sensitive as in contrast to previous studies. However, from SCA, times of enhanced correlation are found, indicating aspect sensitivity or a localized scattering mechanism. Our results suggest that PMSE consist of nonhomogeneous isotropic scattering and previously reported aspect sensitivity values might have been influenced by the inhomogeneous nature of PMSE.

  2. Parametrization of spectra of plasma bubble induced VHF satellite scintillations and its geophysical significance

    Directory of Open Access Journals (Sweden)

    P. N. Vijayakumar

    Full Text Available An important component of ionospheric plasma irregularity studies in the Indian low latitudes involves the study of the plasma bubbles which produce intense scintillations of the transionospheric satellite signals. Many such plasma bubble induced (PBI scintillation events were identified while recording 244 MHz signal from the geostationary satellite Fleetsat (73°E at Delhi (28.6°N, 77.2°E during March-April 1991. This type of scintillations represents changes in plasma processes. These scintillations are spectrally analyzed using an autoregressive (AR scheme, which is equivalent to maximum entropy method of spectrum analysis, amenable to extracting optimum spectral content from short data lengths (20 – 40 s. Each spectrum is assigned a level of detectability using the final prediction error (FPE derived from the optimum filter order required to resolve the spectrum. Lower detectability together with a higher order filter indicate a higher level of coherence for the plasma irregularities (discrete structures. Consistent patterns for these scintillations emerge from the present analysis as follows: (1 the initial and final phases of a scintillation patch display quasiperiodic oscillations. Their corresponding spectra show dominant (Gaussian shaped spectral features with detectability levels of –6 dB to –12 dB and requiring a higher order (>6 AR filter for their spectral resolution. These are most likely associated with discrete "filament-like" or "sheet-like" plasma structures that exist near the bubble walls. (2 Two main features of the scintillation spectra could be positively associated with the well-developed plasma bubble stage: (a spectra displaying a power-law process with a single component spectral slope between 1.6 to 3.0. Generally such spectra are resolved with a 2nd order filter and have a 1 dB to 6 dB of detectability. (b Spectra displaying a double slope, indicating an inner and an outer scale regime for the power

  3. Parametrization of spectra of plasma bubble induced VHF satellite scintillations and its geophysical significance

    Directory of Open Access Journals (Sweden)

    P. N. Vijayakumar

    1997-03-01

    Full Text Available An important component of ionospheric plasma irregularity studies in the Indian low latitudes involves the study of the plasma bubbles which produce intense scintillations of the transionospheric satellite signals. Many such plasma bubble induced (PBI scintillation events were identified while recording 244 MHz signal from the geostationary satellite Fleetsat (73°E at Delhi (28.6°N, 77.2°E during March-April 1991. This type of scintillations represents changes in plasma processes. These scintillations are spectrally analyzed using an autoregressive (AR scheme, which is equivalent to maximum entropy method of spectrum analysis, amenable to extracting optimum spectral content from short data lengths (20 – 40 s. Each spectrum is assigned a level of detectability using the final prediction error (FPE derived from the optimum filter order required to resolve the spectrum. Lower detectability together with a higher order filter indicate a higher level of coherence for the plasma irregularities (discrete structures. Consistent patterns for these scintillations emerge from the present analysis as follows: (1 the initial and final phases of a scintillation patch display quasiperiodic oscillations. Their corresponding spectra show dominant (Gaussian shaped spectral features with detectability levels of –6 dB to –12 dB and requiring a higher order (>6 AR filter for their spectral resolution. These are most likely associated with discrete "filament-like" or "sheet-like" plasma structures that exist near the bubble walls. (2 Two main features of the scintillation spectra could be positively associated with the well-developed plasma bubble stage: (a spectra displaying a power-law process with a single component spectral slope between 1.6 to 3.0. Generally such spectra are resolved with a 2nd order filter and have a 1 dB to 6 dB of detectability. (b Spectra displaying a double slope, indicating an inner and an outer scale regime for the power

  4. Microfabricated Air-core Toroidal Inductor In Very High Frequency Power Converters

    DEFF Research Database (Denmark)

    Lê Thanh, Hoà; Nour, Yasser; Han, Anpan

    2018-01-01

    Miniaturization of power supplies is required for future intelligent electronic systems e.g. internet of things devices. Inductors play an essential role, and they are by far the most bulky and expensive components in power supplies. This paper presents a miniaturized microelectromechanical systems...... of 9 at 20 MHz. A DC-DC class-E boost converter is designed and implemented using the fabricated MEMS air-core inductor and a highperformance 65 V gallium nitride field effect transistor. The VHF converter achieved a peak efficiency of 78 % at the input voltage of 6.5 VDC. The MEMS inductor can carry 1...

  5. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  6. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  7. Technology for satellite power conversion. Semiannual technical report

    Energy Technology Data Exchange (ETDEWEB)

    Gouker, M.A.; Campbell, D.P.; Gallagher, J.J.

    1987-02-01

    The work is this reporting period was concentrated on electronically calibrating the bolometer detectors. The calibration is necessary for two reasons: first, the power delivered to the rectifying circuit must be known in order to choose a diode with the appropriate barrier height, and second, the power captured by the antenna must be measured if the efficiency of the rectenna is to be divided into antenna efficiency and rectification efficiency. The millimeter wave region operation of the bolometers was simulated with a VHF (10 to 90 MHz) test signal. These detectors are accurate to within roughly 10%. The typical responsivity of the bolometers is 10 volts/watt and the NEP at 20 Hz is 5 times 10 to the minus 9th power W(Hz)-1/2.

  8. Development Of VHF (240-270 MHz) Antennas For SoOp (Signal Of Opportunity) Receiver For 6u Cubesat Platforms

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2016-01-01

    The main goal of this research is to design, fabricate, and test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a truly global direct surface soil moisture (SM) and RZSM measurement system (Figure 1) over a variety of land covers with limited density restrictions. In SoOp methodology, signals transmitted by already existing transmitters (known as transmitters of opportunity, in this case the Military Satellite Communication (MilSatCom) System's UHF Follow-On program) are utilized to measure properties of reflecting targets by recording reflected signals using a simple passive microwave receiver.

  9. High-resolution observation of field-aligned irregularities in the ionosphere using multi-frequency range imaging of VHF atmospheric radar

    Science.gov (United States)

    Chen, Jenn-Shyong; Furumoto, Jun-ichi; Su, Ching-Lun; Chu, Yen-Hsyang

    Field-aligned irregularity (FAI) in the ionosphere is a topic of interest to atmospheric radar community. In addition to the field-aligned characteristic, quasi-periodic (QP) appearance of FAI echoes has been observed frequently by very-high-frequency (VHF) atmospheric radar. The occurrence range of QP FAI echoes changes with time, and the slope of range versus time can be positive or negative, depending on occurrence time of the echoes. Several mechanisms responsible for the QP FAI echoes have been proposed, e.g., modulation in altitude by a passing atmospheric gravity wave, semidiurnal neutral-wind variation, and so on. Owing to the finite pulse length of radar in observation, the range resolution of measurement is limited within hundreds of meters. In view of this, the range imaging (RIM) using multiple frequencies has been employed to improve the range resolution of measurement. The multi-frequency technique transmits a set of slightly different frequencies sequentially during each radar pulse, and the radar returns at different transmitting frequencies are received, respectively. With adaptive retrieval algorithms for these radar returns, it is capable of resolving the echo structures at meter scale in the range direction. RIM has been employed in the lower atmosphere successfully. In this study, the performance of RIM for FAI was first carried out with the Middle and Upper atmosphere Radar (46 MHz; 34.85(°) N, 136.10(°) N; Japan) and the Chung-Li VHF radar (52 MHz; 24.9(°) N, 121.1(°) E; Taiwan). Some initial results of high-resolution FAI echoes within the range gate will be shown.

  10. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  11. A VHF Interleaved Self-Oscillating Resonant SEPIC Converter with Phase-Shift Burst-Mode Control

    DEFF Research Database (Denmark)

    Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    This paper presents design and implementation of the phase-shift burst-mode control method for interleaved selfoscillating resonant SEPIC converters for LED lighting applications. The proposed control method utilizes delays in the turn-on and turn-off of the power stage and control circuitry...

  12. 47 CFR 80.57 - Canada/U.S.A. channeling arrangement for VHF maritime public correspondence.

    Science.gov (United States)

    2010-10-01

    ... maritime public correspondence. 80.57 Section 80.57 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... and Supplementary Channels. The effective radiated power (ERP) must not exceed 60 watts. Antenna... paragraph (d)(5) of this section. (2) Inland Waters Local Channel. ERP must not exceed 8 watts with an...

  13. The variability of the occurrence of the Field Aligned Irregularities in the middle-latitude F region using the VHF radar observation at Daejon, South Korea.

    Science.gov (United States)

    Oh, S. J.; Kil, H.; Tae-yong, Y.; Kwak, Y. S.; Lee, W. K.

    2016-12-01

    The VHF radar observations at Daejeon in South Korea reveal the highly variable nature of the field-aligned irregularities (FAIs) in the middle-latitude F-region. Medium-scale travelling ionospheric disturbances (MSTIDs) are suggested as the source of FAIs, however, the occurrence climatology of the FAIs cannot be fully explained by the existence of the MSTIDs. Moreover, the occurrence climatology of the FAIs with respect to local time (pre-midnight and post-midnight) likely to have separate onset mechanisms. We investigate the role of the ionospheric disturbances(MSTIDs, Equatorial Plasma Bubbles(EPBs)) in the creation of the FAIs using the radar data at Daejon , the total electron content maps over Japan acquired during 2010-2015. and the measurements of the ion density by Swarm (2014,2015). We assess the causal linkage of the occurrence of the FAIs by examining the correlative occurrence of MSTIDs in middle latitude F-region and EPB in low latitude F-region.

  14. Observations of VHF emissions from 50-mA electron beam injections in the ionosphere that are associated with beam-induced discharges

    Science.gov (United States)

    Goerke, R. T.; Kellogg, P. J.; Monson, S. J.; Franz, R. C.; Nemzek, R. J.; Anderson, H. R.; Potter, D. W.; Denig, W. F.; Szuszczewicz, E. P.; Earle, G. D.

    1992-01-01

    Results are presented of observations of strong VHF plasma waves with amplitudes in excess of 0.1 mV/m (Hz)1/2 associated with 50 mA electron beam injections in the ionosphere. Data from three swept-frequency receivers carried on two daughter payloads are analyzed to determine the emission spectra of the electron beam for various energies and currents. These results were obtained from the rocket-borne experiment SCEX 3, NASA flight 39.002 UE, launched February 1, 1990. The accelerator payload also carried photometers, which measured luminosity at wavelengths of 391.4 and 380.5 nm. Several times during electron gun activity the measured luminosity increased much faster than proportional to the beam current. This nonlinear increase is evidence that a discharge is occurring in the vicinity of the accelerator payload. It is inferred from the uniform distribution of the luminosity around the accelerator payload that the observed discharge extends significantly outside the beam cylinder.

  15. Mechanical power, thrust power

    OpenAIRE

    Gatta, Giorgio; Cortesi, Matteo; Swaine, Ian; Zamparo, Paola

    2017-01-01

    The purpose of this study was to explore the relationships between mechanical power, thrust power, propelling efficiency and sprint performance in elite swimmers. Mechanical power was measured in 12 elite sprint male swimmers: i) in the laboratory, by using a whole body swimming ergometer (W’TOT); and ii) in the pool, by measuring full tethered swimming force (FT) and maximal swimming velocity (Vmax): W’T = FT .Vmax. Propelling efficiency ( P) was estimated based on the “paddle wheel model“ a...

  16. vhfRNAi: a web-platform for analysis of host genes involved in viral infections discovered by genome wide RNAi screens.

    Science.gov (United States)

    Thakur, Anamika; Qureshi, Abid; Kumar, Manoj

    2017-06-27

    Knockdown of host genes using high-throughput genome-wide RNA interference screens has identified numerous host factors that affect viral infections, which would be helpful in understanding host-virus interactions. We have developed a vhfRNAi web resource based on genome-wide RNAi experiments for viruses. It contains experimental details of 12 249 entries (host factors + restriction factors) for 18 viruses. Simultaneously, this resource encompasses analysis of overlapping genes, genome wide association studies, gene ontology (GO), pathogen interacting proteins, interaction networks and pathway enrichment. Using overlap analysis, it was found that Influenza A virus shared overlapping host genes with the majority of viruses including Hepatitis C virus and Dengue virus 2. In the genome wide association studies analysis, 429 diseases/traits were mapped, of which obesity-related traits were the most common. GO analysis revealed that the major categories belonged to metabolic processes, molecule transport, signal transduction, proteolysis, etc. In the pathogen interacting protein analysis, protein interaction data from different resources can be explored for further understanding of host-virus biology. By pathway enrichment analysis, a total of 8955 genes were mapped on 303 pathways with most of the hits coming from metabolic pathways. We have found 491 genes that are not essential for the host but essential for the virus and can be targeted to inhibit the virus. These may be explored as potential candidates for drug targets. The resource is freely accessible at and will be useful in understanding host-virus biology as well as identification of targets for the development of antiviral therapeutics.

  17. WHU VHF radar observations of the diurnal tide and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N, China

    Directory of Open Access Journals (Sweden)

    C. Huang

    2015-07-01

    Full Text Available The diurnal tide (DT and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N were studied based on the newly established Wuhan University (WHU VHF radar observations with the height intervals of 0.145 km (below 9 km and 0.58 km (above 9 km in the whole year of 2012. We find that the DT was the dominant tidal component and showed remarkable height and season variations. A prominent seasonally dependent height variability characteristic is that maximum DT amplitude usually occurs around 6 km in the winter and spring months, which might be due to the tidal wave energy concentration arising from the reflections from the strong eastward tropospheric jet around 13 km and the ground surface. Our results suggest that the background wind is a crucial cause for height variability and seasonal variability of DT. In April 2012, a notable strengthening of DT is observed. Meanwhile, the significant higher harmonics of tides, i.e., the semidiurnal, terdiurnal, and even quarterdiurnal tides, can also be observed, which has seldom been reported. Interestingly, these four tidal components displayed consistent short-term variability, implying that they were excited by the same dramatically varying tidal source. In addition, we identified two symptoms of the coupling of DT and planetary waves (PWs, which can also lead to the short-term DT variability. One is the sum and difference interactions between DT and PWs, causing the tidal amplitude short-term variability as a consequence of the energy exchange among the interacting waves. The other one is the modulation of DT by PWs, leading to that the amplitude of DT varies with the periods of the PWs.

  18. Heat flux and thermal conduction in O+ and H+ ion flows deduced from EISCAT-VHF radar observations in the high-latitude topside ionosphere

    Science.gov (United States)

    Wu, Jian; Taieb, Charley

    1994-06-01

    With two periods of EISCAT-VHF radar observations, magnetically quiet and moderately disturbed, we have calculated the H+ and O+ heat fluxes in using formulae of Wu and Taieb (1993), accounting not only for temperature gradients but also for pressure gradients, velocity gradients, and diffusion-thermal effects. They correspond to different physical processes that are calculated and compared between them. Then, the general features of the H+ and O+ ion thermal conductions are studied during the two periods of observation in the high-latitude topside ionosphere. The analysis of the two periods of measurements revealed the following trends, to be confirmed by further observations: (1) During the two periods the H+ heat flux Q2 is always upward in the altitude range from 600 km up to about 1000 km. It is larger during the quiet period than during the disturbed period. (2) The most important dominant mechanism for H+ heat flux is the diffusion-thermal effect due to the H+-O+ collision, with a correcting term due to the H+ temperature gradient. (3) The O+ heat flux is always downward in the same altitude range during the two periods of observations. The absolute value during the disturbed period is slightly larger than that during the quiet period. (4) The dominant mechanism for O+ heat flux is its temperature gradient, corrected by the coupling with the H+ ion. (5) The O+ thermal conduction is less important during the quiet period than during the disturbed period, while for the H+ thermal conduction it is the contrary. (6) The H+ thermal conduction increases with altitude below about 1000 km.

  19. Pragmatic power

    CERN Document Server

    Eccles, William

    2008-01-01

    Pragmatic Power is focused on just three aspects of the AC electrical power system that supplies and moves the vast majority of electrical energy nearly everywhere in the world: three-phase power systems, transformers, and induction motors. The reader needs to have had an introduction to electrical circuits and AC power, although the text begins with a review of the basics of AC power. Balanced three-phase systems are studied by developing their single-phase equivalents. The study includes a look at how the cost of ""power"" is affected by reactive power and power factor. Transformers are cons

  20. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  1. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    ... chart recorder at Varanasi during 1991 to 1999. The amplitude fluctuations having peak to peak variations>1 dB have been con- sidered for the present analysis. At Varanasi scintillations are frequently observed during nighttime, hence only nocturnal variation of irregularities in different months and sea- sons are studied.

  2. Power Electronics

    DEFF Research Database (Denmark)

    Iov, Florin; Ciobotaru, Mihai; Blaabjerg, Frede

    2008-01-01

    The global electrical energy consumption is still rising and there is an urgent demand to increase the power capacity. It is expected that the power capacity has to be doubled within 20 years. The production, distribution and use of energy should be as efficient as possible and incentives to save...... energy at the end-user should also be set up. Deregulation of energy has in the past lowered the investment in larger power plants, which means the need for new electrical power sources will be high in the near future. Two major technologies will play important roles to solve the future problems. One...... is to change the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. The other is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most...

  3. Power Talk

    DEFF Research Database (Denmark)

    Angjelichinoski, Marko; Stefanovic, Cedomir; Popovski, Petar

    2016-01-01

    A standard way to realize communication in microgrid control is to use an external communication network, such as modems for wireless or power-line communication, whose implementation may be inefficient in terms of deployment cost, complexity, and system stability. In this chapter we present...... a communication solution, denoted as power talk, which is solely based on the use of the existing microgrid power equipment (i.e., power electronics and buses). The pivotal idea is to modulate information in the power-related parameters of the microgrid buses by use of the flexibility of power electronic...... interfaces. The focus of the chapter is on the design of power talk solutions for DC microgrids with droop control. Specifically, the chapter presents the power talk implementation through modification of the droop parameters of the primary control loop, and investigates the design of modulation schemes...

  4. Benevolent power.

    Science.gov (United States)

    Davidhizar, Ruth

    2005-01-01

    The nurse's ability to use "benevolent power" can be a very useful tool in relating to patients. Use of "benevolent power" takes advantage of the nurse's power and authority by virtue of positions. However, rather than focusing on the nurse's needs or manipulating the patient in a negative way, use of"benevolent power" allows the nurse to respond to the patient situation in a way which is beneficial and positive for the patient.

  5. Stockholm Power Tech. Power systems

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    The proceedings from this symposium is presented in six volumes: Invited speakers` sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume

  6. EMC Investigation of a Very High Frequency Self-oscillating Resonant Power Converter

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Knott, Arnold; Andersen, Michael A. E.

    2016-01-01

    This paper focuses on the electromagnetic compatibility (EMC) performance of a Very High Frequency (VHF) converter and how to lower the emissions. To test the EMC performance a VHF converter is implemented with a Class-E inverter and a Class-DE rectifier. The converter is designed to deliver 3 W...

  7. Power Electronics

    Indian Academy of Sciences (India)

    They cover a wide spectrum of areas from power supplies to power system ... in vehicles. In traction and automotive applications, other than the main propulsion drive itself, there are a number of auxiliary applications requiring electrical control and ... which can be a new solution for the differential drive in electric vehicles.

  8. Power system

    Science.gov (United States)

    Hickam, Christopher Dale [Glasford, IL

    2008-03-18

    A power system includes a prime mover, a transmission, and a fluid coupler having a selectively engageable lockup clutch. The fluid coupler may be drivingly connected between the prime mover and the transmission. Additionally, the power system may include a motor/generator drivingly connected to at least one of the prime mover and the transmission. The power-system may also include power-system controls configured to execute a control method. The control method may include selecting one of a plurality of modes of operation of the power system. Additionally, the control method may include controlling the operating state of the lockup clutch dependent upon the mode of operation selected. The control method may also include controlling the operating state of the motor/generator dependent upon the mode of operation selected.

  9. Dobrudzha power; Dobrudscha-Power

    Energy Technology Data Exchange (ETDEWEB)

    Mihai, Silviu

    2011-11-15

    Europe's biggest wind farm is now under construction between the Danube River and the Black Sea. The region may cover up to 50 percent of Romania's power demand and may make the country's only nuclear power plant dispensable.

  10. Power Talk

    DEFF Research Database (Denmark)

    Stefanovic, Cedomir; Popovski, Petar; Angjelichinoski, Marko

    2015-01-01

    We introduce a novel communication strategy for DC Micro Grids (MGs), termed power talk, in which the devices communicate by modulating the power levels in the DC bus. The information is transmitted by varying the parameters that the MG units use to control the level of the common bus voltage......, while it is received by processing the bus measurements that units perform. This implies that the communication does not require a dedicated modem, but instead it is piggybacked on top of the power electronics. The communication is challenged by the random fluctuations of the voltage level due...

  11. Power Talk

    DEFF Research Database (Denmark)

    Liu, Hongpeng; Yang, Yongheng; Loh, Poh Chiang

    2016-01-01

    In this paper, a novel communication strategy called Power Talk is introduced to realize the power line communication among the Voltage Source Converters (VSC) of DC MicroGrids (MGs). Each VSC transmits information by changing the control parameters, and receives information by observing the local...... output power. By using common coding schemes, which transform the DC MGs in some familiar communication channels, some important communication challenges can be addressed, such as random load variations and VSCs switching, as it do not need a separate communication channel. For this purpose, two multiple...

  12. Normative Power

    DEFF Research Database (Denmark)

    Robert Falkner Norm advocacy: a small state strategy to influence the EUAnnika Björkdahl Empowering Africa: normative power in EU-Africa relationsSibylle Scheipers and Daniela Sicurelli Fake, partial and imposed compliance: the limits of the EU's normative power in the Western BalkansGergana Noutcheva...... Globalizing European Union environmental policyR. Daniel Kelemen Europe and the new global economic order: internal diversity as liability and asset in managing globalizationOrfeo Fioretos Forthcoming: Normative Power Spotting: An ontological and methodological appraisalElisabeth De Zutter...

  13. Enlaces de datos En VHF (VDL dentro del contexto CNS/ATM para la prestación de los servicios de tránsito aéreo en Colombia

    Directory of Open Access Journals (Sweden)

    Édgar Leonardo Gómez Gómez

    2012-09-01

    Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.

  14. Power Outages

    Science.gov (United States)

    ... Access and Functional Needs During a Power Outage: Safety Tips Only use flashlights for emergency lighting, candles ... about 48 hours. For more information about food safety visit our food page. Take steps to remain ...

  15. Tidal power

    Energy Technology Data Exchange (ETDEWEB)

    Baker, A.C.

    1987-05-01

    The principal tidal power sites around the world are summarised, showing that the UK is fortunate in having three major potential sites. The first use of tidal power for generating electricity was a small scheme near Bristol built 56 years ago. Since then, the 240 MW Rance barrage and the recent 20 MW pilot 'Straflo' turbine installed at Annapolis Royal in the Bay of Funday are the main schemes built to date. These were built 'in the dry'. For an inlet off the White sea, North Russia, a samll tidal power plant was prefabricated complete and towed into position in the early 1960s. Alternative methods of operation are discussed and the economics of tidal power compared with thermal stations. Overall, the tides could be a highly predictable and substantial source of renewable energy whose development involves proven technology.

  16. Introduction to electrical power and power electronics

    CERN Document Server

    Patel, Mukund R

    2012-01-01

    Power Generation, Distribution, and Utilization AC Power Fundamentals Common Aspects of Power Equipments AC Generator AC and DC Motors Transformer Power Cable Power Distribution Fault Current Analysis System ProtectionEconomic Use of PowerElectrochemical BatteryPower Electronics and Motor Drives Power Electronics Devices DC-DC Converters AC-DC-AC Converters Variable-Frequency Drives Quality of Power Power Converter CoolingAppendixIndex

  17. Cyber Power

    Science.gov (United States)

    2010-05-01

    libertarians proclaimed that “information wants to be free” and portrayed the internet as the end of government controls and the “death of distance.” In...What is distinctive about power in the cyber domain is not that governments are out of the picture as the early cyber libertarians pre- dicted, but the... Theory (Englewood Cliffs, NJ: Prentice-Hall, 1966), 39-70. Other classic articles on power by Robert Dahl, John C. Harsanyi, Hebert Simon and others

  18. Comic Power

    DEFF Research Database (Denmark)

    Tønder, Lars

    2014-01-01

    to the potential embedded in this power can give us new traction on the conditions of democracy more broadly understood. To show this, the article draws on two rarely paired resources—Spinoza’s philosophy of immanence and Dave Chappelle’s critique of racial discrimination—placing both of them in conversation...

  19. Power branding

    Energy Technology Data Exchange (ETDEWEB)

    Chambers, A.

    1998-12-31

    For most of its century-long history, electricity was a natural monopoly, due in part to the excessive cost of the necessary infrastructure. In the past decade, however, politics have pushed the industry toward competition and consumer choice. At the same time, technology has been developed that allows consumers to choose their electricity supplier and to track the flow of power through the various grids and lines. In her new book, Power Branding, author and industry expert Ann Chambers examines marketing and branding of electricity -- what it is, how it`s done, what its benefits are for electric utilities, marketers, and even natural gas companies allied with the utilities. She surveys industry leaders who have already taken a dive into the ocean of marketing and offers lessons drawn from their experiences. She also takes a look at other formerly regulated industries -- airlines, telephone, natural gas -- and describes how their rebirth as free-market industries may affect the course of the electric utility industry`s experience. The contents include: Introduction; Basics of branding: Brand image; Value-added services; Southern Company; Duke Energy; UtiliCorp/EnergyOne/Aquila--big and brand; Engage energy; Florida Power and Light Co.; Enron; Convergence; Lessons from the natural gas industry; Lessons from other industries; Conclusion; Resources; Glossary of branding, marketing and Btu convergence; and Major federal legislation affecting the electric power industry.

  20. Power electronics

    Indian Academy of Sciences (India)

    Kishore Chatterjee

    This special issue of Sadhana is a compilation of papers selected from those presented at the 7th National Power. Electronics Conference (NPEC), held at the Indian Institute of Technology, Bombay, on 21–23 December 2015. From among the papers presented in NPEC-2017, selected papers were peer-reviewed for ...

  1. Atomic Power

    African Journals Online (AJOL)

    Atomic Power. By Denis Taylor: Dr. Taylor was formerly Chief UNESCO Advisor at the University. College, Nairobi, Kenya and is now Professor of Electrical Engineering in the Uni- versity of ... method of producing radioactive isotopes, which are materials .... the sealing and the pressure balancing, all can be carried out ...

  2. Power semiconductors

    CERN Document Server

    Kubát, M

    1984-01-01

    The book contains a summary of our knowledge of power semiconductor structures. It presents first a short historic introduction (Chap. I) as well as a brief selection of facts from solid state physics, in particular those related to power semiconductors (Chap. 2). The book deals with diode structures in Chap. 3. In addition to fundamental facts in pn-junction theory, the book covers mainly the important processes of power structures. It describes the emitter efficiency and function of microleaks (shunts). the p +p and n + n junctions, and in particular the recent theory of the pin, pvn and p1tn junctions, whose role appears to be decisive for the forward mode not only of diode structures but also of more complex ones. For power diode structures the reverse mode is the decisive factor in pn-junction breakdown theory. The presentation given here uses engineering features (the multiplication factor M and the experimentally detected laws for the volume and surface of crystals), which condenses the presentation an...

  3. Soft Power and Smart Power in Africa

    Science.gov (United States)

    2008-12-01

    World Politics , 1st ed. (New York: Public Affairs, 2004), x. 2. CSIS Commission on Smart Power: A Smarter, More Secure America (Washington, D.C...4. Ibid. 5. Nye, Soft Power: The Means to Success in World Politics , xi and 1. 6. Ernest J. Wilson III, "Hard Power, Soft Power, Smart Power," The...548. 25. Nye, Soft Power: The Means to Success in World Politics , 5. 26. Nye, Public Diplomacy and Soft Power, 95. 27. Nye, Limits of American Power

  4. Pipeline Power

    OpenAIRE

    Hubert, Franz; Cobanli, Onur

    2012-01-01

    We use cooperative game theory to analyze the impact of three controversial pipeline projects on the power structure in the Eurasian trade of natural gas. Two of them, Nord Stream and South Stream, allow Russian gas to bypass transit countries, Ukraine and Belarus. Nord Stream’s strategic value turns out to be huge, justifying the high investment cost for Germany and Russia. The additional leverage obtained through South Stream, in contrast, appears small. The third project, Nabucco, aims at ...

  5. Power generation technologies

    Energy Technology Data Exchange (ETDEWEB)

    Paul Breeze

    2005-07-01

    Contents: Introduction to electricity generation; Environmental considerations; Coal-fired power plants - Types of coal; Traditional coal-burning power plant technology; Emission control for traditional coal-burning plants; Advanced coal-burning power plant technology; Environmental effects of coal combustion; Financial risks associated with coal-fired power generation; The cost of coal-fired electricity generation; Gas turbines and combined cycle power plants; Combined heat and power; Piston-engine-based power plants; Fuel cells; Hydropower; Tidal power; Storage technologies; Wind power; Geothermal power; Solar power; Ocean power; Biomass-based power generation; Power from waste; Nuclear power.

  6. 47 CFR 80.268 - Technical requirements for radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Equipment Authorization for Compulsory Ships § 80... radio ground waves over seawater. The installation and construction of the required antenna must ensure... between masts or other supports subject to whipping, a safety link must be installed which under heavy...

  7. Wind power - a power source now enabled by power electronics

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Iov, Florin

    2007-01-01

    the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. Another is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most emerging...... renewable energy sources, wind energy, which by means of power electronics are changing from being minor energy sources to be acting as important power sources in the energy system....

  8. Observation of strong VHF-radar echoes from the E-region at 69°N and 54°N: Echo properties, relation to sporadic layers, and physical mechanisms

    Science.gov (United States)

    Rapp, Markus; Leitert, Lasse; Latteck, Ralph; Zecha, Marius; Hoffmann, Peter; Höffner, Josef; Hoppe, Ulf-Peter; La Hoz, Cesar

    For more than ten years the Leibniz-Institute of Atmospheric Physics at Rostock University in Kühlungsborn has been operating two VHF-radars (53.5 MHz) at the Arctic location Andenes (69N, 16E) as well as the mid-latitude site Kühlungsborn (54.1N 11.8E). Both radars have primarily been used for the study of strong radar echoes from the summer mesopause region known as (polar) mesosphere summer echoes or (P)MSE. PMSE occur from mid May until mid August in an altitude range from 80 -90 km, i.e., at the time of year and in the altitude range where the atmosphere is supersaturated with respect to ice such that ice particles may form, modify the D-region plasma, and lead to spectacular radar echoes. The existence of echoes from above this altitude range has generally been deemed impossible since refractive index fluctuations arising from neutral dynamics such as turbulence are effectively destroyed at these altitudes owing to the exponential increase of viscosity with height. Also, plasma instabilities which occur between 90 -110 km height produce field aligned irregularities and should not lead to detectable echoes for vertically sounding radars at polar latitudes where the magnetic field lines are essentially perpendicular to the surface. It hence comes as a surprise that our recent observations in the altitude range from 90 -115 km reveals the presence of strong radar echoes both at 69N as well as 54N. These echoes have a typical duration of less than 1 hour and extend over less than 1 km in height. They occur in the entire altitude range from 90 to 115 km with a pronounced maximum at 100 km. The seasonal variation is marked by a pronounced maximum during the summer months. This paper describes the morphology and statistics of these echoes, discusses its relation to sporadic E-layers and sporadic metal layers, and closes with an initial attempt to identify a physical mechanism responsible for these structures.

  9. SPACE VEHICLE POWER PLANTS,

    Science.gov (United States)

    SPACECRAFT, POWER SUPPLIES), (*POWER SUPPLIES, SPACECRAFT), ENERGY CONVERSION, BATTERY COMPONENTS, ELECTRIC BATTERIES, SOLAR CELLS, NUCLEAR POWER PLANTS , SPACEBORNE, MAGNETOHYDRODYNAMICS, ELECTROSTATICS, SPACE ENVIRONMENTS

  10. Green Power Partnership Videos

    Science.gov (United States)

    The Green Power Partnership develops videos on a regular basis that explore a variety of topics including, Green Power partnership, green power purchasing, Renewable energy certificates, among others.

  11. A discussion on the variations of MST/ST radar echo power with an atmospheric layer resolved by frequency domain interferometry technique

    Science.gov (United States)

    Chen, J. S.; Chu, Y. H.

    2000-11-01

    The relationship between an atmospheric layer and its VHF backscatter resolved by the frequency domain interferometry (FDI) technique is investigated in this article. A theoretical expression connecting the radar echo power with the thickness and position of an atmospheric layer and the range weighting function of a matched filter is derived. It shows that the farther the layer locates from the central height of the radar volume, the weaker the echo power will be. This feature is attributed to the range weighting effect of the radar system. FDI observations also show that the echo power from the atmospheric layer located close to the central height of the radar volume is usually greater than that from the layer located at the edge of the volume, which is in good agreement with the theoretical prediction. Moreover, the correlation between the echo power and layer position is negative (positive) if the layer locates in the upper (lower) part of the radar volume. This behavior is consistent with the theoretical prediction and can also be interpreted by the range weighting effect. It is also suggested that the power-position relation is capable of indicating the system bias causing the systematic error of FDI-estimated layer position. In addition, numerical simulation is performed in this article to examine the difference between the range weighting functions resulting from rectangular and nonrectangular radar pulses for a given receiver impulse response.

  12. Human Power Empirically Explored

    NARCIS (Netherlands)

    Jansen, A.J.

    2011-01-01

    Harvesting energy from the users’ muscular power to convert this into electricity is a relatively unknown way to power consumer products. It nevertheless offers surprising opportunities for product designers; human-powered products function independently from regular power infrastructure, are

  13. Power manager and method for managing power

    NARCIS (Netherlands)

    Burchard, A.T.; Kersten, G.; Molnos, A.M.; Milutinovic, A.; Goossens, K.G.W.; Steffens, E.F.M.

    2009-01-01

    A power manager (106) and method for managing the power supplied to an electronic device is provided. Furthermore, a system wherein the power supplied to an electronic device is managed is provided. The power manager (106) is operative to monitor a hardware monitor (104) during a monitoring time

  14. Power theories for improved power quality

    CERN Document Server

    Pasko, Marian

    2012-01-01

    Power quality describes a set of parameters of electric power and the load’s ability to function properly under specific conditions. It is estimated that problems relating to power quality costs the European industry hundreds of billions of Euros annually. In contrast, financing for the prevention of these problems amount to fragments of these costs. Power Theories for Improved Power Quality addresses this imbalance by presenting and assessing a range of methods and problems related to improving the quality of electric power supply. Focusing particularly on active compensators and the DSP based control algorithms, Power Theories for Improved Power Quality introduces the fundamental problems of electrical power. This introduction is followed by chapters which discuss: •‘Power theories’ including their historical development and application to practical problems, •operational principles of active compensator’s DSP control based algorithms using examples and results from laboratory research, and •t...

  15. Women, Power, and Libraries.

    Science.gov (United States)

    Schuman, Patricia Glass

    1984-01-01

    Discusses the concept of power in the context of women and the library profession, citing views of power by Max Weber, John Kenneth Galbraith, Letty Cottin Pogrebin, and Rosabeth Moss Kantor. Male power and female submission, defining power, organizing for power, and sharing power are highlighted. A 12-item bibliography is included. (EJS)

  16. Dynamic power flow controllers

    Science.gov (United States)

    Divan, Deepakraj M.; Prasai, Anish

    2017-03-07

    Dynamic power flow controllers are provided. A dynamic power flow controller may comprise a transformer and a power converter. The power converter is subject to low voltage stresses and not floated at line voltage. In addition, the power converter is rated at a fraction of the total power controlled. A dynamic power flow controller controls both the real and the reactive power flow between two AC sources having the same frequency. A dynamic power flow controller inserts a voltage with controllable magnitude and phase between two AC sources; thereby effecting control of active and reactive power flows between two AC sources.

  17. Lunar solar-power system: Commerical power

    Science.gov (United States)

    Criswell, David R.

    1995-01-01

    The proposed Lunar Solar-Power (LSP) System collects solar power on the moon. The power is converted to beams of microwaves and transmitted to fields of microwave receivers (rectennas) on Earth that provide electric power to local and regional power grids. LSP can provide abundant and low cost energy to Earth to sustain several centuries of economic development on Earth and in space. The LSP power is independent of the biosphere (global warming, weather, and climate changes), independent of reserves of terrestrial non-renewable and renewable power, and is low in total costs compared to other large scale power systems. Efficient utilization of the moon as a platform for solar collectors/power transmitters and as a source of building materials is key to the development and emplacement of the LSP System. LSP development costs can be significantly reduced by the establishment of a manned lunar base.

  18. Switching power converters medium and high power

    CERN Document Server

    Neacsu, Dorin O

    2013-01-01

    An examination of all of the multidisciplinary aspects of medium- and high-power converter systems, including basic power electronics, digital control and hardware, sensors, analog preprocessing of signals, protection devices and fault management, and pulse-width-modulation (PWM) algorithms, Switching Power Converters: Medium and High Power, Second Edition discusses the actual use of industrial technology and its related subassemblies and components, covering facets of implementation otherwise overlooked by theoretical textbooks. The updated Second Edition contains many new figures, as well as

  19. Electrical Power Converter

    NARCIS (Netherlands)

    Ferreira, J.A.

    2014-01-01

    Electrical power converter for converting electrical power of a power source connected or connectable at an input to electrical DC-power at an output, wherein between the input and the output a first circuit of submodules is provided, wherein said first circuit of submodules and the power source

  20. Good Health: The Power of Power

    Science.gov (United States)

    Corbin, Charles B.; Janz, Kathleen F.; Baptista, Fátima

    2017-01-01

    Power has long been considered to be a skill-related fitness component. However, based on recent evidence, a strong case can be made for the classification of power as a health-related fitness component. Additionally, the evidence indicates that performing physical activities that build power is associated with the healthy development of bones…

  1. Wind Power - A Power Source Enabled by Power Electronics

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Chen, Zhe

    2004-01-01

    The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. The production, distribution and the use of the energy should be as technological efficient as possible and incentives to save energy at the end-user should be set up. The deregul......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. The production, distribution and the use of the energy should be as technological efficient as possible and incentives to save energy at the end-user should be set up....... The deregulation of energy has lowered the investment in bigger power plants, which means the need for new electrical power sources may be very high in the near future. Two major technologies will play important roles to solve the future problems. One is to change the electrical power production sources from...... the conventional, fossil (and short term) based energy sources to renewable energy sources. The other is to use high efficient power electronics in power systems, power production and end-user application. This paper discuss the most emerging renewable energy source, wind energy, which by means of power...

  2. Wind power in modern power systems

    DEFF Research Database (Denmark)

    Chen, Zhe

    2013-01-01

    In recent years, wind power is experiencing a rapid growth, and large-scale wind turbines/wind farms have been developed and connected to power systems. However, the traditional power system generation units are centralized located synchronous generators with different characteristics compared...... with wind turbines. This paper presents an overview of the issues about integrating large-scale wind power plants into modern power systems. Firstly, grid codes are introduced. Then, the main technical problems and challenges are presented. Finally, some possible technical solutions are discussed....

  3. Kansas Power Plants

    Data.gov (United States)

    Kansas Data Access and Support Center — The Kansas Power Plants database depicts, as point features, the locations of the various types of power plant locations in Kansas. The locations of the power plants...

  4. Distributed Power Flow Controller

    OpenAIRE

    Yuan, Z

    2010-01-01

    In modern power systems, there is a great demand to control the power flow actively. Power flow controlling devices (PFCDs) are required for such purpose, because the power flow over the lines is the nature result of the impedance of each line. Due to the control capabilities of different types of PFCDs, the trend is that mechanical PFCDs are gradually being replaced by Power electronics (PE) PFCDs. Among all PE PFCDs, the Unified Power Flow Controller (UPFC) is the most versatile device. How...

  5. Power Service Shops

    Data.gov (United States)

    Federal Laboratory Consortium — TVA's Power Service Shops provides expert repair and maintenance of power system components and large industrial equipment. With world-class maintenance facilities...

  6. Power amplifier circuit

    NARCIS (Netherlands)

    Takeya, Hideaki; Nauta, Bram

    2015-01-01

    PROBLEM TO BE SOLVED: To provide a power amplifier circuit which has high power efficiency while suppressing a fluctuation of output power relatively to a fluctuation of a power supply voltage in a high-efficiency switching amplifier which operates in a radio frequency band.SOLUTION: A duty ratio

  7. Wind Power Now!

    Science.gov (United States)

    Inglis, David Rittenhouse

    1975-01-01

    The government promotes and heavily subsidizes research in nuclear power plants. Federal development of wind power is slow in comparison even though much research with large wind-electric machines has already been conducted. Unless wind power programs are accelerated it will not become a major energy alternative to nuclear power. (MR)

  8. Distributed Power Flow Controller

    NARCIS (Netherlands)

    Yuan, Z.

    2010-01-01

    In modern power systems, there is a great demand to control the power flow actively. Power flow controlling devices (PFCDs) are required for such purpose, because the power flow over the lines is the nature result of the impedance of each line. Due to the control capabilities of different types of

  9. Atmosphere: Power, Critique, Politics

    DEFF Research Database (Denmark)

    Albertsen, Niels

    2016-01-01

    This paper hans three interrelated parts. First, atmosphere is approached through the concept of power. Atmospheres 'grip' us directly or mediate power indirectly by manipulating moods and evoking emotions. How does atmosphere relate to different conceptions of power? Second, atmospheric powers may...

  10. Tidal power in Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Aisiks, E.G.

    1993-03-01

    This presentation describes the tidal power potential of Argentina and the current status of its utilization. The topics of the presentation include tidal power potential, electric production of the region and the Argentine share of production and consumption, conventional hydroelectric potential, economic feasibility of tidal power production, and the general design and feasibility of a tidal power plant planned for the San Jose Gulf.

  11. The electric power engineering handbook power systems

    CERN Document Server

    2012-01-01

    Power Systems, Third Edition (part of the five-volume set, The Electric Power Engineering Handbook) covers all aspects of power system protection, dynamics, stability, operation, and control. Under the editorial guidance of L.L. Grigsby, a respected and accomplished authority in power engineering, and section editors Andrew Hanson, Pritindra Chowdhuri, Gerry Sheble, and Mark Nelms, this carefully crafted reference includes substantial new and revised contributions from worldwide leaders in the field. This content provides convenient access to overviews and detailed information on a diverse arr

  12. Power Plant Systems Analysis

    Science.gov (United States)

    Williams, J. R.; Yang, Y. Y.

    1973-01-01

    Three basic thermodynamic cycles of advanced nuclear MHD power plant systems are studied. The effect of reactor exit temperature and space radiator temperature on the overall thermal efficiency of a regenerative turbine compressor power plant system is shown. The effect of MHD pressure ratio on plant efficiency is also described, along with the dependence of MHD power output, compressor power requirement, turbine power output, mass flow rate of H2, and overall plant efficiency on the reactor exit temperature for a specific configuration.

  13. Reactive Power Management in Electric Power Systems

    African Journals Online (AJOL)

    The quality of electric power at a supply point can be quantified in terms of how stab)e are the voltage and frequency and how close is the power factor to unity. The continuity of supply and in three-phase systems the degree to which the phase currents and voltages are balanced constitute additional quality parameters.

  14. Power, stability of power, and creativity

    NARCIS (Netherlands)

    Sligte, D.J.; de Dreu, C.K.W.; Nijstad, B.A.

    2011-01-01

    Power hierarchies are an essential aspect of social organization, create stability and social order, and provide individuals with incentives to climb the hierarchical ladder. Extending previous work on power and creativity, we put forward that this relationship critically depends on both the

  15. Power, stability of power, and creativity

    NARCIS (Netherlands)

    Sligte, Daniel J.; de Dreu, Carsten K. W.; Nijstad, Bernard A.

    Power hierarchies are an essential aspect of social organization, create stability and social order, and provide individuals with incentives to climb the hierarchical ladder. Extending previous work on power and creativity, we put forward that this relationship critically depends on both the

  16. Power in Households: Disentangling Bargaining Power

    NARCIS (Netherlands)

    R. Mabsout (Ramzi); I.P. van Staveren (Irene)

    2009-01-01

    textabstractIntroduction Within the household bargaining literature, bargaining power is generally understood in terms of economic resources, such as income or assets. Empirical analyses of women’s bargaining power in households in developed and developing countries find that, in general, higher

  17. Green Power Partnership 100 Green Power Users

    Science.gov (United States)

    EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. Partners on this list use green power to meet 100 of their U.S. organization-wide electricity use.

  18. Active Power Control from Wind Power (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Ela, E.; Brooks, D.

    2011-04-01

    In order to keep the electricity grid stable and the lights on, the power system relies on certain responses from its generating fleet. This presentation evaluates the potential for wind turbines and wind power plants to provide these services and assist the grid during critical times.

  19. Power and revenge.

    Science.gov (United States)

    Strelan, Peter; Weick, Mario; Vasiljevic, Milica

    2014-09-01

    We took an individual differences approach to explain revenge tendencies in powerholders. Across four experimental studies, chronically powerless individuals sought more revenge than chronically powerful individuals following a high power episode (Studies 1 and 2), when striking a powerful pose (Study 3), and when making a powerful hand gesture (Study 4). This relationship vanished when participants were not exposed to incidental power. A meta-analysis revealed that, relative to a lack of power or a neutral context, exposure to incidental power increased vengeance among the chronically powerless and reduced vengeance among the chronically powerful. These findings add to previous research on relations between power and aggression, and underscore the role of individual differences as a determinant of powerholders' destructive responses. © 2013 The British Psychological Society.

  20. Power Electronics for Microgrids

    DEFF Research Database (Denmark)

    Dragicevic, Tomislav; Blaabjerg, Frede

    2016-01-01

    A microgrid (MG) is a stand-alone or grid-connected hybrid renewable system that uses distributed renewable and nonrenewable energy sources and energy storage systems (ESSs) to supply power to local loads. The system is ordinarily based on power electronics, with interface converters allowing...... a continuous supply of power in the presence of variable RES production. This chapter describes some specific features of DC MGs in terms of power architecture, control, and protection. It also reviews several uncommon power electronic interfaces. Regarding control, operation without critical communication...... are explained in this chapter. The chapter concludes with a review of power electronic intensive protection solutions for DC MGs....

  1. Electric power systems

    CERN Document Server

    Weedy, B M; Jenkins, N; Ekanayake, J B; Strbac, G

    2012-01-01

    The definitive textbook for Power Systems students, providing a grounding in essential power system theory while also focusing on practical power engineering applications. Electric Power Systems has been an essential book in power systems engineering for over thirty years. Bringing the content firmly up-to-date whilst still retaining the flavour of Weedy's extremely popular original, this Fifth Edition has been revised by experts Nick Jenkins, Janaka Ekanayake and Goran Strbac. This wide-ranging text still covers all of the fundamental power systems subjects but is now e

  2. Small scale power production

    Energy Technology Data Exchange (ETDEWEB)

    Muoniovaara, M. [IVO International Ltd, Vantaa (Finland)

    1996-12-31

    IVO International is a major constructor of biomass power plants in Finland and abroad. As a subsidiary of Imatran Voima Oy, the largest power utility in Finland, it has designed and constructed ten power plants owned by IVO Group or others capable of burning biomasses. Sizes of the plants vary from the world`s largest condensing peat-fired power plant of 155 MWe to a 6 MWe combined heat and power producing unit. This article describes the biomass power plants designed and constructed by IVO Group 3 refs.

  3. The Turkish power elite

    OpenAIRE

    Arslan, Ali

    2006-01-01

    This study aims to analyse, the general power structure of Turkish society, and specifically the Turkish power elite. Also, the relationships within and between the elite groups, and the distribution of power will be examined. This paper will also try to understand and explain the distribution of power in Turkish society: How far is power (effective power) diffused in society or how far it is centralised and concentrated in the hands of elite groups?    In accordance with the pluralists views...

  4. The Turkish power elite

    OpenAIRE

    Ali Arslan

    2006-01-01

    This study aims to analyse, the general power structure of Turkish society, and specifically the Turkish power elite. Also, the relationships within and between the elite groups, and the distribution of power will be examined. This paper will also try to understand and explain the distribution of power in Turkish society: How far is power (effective power) diffused in society or how far it is centralised and concentrated in the hands of elite groups?    In accordance with the p...

  5. Shipboard electrical power systems

    CERN Document Server

    Patel, Mukund R

    2011-01-01

    Shipboard Electrical Power Systems addresses new developments in this growing field. Focused on the trend toward electrification to power commercial shipping, naval, and passenger vessels, this book helps new or experienced engineers master cutting-edge methods for power system design, control, protection, and economic use of power. Provides Basic Transferable Skills for Managing Electrical Power on Ships or on LandThis groundbreaking book is the first volume of its kind to illustrate optimization of all aspects of shipboard electrical power systems. Applying author Mukund Patel's rare combina

  6. Balancing modern Power System with large scale of wind power

    OpenAIRE

    Basit, Abdul; Altin, Müfit; Hansen, Anca Daniela; Sørensen, Poul Ejnar

    2014-01-01

    Power system operators must ensure robust, secure and reliable power system operation even with a large scale integration of wind power. Electricity generated from the intermittent wind in large propor-tion may impact on the control of power system balance and thus deviations in the power system frequency in small or islanded power systems or tie line power flows in interconnected power systems. Therefore, the large scale integration of wind power into the power system strongly concerns the s...

  7. Power of Writing

    Science.gov (United States)

    ... Power of Writing Request Permissions The Power of Writing June 26, 2014 · Amber Bauer, ASCO staff I ... entries while on the go. Think about making writing a part of your daily routine. Maybe you ...

  8. Spacecraft Power Monitor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR Phase I project will develop the Spacecraft Power Monitor (SPM) which will use non-intrusive electrical monitoring (NEMO). NEMO transforms the power...

  9. Industrial power distribution

    CERN Document Server

    Fehr, Ralph

    2016-01-01

    In this fully updated version of Industrial Power Distribution, the author addresses key areas of electric power distribution from an end-user perspective for both electrical engineers, as well as students who are training for a career in the electrical power engineering field. Industrial Power Distribution, Second Edition, begins by describing how industrial facilities are supplied from utility sources, which is supported with background information on the components of AC power, voltage drop calculations, and the sizing of conductors and transformers. Important concepts and discussions are featured throughout the book including those for sequence networks, ladder logic, motor application, fault calculations, and transformer connections. The book concludes with an introduction to power quality, how it affects industrial power systems, and an expansion of the concept of power factor, including a distortion term made necessary by the existence of harmonic.

  10. Green Power Communities

    Science.gov (United States)

    GPCs are towns, villages, cities, counties, or tribal governments in which the local government, businesses, and residents collectively use green power in amounts that meet or exceed EPA's Green Power Community purchase requirements.

  11. Green Power Partner List

    Science.gov (United States)

    The U.S. EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. There are thousands of Green Power Partners, all listed on this page.

  12. Green Power Markets

    Science.gov (United States)

    The U.S. EPA's Green Power Partnership defines Green power is a subset of renewable energy and represents those renewable energy resources and technologies that provide the highest environmental benefit.

  13. Minnesota Power Settlement

    Science.gov (United States)

    EPA and DOJ announced a Clean Air Act settlement with Minnesota Power, an ALLETE company based in Duluth, that will cover its three coal-fired power plants and one biomass-and-coal-fired steam and electricity cogeneration plan

  14. What Is Green Power?

    Science.gov (United States)

    The U.S. EPA's Green Power Partnership defines Green power is a subset of renewable energy and represents those renewable energy resources and technologies that provide the highest environmental benefit.

  15. Wind Farm Power Forecasting

    OpenAIRE

    Haouas, Nabiha; Bertrand, Pierre R.

    2013-01-01

    Forecasting annual wind power production is useful for the energy industry. Until recently, attention has only been paid to the mean annual wind power energy and statistical uncertainties on this forecasting. Recently, Bensoussan et al. (2012) have pointed that the annual wind power produced by one wind turbine is a Gaussian random variable under a reasonable set of assumptions. Moreover, they can derive both mean and quantiles of annual wind power produced by one wind ...

  16. Power oscillation damping controller

    DEFF Research Database (Denmark)

    2012-01-01

    A power oscillation damping controller is provided for a power generation device such as a wind turbine device. The power oscillation damping controller receives an oscillation indicating signal indicative of a power oscillation in an electricity network and provides an oscillation damping control...... signal in response to the oscillation indicating signal, by processing the oscillation damping control signal in a signal processing chain. The signal processing chain includes a filter configured for passing only signals within a predetermined frequency range....

  17. Power Converters for Accelerators

    CERN Document Server

    Visintini, R.

    2015-06-15

    Particle accelerators use a great variety of power converters for energizing their sub-systems; while the total number of power converters usually depends on the size of the accelerator or combination of accelerators (including the experimental setup), the characteristics of power converters depend on their loads and on the particle physics requirements: this paper aims to provide an overview of the magnet power converters in use in several facilities worldwide.

  18. Solar mobile power supply

    OpenAIRE

    Hu, Libian

    2014-01-01

    The solar mobile power supply is a comprehensive energy saving and environment protective product. Besides, it consists of solar panels, storage battery and controller as well as other important components. Based on the traditional solar charging circuit, this solar power supply combines the 5V USB interface and 12V adjustable circuit as well as the 220V inverter and power adapter to greatly improve the function of the power system.

  19. The Pervasive Power of PowerPoint

    DEFF Research Database (Denmark)

    Schoeneborn, Dennis

    2013-01-01

    This paper examines the pervasive role of Microsoft’s presentation software PowerPoint as a genre of professional and organizational communication. Frequently, PowerPoint is not only used for the primary function it was initially designed for, i.e., facilitating live presentations, but also...... for alternative purposes such as project documentation. Its application in a neighboring domain, however, poses a functional dilemma: does the PowerPoint genre preserve the features of its primary function, i.e., presentation, or rather adapt to the new function, i.e., documentation? By drawing on a communication......-centered perspective, this paper examines PowerPoint’s role in the domain of project documentation as a clash between the constitutive affordances of professional and of organizational communication. To investigate this issue empirically, I conducted a case study at a multinational business consulting firm. The study...

  20. Advanced power cycles for concentrated solar power

    OpenAIRE

    Stein, W. H.; Buck, Reiner

    2017-01-01

    This paper provides a review of advanced power cycles under consideration for CSP. As variable renewables make rapid commercial progress, CSP with thermal energy storage is in an excellent position to provide low cost stability and reliability to the grid, however higher efficiency and lower costs are critical. Steam turbines provide a robust commercial option for today but more advanced power cycles offering greater agility and flexibility are needed. Supercritical steam turbines are attract...

  1. Silicon Power MOSFETs

    Science.gov (United States)

    Lauenstein, Jean-Marie; Casey, Megan; Campola, Michael; Ladbury, Raymond; Label, Kenneth; Wilcox, Ted; Phan, Anthony; Kim, Hak; Topper, Alyson

    2017-01-01

    Recent work for the NASA Electronic Parts and Packaging Program Power MOSFET task is presented. The Task technology focus, roadmap, and partners are given. Recent single-event effect test results on commercial, automotive, and radiation hardened trench power MOSFETs are summarized with an emphasis on risk of using commercial and automotive trench-gate power MOSFETs in space applications.

  2. Power of the Presidency.

    Science.gov (United States)

    Fisher, James L.

    A guide for college presidents is presented that reviews briefly the significant research on leadership and power and discusses each presidential constituency. Attention is directed to the uses and limits of the following types of power in many daily situations: coercive, reward, legitimate, expert, and charismatic. Of these types of power, it is…

  3. Wind power soars

    Energy Technology Data Exchange (ETDEWEB)

    Flavin, C. [Worldwatch Inst., Washington, DC (United States)

    1996-12-31

    Opinions on the world market for wind power are presented in this paper. Some data for global wind power generating capacity are provided. European and other markets are discussed individually. Estimated potential for wind power is given for a number of countries. 3 figs.

  4. Optimization in power systems

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Geraldo R.M. da [Sao Paulo Univ., Sao Carlos, SP (Brazil). Escola de Engenharia

    1994-12-31

    This paper discusses, partially, the advantages and the disadvantages of the optimal power flow. It shows some of the difficulties of implementation and proposes solutions. An analysis is made comparing the power flow, BIGPOWER/CESP, and the optimal power flow, FPO/SEL, developed by the author, when applied to the CEPEL-ELETRONORTE and CESP systems. (author) 8 refs., 5 tabs.

  5. Optical cycle power meter

    DEFF Research Database (Denmark)

    2014-01-01

    A bicycle power meter for measuring power generated when riding a bicycle, the power meter comprising a position-sensitive radiation detector (409) attachable to a component of a crank set (404) of bicycle, and a radiation source (408) attachable to the component of the crank set and configured...

  6. Power Plant Cycling Costs

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, N.; Besuner, P.; Lefton, S.; Agan, D.; Hilleman, D.

    2012-07-01

    This report provides a detailed review of the most up to date data available on power plant cycling costs. The primary objective of this report is to increase awareness of power plant cycling cost, the use of these costs in renewable integration studies and to stimulate debate between policymakers, system dispatchers, plant personnel and power utilities.

  7. Network Power Fault Detection

    OpenAIRE

    Siviero, Claudio

    2013-01-01

    Network power fault detection. At least one first network device is instructed to temporarily disconnect from a power supply path of a network, and at least one characteristic of the power supply path of the network is measured at a second network device connected to the network while the at least one first network device is temporarily disconnected from the network

  8. Powering biomedical devices

    CERN Document Server

    Romero, Edwar

    2013-01-01

    From exoskeletons to neural implants, biomedical devices are no less than life-changing. Compact and constant power sources are necessary to keep these devices running efficiently. Edwar Romero's Powering Biomedical Devices reviews the background, current technologies, and possible future developments of these power sources, examining not only the types of biomedical power sources available (macro, mini, MEMS, and nano), but also what they power (such as prostheses, insulin pumps, and muscular and neural stimulators), and how they work (covering batteries, biofluids, kinetic and ther

  9. Power system relaying

    CERN Document Server

    Horowitz, Stanley H; Niemira, James K

    2013-01-01

    The previous three editions of Power System Relaying offer comprehensive and accessible coverage of the theory and fundamentals of relaying and have been widely adopted on university and industry courses worldwide. With the third edition, the authors have added new and detailed descriptions of power system phenomena such as stability, system-wide protection concepts and discussion of historic outages. Power System Relaying, 4th Edition continues its role as an outstanding textbook on power system protection for senior and graduate students in the field of electric power engineering and a refer

  10. Human Power Empirically Explored

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, A.J.

    2011-01-18

    Harvesting energy from the users' muscular power to convert this into electricity is a relatively unknown way to power consumer products. It nevertheless offers surprising opportunities for product designers; human-powered products function independently from regular power infrastructure, are convenient and can be environmentally and economically beneficial. This work provides insight into the knowledge required to design human-powered energy systems in consumer products from a scientific perspective. It shows the developments of human-powered products from the first introduction of the BayGen Freeplay radio in 1995 till current products and provides an overview and analysis of 211 human-powered products currently on the market. Although human power is generally perceived as beneficial for the environment, this thesis shows that achieving environmental benefit is only feasible when the environmental impact of additional materials in the energy conversion system is well balanced with the energy demands of the products functionality. User testing with existing products showed a preference for speeds in the range of 70 to 190 rpm for crank lengths from 32 to 95 mm. The muscular input power varied from 5 to 21 W. The analysis of twenty graduation projects from the Faculty of Industrial Design Engineering in the field of human-powered products, offers an interesting set of additional practice based design recommendations. The knowledge based approach of human power is very powerful to support the design of human-powered products. There is substantial potential for improvements in the domains energy conversion, ergonomics and environment. This makes that human power, when applied properly, is environmentally and economically competitive over a wider range of applications than thought previously.

  11. Power-functional network

    Science.gov (United States)

    Sun, Yong; Kurths, Jürgen; Zhan, Meng

    2017-08-01

    Power grids and their properties have been studied broadly in many aspects. In this paper, we propose a novel concept, power-flow-based power grid, as a typical power-functional network, based on the calculation of power flow distribution from power electrical engineering. We compare it with structural networks based on the shortest path length and effective networks based on the effective electrical distance and study the relationship among these three kinds of networks. We find that they have roughly positive correlations with each other, indicating that in general any close nodes in the topological structure are actually connected in function. However, we do observe some counter-examples that two close nodes in a structural network can have a long distance in a power-functional network, namely, two physically connected nodes can actually be separated in function. In addition, we find that power grids in the structural network tend to be heterogeneous, whereas those in the effective and power-functional networks tend to be homogeneous. These findings are expected to be significant not only for power grids but also for various other complex networks.

  12. On power and empowerment.

    Science.gov (United States)

    Pratto, Felicia

    2016-03-01

    This study presents a conceptual analysis of social power. The most common theories of power are social-relational, an approach instantiated in a range of contemporary experiments that give participants the chance to control other people's outcomes. The relational approach is also reflected in various analyses of international relations. In comparing and contrasting relational theories of power, I identify logical inconsistencies and shortcomings in their ability to address empowerment and reductions in inequality. In turn, I propose a new ecological conceptualization of empowerment as the state of being able to achieve one's goals and of power as stemming from a combination of the capacity of the party and the affordances of the environment. I explain how this new conceptualization can describe the main kinds of power social relations, avoid logical contradictions, and moreover, distinguish power from agency and from control. This new conceptualization of power as the possibility of meeting goals, coupled with recognizing survival as the fundamental goal of all living things, implies an absolute and not relative or relational standard for power, namely well-being. It also allows us to conceive of power in ways that help address the many social concerns that have motivated research on power. © 2015 The British Psychological Society.

  13. Power flow for spacecraft power systems

    Science.gov (United States)

    Halpin, S. M.; Grigsby, L. L.; Sheble, G. B.; Nelms, R. M.

    1989-01-01

    A method for constructing the generalized system-level admittance matrix for use with a Newton-Raphson power flow is presented. The network modeling technique presented does not use the standard pi-equivalent models, which assume a lossless return path, for the transmission line and transformer. If the return path cannot be assumed lossless, then the standard algorithms for constructing the system admittance matrix cannot be used. The method presented here uses concepts from linear graph theory to combine network modules to form the system-level admittance matrix. The modeling technique is presented, and the resulting matrix is used with a standard Newton-Raphson power flow to calculate all system voltages and current (power) flows.

  14. Power-constrained supercomputing

    Science.gov (United States)

    Bailey, Peter E.

    As we approach exascale systems, power is turning from an optimization goal to a critical operating constraint. With power bounds imposed by both stakeholders and the limitations of existing infrastructure, achieving practical exascale computing will therefore rely on optimizing performance subject to a power constraint. However, this requirement should not add to the burden of application developers; optimizing the runtime environment given restricted power will primarily be the job of high-performance system software. In this dissertation, we explore this area and develop new techniques that extract maximum performance subject to a particular power constraint. These techniques include a method to find theoretical optimal performance, a runtime system that shifts power in real time to improve performance, and a node-level prediction model for selecting power-efficient operating points. We use a linear programming (LP) formulation to optimize application schedules under various power constraints, where a schedule consists of a DVFS state and number of OpenMP threads for each section of computation between consecutive message passing events. We also provide a more flexible mixed integer-linear (ILP) formulation and show that the resulting schedules closely match schedules from the LP formulation. Across four applications, we use our LP-derived upper bounds to show that current approaches trail optimal, power-constrained performance by up to 41%. This demonstrates limitations of current systems, and our LP formulation provides future optimization approaches with a quantitative optimization target. We also introduce Conductor, a run-time system that intelligently distributes available power to nodes and cores to improve performance. The key techniques used are configuration space exploration and adaptive power balancing. Configuration exploration dynamically selects the optimal thread concurrency level and DVFS state subject to a hardware-enforced power bound

  15. Nuclear power generation modern power station practice

    CERN Document Server

    1971-01-01

    Nuclear Power Generation focuses on the use of nuclear reactors as heat sources for electricity generation. This volume explains how nuclear energy can be harnessed to produce power by discussing the fundamental physical facts and the properties of matter underlying the operation of a reactor. This book is comprised of five chapters and opens with an overview of nuclear physics, first by considering the structure of matter and basic physical concepts such as atomic structure and nuclear reactions. The second chapter deals with the requirements of a reactor as a heat source, along with the diff

  16. Balancing modern Power System with large scale of wind power

    DEFF Research Database (Denmark)

    Basit, Abdul; Altin, Müfit; Hansen, Anca Daniela

    2014-01-01

    Power system operators must ensure robust, secure and reliable power system operation even with a large scale integration of wind power. Electricity generated from the intermittent wind in large propor-tion may impact on the control of power system balance and thus deviations in the power system...... frequency in small or islanded power systems or tie line power flows in interconnected power systems. Therefore, the large scale integration of wind power into the power system strongly concerns the secure and stable grid operation. To ensure the stable power system operation, the evolving power system has...... to be analysed with improved analytical tools and techniques. This paper proposes techniques for the active power balance control in future power systems with the large scale wind power integration, where power balancing model provides the hour-ahead dispatch plan with reduced planning horizon and the real time...

  17. A Review of Power Electronics for Wind Power

    DEFF Research Database (Denmark)

    Chen, Zhe

    2011-01-01

    The paper reviews the power electronic applications for wind energy systems. Main wind turbine systems with different generators and power electronic converters are described. The electrical topologies of wind farms with power electronic conversion are discussed. Power electronic applications...

  18. Power distribution arrangement

    DEFF Research Database (Denmark)

    2010-01-01

    An arrangement and a method for distributing power supplied by a power source to two or more of loads (e.g., electrical vehicular systems) is disclosed, where a representation of the power taken by a particular one of the loads from the source is measured. The measured representation of the amount...... of power taken from the source by the particular one of the loads is compared to a threshold to provide an overload signal in the event the representation exceeds the threshold. Control signals dependant on the occurring of the overload signal are provided such that the control signal decreases the output...... power of the power circuit in case the overload signal occurs...

  19. CLIC Detector Power Requirements

    CERN Document Server

    Gaddi, A

    2013-01-01

    An estimate for the CLIC detector power requirements is outlined starting from the available data on power consumptions of the four LHC experiments and considering the differences between a typical LHC Detector (CMS) and the CLIC baseline detector concept. In particular the impact of the power pulsing scheme for the CLIC Detector electronics on the overall detector consumption is considered. The document will be updated with the requirements of the sub-detector electronics once they are more defined.

  20. Electric power annual 1993

    Energy Technology Data Exchange (ETDEWEB)

    1994-12-08

    This report presents a summary of electric power industry statistics at national, regional, and state levels: generating capability and additions, net generation, fossil-fuel statistics, retail sales and revenue, finanical statistics, environmental statistics, power transactions, demand side management, nonutility power producers. Purpose is to provide industry decisionmakers, government policymakers, analysts, and the public with historical data that may be used in understanding US electricity markets.

  1. Power system health analysis

    Energy Technology Data Exchange (ETDEWEB)

    Billinton, Roy; Fotuhi-Firuzabad, Mahmud; Aboreshaid, Saleh

    1997-01-01

    This paper presents a technique which combines both probabilistic indices and deterministic criteria to reflect the well-being of a power system. This technique permits power system planners, engineers and operators to maximize the probability of healthy operation as well as minimizing the probability of risky operation. The concept of system well-being is illustrated in this paper by application to the areas of operating reserve assessment and composite power system security evaluation.

  2. Impact of advanced wind power ancillary services on power system

    DEFF Research Database (Denmark)

    Hansen, Anca Daniela; Altin, Müfit

    The objective of this report is to illustrate and analyse, by means of simulation test cases, the impact of wind power advanced ancillary services, like inertial response (IR), power oscillation damping (POD) and synchronising power (SP) on the power system. Generic models for wind turbine, wind...... power plant and power system are used in the investigation....

  3. Electric power quality

    CERN Document Server

    Chattopadhyay, Surajit; Sengupta, Samarjit

    2011-01-01

    In the present day deregulated power market electric power quality issues have become great concerns of utilities, end users and manufacturers. Worldwide researches are going on to address those issues. Electric Power Quality has evolved from the researches carried out by the authors. The key features of the book can be highlighted as follows: the contents focuses, on one hand, different power quality issues, their sources and effects and different related standards, which are required for students, researchers and practising engineers and, on the other hand, measurement techniques for differe

  4. Water Powered Tools

    Science.gov (United States)

    1976-01-01

    Space Spin-Offs, Inc. under a contract with Lewis Research Center and Marshall Space Flight Center produced a new water-powered saw that cuts through concrete and steel plate reducing danger of explosion or electric shock in rescue and other operations. In prototype unit efficient water-powered turbine drives an 8 inch diameter grinding disk at 6,600 rpm. Exhaust water cools disk and workpiece quenching any sparks produced by cutting head. At maximum power, tool easily cuts through quarter inch steel plate. Adapter heads for chain saws, impact wrenches, heavy duty drills, and power hack saws can be fitted.

  5. Power generation technologies

    CERN Document Server

    Breeze, Paul

    2014-01-01

    The new edition of Power Generation Technologies is a concise and readable guide that provides an introduction to the full spectrum of currently available power generation options, from traditional fossil fuels and the better established alternatives such as wind and solar power, to emerging renewables such as biomass and geothermal energy. Technology solutions such as combined heat and power and distributed generation are also explored. However, this book is more than just an account of the technologies - for each method the author explores the economic and environmental costs and risk factor

  6. Power from Radioisotopes (Rev.)

    Energy Technology Data Exchange (ETDEWEB)

    Corliss, William R; Mead, Robert L

    1971-01-01

    This booklet discusses Systems for Nuclear Auxiliary Power (SNAP), called isotope power generators, that are based on using heat from the decay of radioisotopes to produce electricity. These are the SNAP systems with odd-numbered designators. The basics of radioisotope thermoelectric generators (RTGs) are discussed and their uses as power sources in space exploration and on earth are described. Various radioisotope heat sources are discussed and a table of RTGs built under the SNAP program listing their uses, electrical power, weight, the radioisotope used, the radioisotope's half-life, and the generator life is given.

  7. Can solar power deliver?

    Science.gov (United States)

    Nelson, Jenny; Emmott, Christopher J M

    2013-08-13

    Solar power represents a vast resource which could, in principle, meet the world's needs for clean power generation. Recent growth in the use of photovoltaic (PV) technology has demonstrated the potential of solar power to deliver on a large scale. Whilst the dominant PV technology is based on crystalline silicon, a wide variety of alternative PV materials and device concepts have been explored in an attempt to decrease the cost of the photovoltaic electricity. This article explores the potential for such emerging technologies to deliver cost reductions, scalability of manufacture, rapid carbon mitigation and new science in order to accelerate the uptake of solar power technologies.

  8. Electrical power cable engineering

    CERN Document Server

    Thue, William A

    2011-01-01

    Fully updated, Electrical Power Cable Engineering, Third Edition again concentrates on the remarkably complex design, application, and preparation methods required to terminate and splice cables. This latest addition to the CRC Press Power Engineering series covers cutting-edge methods for design, manufacture, installation, operation, and maintenance of reliable power cable systems. It is based largely on feedback from experienced university lecturers who have taught courses on these very concepts.The book emphasizes methods to optimize vital design and installation of power cables used in the

  9. Improving Power Converter Reliability

    DEFF Research Database (Denmark)

    Ghimire, Pramod; de Vega, Angel Ruiz; Beczkowski, Szymon

    2014-01-01

    The real-time junction temperature monitoring of a high-power insulated-gate bipolar transistor (IGBT) module is important to increase the overall reliability of power converters for industrial applications. This article proposes a new method to measure the on-state collector?emitter voltage...... of a high-power IGBT module during converter operation, which may play a vital role in improving the reliability of the power converters. The measured voltage is used to estimate the module average junction temperature of the high and low-voltage side of a half-bridge IGBT separately in every fundamental...

  10. CSTI High Capacity Power

    Science.gov (United States)

    Winter, Jerry M.

    1989-01-01

    The SP-100 program was established in 1983 by DOD, DOE, and NASA as a joint program to develop the technology necessary for space nuclear power systems for military and civil application. During FY-86 and 87, the NASA SP-100 Advanced Technology Program was devised to maintain the momentum of promising technology advancement efforts started during Phase 1 of SP-100 and to strengthen, in key areas, the chances for successful development and growth capability of space nuclear reactor power systems for future space applications. In FY-88, the Advanced Technology Program was incorporated into NASA's new Civil Space Technology Initiative (CSTI). The CSTI Program was established to provide the foundation for technology development in automation and robotics, information, propulsion, and power. The CSTI High Capacity Power Program builds on the technology efforts of the SP-100 program, incorporates the previous NASA SP-100 Advanced Technology project, and provides a bridge to NASA Project Pathfinder. The elements of CSTI High Capacity Power development include Conversion Systems, Thermal Management, Power Management, System Diagnostics, and Environmental Interactions. Technology advancement in all areas, including materials, is required to assure the high reliability and 7 to 10 year lifetime demanded for future space nuclear power systems. The overall program will develop and demonstrate the technology base required to provide a wide range of modular power systems as well as allowing mission independence from solar and orbital attitude requirements. Several recent advancements in CSTI High Capacity power development will be discussed.

  11. Powerful drivers for maintenance.

    Science.gov (United States)

    Mason, Steve

    2013-10-01

    A UPS system is the central building block of a Power Continuity Plan in medical facilities, but such equipment requires careful maintenance to continue fulfilling its vital role in delivering power resilience, and avoid catastrophic downtime, and potentially tens of thousands of pounds in costs to rectify the issues caused by poor maintenance. In our latest technical guidance article, Steve Mason, MD at Bender UK, one of the leading providers of isolated power supplies, theatre control panels, UPS systems, and Steris surgical products, and a turnkey provider of solutions for safe handling of electrical power and advanced provision of critical care products, examines some of the issue surrounding UPS maintenance.

  12. Memory of Power Transformed

    Directory of Open Access Journals (Sweden)

    Kalina Maleska

    2014-11-01

    Full Text Available This essay is focused on the phenomenon of power. Special attention is paid to the past understanding, research and explanation of what power is, and how it has been understood throughout history. Traditionally, power has referred to authority, influence, control. The research of literary works, however, has led me to the realization that the notion of power is understood in different terms in literature in comparison to how it is explained in philosophy and the social sciences. In order to contribute to the broader understanding of power from a literary point of view, this essay examines many questions concerning this phenomenon, such as: how does the past understanding of power determine how it is accepted and interpreted in the present? How are the success of the present efforts and initiatives affected by the memory of power? The essay attempts to show that the memory of the notion of power is not and cannot be fixed and given once and for all. Therefore, the literary examples provided demonstrate how the definitions of power given in the past are transformed and transfigured by present literary works, which show how we may “forget” what we know about this phenomenon, and define it from a new perspective.

  13. Separation of Powers and the Legislative Power.

    Science.gov (United States)

    Rossum, Ralph A.

    1986-01-01

    Addresses the contribution of separation of powers and checks and balances in resolving the rival defects of democratic ineptitude and majority tyranny as the Founders framed the Constitution. Contends the Founders structured the government so that the three branches could keep each other in their proper places. Discusses Anti- Federalist…

  14. The Power Trading Agent Competition

    NARCIS (Netherlands)

    W. Ketter (Wolfgang); J. Collins (John); P. Reddy (Prashant); C. Flath (Christoph)

    2011-01-01

    textabstractThis is the specification for the Power Trading Agent Competition for 2011 (Power TAC 2011). Agents are simulations of electrical power brokers, who must compete with each other for both power production and consumption, and manage their portfolios.

  15. Power plant chemical technology

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    17 contributions covering topies of fossil fuel combustion, flue gas cleaning, power plant materials, corrosion, water/steam cycle chemistry, monitoring and control were presented at the annual meeting devoted to Power Plant Chemical Technology 1996 at Kolding (Denmark) 4-6 September 1996. (EG)

  16. Economical space power systems

    Science.gov (United States)

    Burkholder, J. H.

    1980-01-01

    A commercial approach to design and fabrication of an economical space power system is investigated. Cost projections are based on a 2 kW space power system conceptual design taking into consideration the capability for serviceability, constraints of operation in space, and commercial production engineering approaches. A breakdown of the system design, documentation, fabrication, and reliability and quality assurance estimated costs are detailed.

  17. Solar Powered Refrigeration System

    Science.gov (United States)

    Ewert, Michael K. (Inventor); Bergeron, David J., III (Inventor)

    2002-01-01

    A solar powered vapor compression refrigeration system is made practicable with thermal storage and novel control techniques. In one embodiment, the refrigeration system includes a photovoltaic panel, a variable speed compressor, an insulated enclosure, and a thermal reservoir. The photovoltaic (PV) panel converts sunlight into DC (direct current) electrical power. The DC electrical power drives a compressor that circulates refrigerant through a vapor compression refrigeration loop to extract heat from the insulated enclosure. The thermal reservoir is situated inside the insulated enclosure and includes a phase change material. As heat is extracted from the insulated enclosure, the phase change material is frozen, and thereafter is able to act as a heat sink to maintain the temperature of the insulated enclosure in the absence of sunlight. The conversion of solar power into stored thermal energy is optimized by a compressor control method that effectively maximizes the compressor's usage of available energy. A capacitor is provided to smooth the power voltage and to provide additional current during compressor start-up. A controller monitors the rate of change of the smoothed power voltage to determine if the compressor is operating below or above the available power maximum, and adjusts the compressor speed accordingly. In this manner, the compressor operation is adjusted to convert substantially all available solar power into stored thermal energy.

  18. Power Curve Measurements

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Vesth, Allan

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine....

  19. Power Curve Measurements, FGW

    DEFF Research Database (Denmark)

    Vesth, Allan; Kock, Carsten Weber

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine....

  20. Power Curve Measurements

    DEFF Research Database (Denmark)

    Villanueva, Héctor; Gómez Arranz, Paula

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...... analyze of power performance of the turbine...

  1. Power Technologies Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, L.

    2002-09-01

    This report, prepared by NREL's Energy Analysis Office, includes up-to-date information on power technologies, including complete technology profiles. The data book also contains charts on electricity restructuring, power technology forecasts and comparisons, electricity supply, electricity capability, electricity generation, electricity demand, prices, economic indicators, environmental indicators, conversion factors, and selected congressional questions and answers.

  2. Definition of Power Converters

    CERN Document Server

    Bordry, F

    2015-01-01

    The paper is intended to introduce power conversion principles and to define common terms in the domain. The concept s of sources and switches are defined and classified. From the basic laws of source interconnections, a generic method of power converter synthesis is presented. Some examples illustrate this systematic method. Finally, the commutation cell and soft commuta tion are introduced and discussedd.

  3. Power and leadership

    DEFF Research Database (Denmark)

    Fogsgaard, Morten Kusk; Elmholdt, Claus Westergård

    2016-01-01

    of this contribution is to emphasize the dynamics of power and leadership relations in organizations. Power is traditionally defined as forms of influence based on the execution of control and sanctions (Hatch 2011; Fogsgaard and Elmholdt 2014). However, in relation to leadership, this definition is insufficient...

  4. Power and environmental assessment

    DEFF Research Database (Denmark)

    Cashmore, Matthew Asa; Richardson, Tim

    2013-01-01

    The significance of politics and power dynamics has long been recognised in environmental assessment (EA) research, but there has not been sustained attention to power, either theoretically or empirically. The aim of this special issue is to encourage the EA community to engage more consistently...

  5. PowerCLI cookbook

    CERN Document Server

    Sellers, Philip

    2015-01-01

    If you are a virtualization professional who wants to unleash the power of automation and combat the complexity of sprawling virtual environments, this book is ideal for you. This book will enhance your skills of administering VMware vSphere and vCloud Director with PowerCLI.

  6. Power and responsibility

    NARCIS (Netherlands)

    Nollkaemper, A.

    2014-01-01

    This paper critically reviews the popular proposition that 'power breeds responsibility'. It first explains why this proposition is intuitively appealing. Particularly in situations where multiple actors contribute to harm, power can be a criterion for determining who of a multitude of actors should

  7. Language, Power and Identity

    Science.gov (United States)

    Wodak, Ruth

    2012-01-01

    How are identities constructed in discourse? How are national and European identities tied to language and communication? And what role does power have--power in discourse, over discourse and of discourse? This paper seeks to identify and analyse processes of identity construction within Europe and at its boundaries, particularly the diversity of…

  8. Nuclear Power Plants. Revised.

    Science.gov (United States)

    Lyerly, Ray L.; Mitchell, Walter, III

    This publication is one of a series of information booklets for the general public published by the United States Atomic Energy Commission. Among the topics discussed are: Why Use Nuclear Power?; From Atoms to Electricity; Reactor Types; Typical Plant Design Features; The Cost of Nuclear Power; Plants in the United States; Developments in Foreign…

  9. Power API Prototype

    Energy Technology Data Exchange (ETDEWEB)

    2014-12-04

    The software serves two purposes. The first purpose of the software is to prototype the Sandia High Performance Computing Power Application Programming Interface Specification effort. The specification can be found at http://powerapi.sandia.gov . Prototypes of the specification were developed in parallel with the development of the specification. Release of the prototype will be instructive to anyone who intends to implement the specification. More specifically, our vendor collaborators will benefit from the availability of the prototype. The second is in direct support of the PowerInsight power measurement device, which was co-developed with Penguin Computing. The software provides a cluster wide measurement capability enabled by the PowerInsight device. The software can be used by anyone who purchases a PowerInsight device. The software will allow the user to easily collect power and energy information of a node that is instrumented with PowerInsight. The software can also be used as an example prototype implementation of the High Performance Computing Power Application Programming Interface Specification.

  10. High Power Vanadate lasers

    CSIR Research Space (South Africa)

    Strauss, HJ

    2006-07-01

    Full Text Available This presentation aims at the following: to develop new techniques to mount laser crystals; compare the laser properties of two equally doped, high power Nd:YVO4 and Nd: GdVO4 lasers; build a 1um vanadate laser with average output power exceeding...

  11. Power without Glory

    DEFF Research Database (Denmark)

    Jørgensen, Kenneth Mølbjerg

    This book is about power and language in organizations. Its purpose is, more specifically, to develop and apply a method for exploring power in organizations where organizations are conceptualized by drawing on Wittgenstein’s concept of language games. The method is genealogy and is closely linked...

  12. Clean power for Galapagos

    Energy Technology Data Exchange (ETDEWEB)

    Tisot, Anthony

    2009-07-01

    In order to protect its sensitive ecosystem, the Galapagos Islands will be discontinuing power generation from fossil fuels by 2015. Wind power will then cover a large part of this demand. The first wind farm has already been set up. (orig.)

  13. Power. Conflicting views.

    Science.gov (United States)

    Heineken, J

    1985-11-01

    This study on power is the first of its kind reported in the nursing literature. We now know that the term "power" has significantly different meanings for nurses. The basic differences found between nurse executives and head and charge nurses with respect to their views on power is a timely finding. Before generalizations and interventions can be definitively suggested, more studies must be done. Nurses interested in participating in this effort should contact the author. The issue of unification of nurses is important. More exploration in the area of power will bring us closer to mobilizing our potential and strength. Nurse executives will be more successful in accomplishing their organizational goals with a united personnel group. The discrepancy in power beliefs identified in this article will create the stimulus for further discussion and reflection.

  14. Resonant High Power Combiners

    CERN Document Server

    Langlois, Michel; Peillex-Delphe, Guy

    2005-01-01

    Particle accelerators need radio frequency sources. Above 300 MHz, the amplifiers mostly used high power klystrons developed for this sole purpose. As for military equipment, users are drawn to buy "off the shelf" components rather than dedicated devices. IOTs have replaced most klystrons in TV transmitters and find their way in particle accelerators. They are less bulky, easier to replace, more efficient at reduced power. They are also far less powerful. What is the benefit of very compact sources if huge 3 dB couplers are needed to combine the power? To alleviate this drawback, we investigated a resonant combiner, operating in TM010 mode, able to combine 3 to 5 IOTs. Our IOTs being able to deliver 80 kW C.W. apiece, combined power would reach 400 kW minus the minor insertion loss. Values for matching and insertion loss are given. The behavior of the system in case of IOT failure is analyzed.

  15. Solar Power on Mars

    Science.gov (United States)

    2005-01-01

    This chart illustrates the variation in available solar power for each of NASA's twin Mars Exploration Rovers over the course of approximately two Mars years. Two factors affect the amount of available power: the tilt of Mars' axis and the eccentricity of the Mars' orbit about the sun. The horizontal scale is the number of Martian days (sols) after the Jan. 4, 2004, (Universal Time) landing of Spirit at Mars' Gusev Crater. The vertical scale on the right indicates the amount of available solar power as a ratio of the amount available at the equator when Mars is closest to the sun (perihelion). The red line indicates power availability at Spirit's landing site (Gusev). The blue line indicates power availability at Opportunity's landing site (Meridiani). The vertical scale on the right applies to the dotted line, indicating the latitude north or south of Mars' equator where the noon sun is overhead at different times of the Martian year.

  16. Nuclear power plant maintainability.

    Science.gov (United States)

    Seminara, J L; Parsons, S O

    1982-09-01

    In the mid-1970s a general awareness of human factors engineering deficiencies associated with power plant control rooms took shape and the Electric Power Research Institute (EPRI) awarded the Lockheed Corporation a contract to review the human factors aspects of five representative operational control rooms and their associated simulators. This investigation revealed a host of major and minor deficiencies that assumed unforeseen dimensions in the post- Three Mile Island accident period. In the course of examining operational problems (Seminara et al, 1976) and subsequently the methods for overcoming such problems (Seminara et al, 1979, 1980) indications surfaced that power plants were far from ideal in meeting the needs of maintenance personnel. Accordingly, EPRI sponsored an investigation of the human factors aspects of power plant maintainability (Seminara, 1981). This paper provides an overview of the maintainability problems and issues encountered in the course of reviewing five nuclear power plants.

  17. Space Nuclear Power Systems

    Science.gov (United States)

    Houts, Michael G.

    2012-01-01

    Fission power and propulsion systems can enable exciting space exploration missions. These include bases on the moon and Mars; and the exploration, development, and utilization of the solar system. In the near-term, fission surface power systems could provide abundant, constant, cost-effective power anywhere on the surface of the Moon or Mars, independent of available sunlight. Affordable access to Mars, the asteroid belt, or other destinations could be provided by nuclear thermal rockets. In the further term, high performance fission power supplies could enable both extremely high power levels on planetary surfaces and fission electric propulsion vehicles for rapid, efficient cargo and crew transfer. Advanced fission propulsion systems could eventually allow routine access to the entire solar system. Fission systems could also enable the utilization of resources within the solar system.

  18. Power module assembly

    Science.gov (United States)

    Campbell, Jeremy B [Torrance, CA; Newson, Steve [Redondo Beach, CA

    2011-11-15

    A power module assembly of the type suitable for deployment in a vehicular power inverter, wherein the power inverter has a grounded chassis, is provided. The power module assembly comprises a conductive base layer electrically coupled to the chassis, an insulating layer disposed on the conductive base layer, a first conductive node disposed on the insulating layer, a second conductive node disposed on the insulating layer, wherein the first and second conductive nodes are electrically isolated from each other. The power module assembly also comprises a first capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the first conductive node, and further comprises a second capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the second conductive node.

  19. KEKB electromagnet power supply

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Masato; Kubo, Tadashi [High Energy Accelerator Research Organization, Tsukuba, Ibaraki (Japan)

    2000-01-01

    Numbers of electromagnet power supply for KEKB are 2,243 except BT. To satisfy stability, DAC in the current control circuit, current detector, R and D of small thermostatic bath and a calibration method of current using CPU were introduced. They satisfied needs. With producing R and D apparatus of switching source, problems of ripple, stability and noise were solved, so that we began mass production. In this paper, many kinds of R and D and performance and troubles after operation of KEKB power source are described. A plan of design of power supply consisted of seven items such as high accuracy, serial communication of interface, small type, high affectivity, easy maintenance, independence of current setting and current detector for monitor and control of radiation and conduction noise of switching power supply. These items were satisfied by development of interface board of ARCNET communication, introduction of double buffer method for interface through CPU, power supply unit by air-cooled method using a switching method and small thermostatic oven for bending and quadrupole electromagnet. R and D of DCCT, burden and shunt resistance, DAC, thermostatic bath, power supply, offset and gain calibration by double buffer method, specification of power supply, various kinds of measurements of mass production apparatus at rising, after long operation and problems before and after operation are reported. The results of R and D made satisfy the specification of stability and ripple of power supply. Although many switching power supply were operated, there was no noise and troubles at the initial period decreased. However, in order to use many power supply, the performance measurement and maintenance are very important at long shut down. (S.Y.)

  20. TEP Power Partners Project [Tucson Electric Power

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-02-06

    The Arizona Governor’s Office of Energy Policy, in partnership with Tucson Electric Power (TEP), Tendril, and Next Phase Energy (NPE), formed the TEP Power Partners pilot project to demonstrate how residential customers could access their energy usage data and third party applications using data obtained from an Automatic Meter Reading (AMR) network. The project applied for and was awarded a Smart Grid Data Access grant through the U.S. Department of Energy. The project participants’ goal for Phase I is to actively engage 1,700 residential customers to demonstrate sustained participation, reduction in energy usage (kWh) and cost ($), and measure related aspects of customer satisfaction. This Demonstration report presents a summary of the findings, effectiveness, and customer satisfaction with the 15-month TEP Power Partners pilot project. The objective of the program is to provide residential customers with energy consumption data from AMR metering and empower these participants to better manage their electricity use. The pilot recruitment goals included migrating 700 existing customers from the completed Power Partners Demand Response Load Control Project (DRLC), and enrolling 1,000 new participants. Upon conclusion of the project on November 19, 2013; 1,390 Home Area Networks (HANs) were registered; 797 new participants installed a HAN; Survey respondents’ are satisfied with the program and found value with a variety of specific program components; Survey respondents report feeling greater control over their energy usage and report taking energy savings actions in their homes after participating in the program; On average, 43 % of the participants returned to the web portal monthly and 15% returned weekly; and An impact evaluation was completed by Opinion Dynamics and found average participant savings for the treatment period1 to be 2.3% of their household use during this period.2 In total, the program saved 163 MWh in the treatment period of 2013.

  1. Inductive power transfer: Powering our future

    Science.gov (United States)

    Covic, Grant A.

    2013-12-01

    The ability to provide power without wires was imagined over a century ago, but assumed commercially impractical and impossible to realise. However for more than two decades the University of Auckland has been at the forefront of developing and commercialising this technology alongside its industrial partners. This research has proven that significant wireless power can be transferred over relatively large air-gaps efficiently and robustly. Early solutions were applied in industrial applications to power moving vehicles in clean room systems, industrial plants, and in theme parks, but more recently this research has helped develop technology that has the ability to impact us directly at home. The seminar will describe some of the early motivations behind this research, and introduce some of the solutions which have been developed by the team of researchers at Auckland over two decades, many of which have found their way into the market. It will also describe how the technology has recently been re-developed to enable battery charging of electric vehicles without the need to plug in, and alongside this how it has the potential to change the way we drive in the future.

  2. Electric power annual 1992

    Energy Technology Data Exchange (ETDEWEB)

    1994-01-06

    The Electric Power Annual presents a summary of electric utility statistics at national, regional and State levels. The objective of the publication is to provide industry decisionmakers, government policymakers, analysts and the general public with historical data that may be used in understanding US electricity markets. The Electric Power Annual is prepared by the Survey Management Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. ``The US Electric Power Industry at a Glance`` section presents a profile of the electric power industry ownership and performance, and a review of key statistics for the year. Subsequent sections present data on generating capability, including proposed capability additions; net generation; fossil-fuel statistics; retail sales; revenue; financial statistics; environmental statistics; electric power transactions; demand-side management; and nonutility power producers. In addition, the appendices provide supplemental data on major disturbances and unusual occurrences in US electricity power systems. Each section contains related text and tables and refers the reader to the appropriate publication that contains more detailed data on the subject matter. Monetary values in this publication are expressed in nominal terms.

  3. Society and Social Power

    Directory of Open Access Journals (Sweden)

    Janani Harish

    2014-10-01

    Full Text Available Society is the source of immense power. Over the past few centuries humanity has record­ed phenomenal growth in its collective capacity for accomplishment, as reflected in the 12-fold growth in global per capita income since 1800. The remarkable achievements in living standards, longevity, science, technology, industry, education, democracy, human rights, peace and global governance are the result of the exponential development of the capacity of society to harness human energies and convert them into social power for productive purposes. Today, humanity possesses the power and capabilities needed to fully meet the multi-dimensional challenges confronting global society. The source of this energy is people. Human energy is transformed into social power by the increasing reach, frequency and complexity of human relationships. Society is a complex living network of organized relationships between people. Its power issues from channelizing our collective energies in productive ways by means of organizing principles such as coordination, systems, specialization of function, hierarchy of authority, and integration. This immense social power remains largely underutilized. Social science needs to evolve a comprehensive, trans-disciplinary understanding of the roots of social power and the process by which it is generated, distributed and applied. This knowledge is the essential foundation for formulating effective social policies capable of eradicating forever persistent poverty, unemployment and social inequality. This article is based on a series of lectures delivered by the author in the WAAS-WUC course on “Toward a Trans-disciplinary Science of Society” at Dubrovnik on September 1-3, 2014. It traces the development of social power in different fields to show that human and social capital are inexhaustible in potential. The more we harness them, the more they grow. Unleashing, directing, channeling and converting human potential into social

  4. Thermoelectric power generator for variable thermal power source

    Science.gov (United States)

    Bell, Lon E; Crane, Douglas Todd

    2015-04-14

    Traditional power generation systems using thermoelectric power generators are designed to operate most efficiently for a single operating condition. The present invention provides a power generation system in which the characteristics of the thermoelectrics, the flow of the thermal power, and the operational characteristics of the power generator are monitored and controlled such that higher operation efficiencies and/or higher output powers can be maintained with variably thermal power input. Such a system is particularly beneficial in variable thermal power source systems, such as recovering power from the waste heat generated in the exhaust of combustion engines.

  5. Electric power substations engineering

    CERN Document Server

    McDonald, John D

    2012-01-01

    The use of electric power substations in generation, transmission, and distribution remains one of the most challenging and exciting areas of electric power engineering. Recent technological developments have had a tremendous impact on all aspects of substation design and operation. With 80% of its chapters completely revised and two brand-new chapters on energy storage and Smart Grids, Electric Power Substations Engineering, Third Edition provides an extensive updated overview of substations, serving as a reference and guide for both industry and academia. Contributors have written each chapt

  6. Managing Functional Power

    DEFF Research Database (Denmark)

    Rosenstand, Claus Andreas Foss; Laursen, Per Kyed

    2013-01-01

    to the product quality. The area of interest is the vision driven digital media industry in general; however, the point of departure is the game industry due to its aesthetic complexity. The article's contribution to the area is a power graph, which shows the functional power of the leading functions according...... to a general digital media creation cycle. This is used to point out potential power conflicts and their consequences. It is concluded that there is normally more conflict potential in vision driven digital media creation than in digital media creation in general or in software development. The method...

  7. Play and Power

    DEFF Research Database (Denmark)

    The power of play, so central to psychoanalytic theory and practice, is conjoined to the social psychological or socio-politically coloured concept of power, giving rise to many fruitful discussions of how these concepts manifest themselves in clinical work with children, groups and adults...... with children and adults and from group analysis. Most of the examples are with hateful or resigned children and adults who have been exposed to extremely damaging or unhelpful environments, and who demonstrate convincingly some of the devastating consequences that abuse of power in the real world may have...

  8. Teaching power concepts.

    Science.gov (United States)

    Heineken, J; McCloskey, J C

    1985-01-01

    Concepts and strategies presented here provide nurses with a new perspective from which to analyze and interact with power dynamics. Understanding fundamental concepts of power will help nurses enjoy a more equal status and bargaining position within the community of health professionals and in health care delivery systems. As nurses integrate and utilize this content for enhancing professional practices and client services, our public image will also continue to be strengthened. In so doing, our power base and sphere of influence will also be broadened.

  9. Hekinan thermal power station

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-12-31

    Hekinan thermal power station is situated at the port of Kinuura in Aichi Prefecture, Japan. Unit 1 began commercial operation in October 1991, Unit 2 in June 1992 and Unit 3 in April 1993. This brochure gives the specification of the main facilities of the power station, shows its layout; illustrates its pollution control equipment, gives specifications of its flue gas treatment systems and of its large steam turbine, describes its coal handling facilities and gives their specifications, and mentions the power station`s automated control system.

  10. Wind power prediction models

    Science.gov (United States)

    Levy, R.; Mcginness, H.

    1976-01-01

    Investigations were performed to predict the power available from the wind at the Goldstone, California, antenna site complex. The background for power prediction was derived from a statistical evaluation of available wind speed data records at this location and at nearby locations similarly situated within the Mojave desert. In addition to a model for power prediction over relatively long periods of time, an interim simulation model that produces sample wind speeds is described. The interim model furnishes uncorrelated sample speeds at hourly intervals that reproduce the statistical wind distribution at Goldstone. A stochastic simulation model to provide speed samples representative of both the statistical speed distributions and correlations is also discussed.

  11. The Kuroshio power plant

    CERN Document Server

    Chen, Falin

    2013-01-01

    By outlining a new design or the Kuroshio power plant, new approaches to turbine design, anchorage system planning, deep sea marine engineering and power plant operations and maintenance are explored and suggested. The impact on the local environment, particularly in the face of natural disasters, is also considered to provide a well rounded introduction to plan and build a 30MW pilot power plant. Following a literature review, the six chapters of this book propose a conceptual design by focusing on the plant's core technologies and establish the separate analysis logics for turbine design and

  12. Power system state estimation

    CERN Document Server

    Ahmad, Mukhtar

    2012-01-01

    State estimation is one of the most important functions in power system operation and control. This area is concerned with the overall monitoring, control, and contingency evaluation of power systems. It is mainly aimed at providing a reliable estimate of system voltages. State estimator information flows to control centers, where critical decisions are made concerning power system design and operations. This valuable resource provides thorough coverage of this area, helping professionals overcome challenges involving system quality, reliability, security, stability, and economy.Engineers are

  13. Power quality load management for large spacecraft electrical power systems

    Science.gov (United States)

    Lollar, Louis F.

    1988-01-01

    In December, 1986, a Center Director's Discretionary Fund (CDDF) proposal was granted to study power system control techniques in large space electrical power systems. Presented are the accomplishments in the area of power system control by power quality load management. In addition, information concerning the distortion problems in a 20 kHz ac power system is presented.

  14. Electronic Power Transformer for Power Distribution Networks

    Directory of Open Access Journals (Sweden)

    Ermuraсhi Iu.V.

    2017-12-01

    Full Text Available Reducing losses in electricity distribution networks is a current technical problem. This issue also has social and environmental aspects. As a promising solution one can examine the direct distribution from the medium voltage power network using new equipment based on the use of power electronics. The aim of the paper is to propose and argue an innovative technical solution for the realization of the Solid State Transformer (SST in order to decrease the number of energy transformation stages compared to the known solutions, simplifying the topology of the functional scheme with the reduction of production costs and the loss of energy in transformers used in electrical distribution networks. It is proposed the solution of simplifying the topology of the AC/AC electronic transformer by reducing the number of passive electronic components (resistors, inductors, capacitors and active (transistors. The inverter of the SST transformer ensures the switching mode of the transistors, using for this purpose the inductance of the magnetic leakage flux of the high frequency transformer. The robustness of the laboratory sample of the SST 10 / 0.22 kV transformer with the power of 20 kW was manufactured and tested. Testing of the laboratory sample confirmed the functionality of the proposed scheme and the possibility of switching of the transistors to at zero current (ZCS mode with the reduction of the energy losses. In the proposed converter a single high-frequency transformer with a simplified construction with two windings is used, which reduces its mass and the cost of making the transformer. The reduction in the manufacturing cost of the converter is also due to the decrease in the number of links between the functional elements.

  15. Structural power flow measurement

    Energy Technology Data Exchange (ETDEWEB)

    Falter, K.J.; Keltie, R.F.

    1988-12-01

    Previous investigations of structural power flow through beam-like structures resulted in some unexplained anomalies in the calculated data. In order to develop structural power flow measurement as a viable technique for machine tool design, the causes of these anomalies needed to be found. Once found, techniques for eliminating the errors could be developed. Error sources were found in the experimental apparatus itself as well as in the instrumentation. Although flexural waves are the carriers of power in the experimental apparatus, at some frequencies longitudinal waves were excited which were picked up by the accelerometers and altered power measurements. Errors were found in the phase and gain response of the sensors and amplifiers used for measurement. A transfer function correction technique was employed to compensate for these instrumentation errors.

  16. Power and Welfare

    DEFF Research Database (Denmark)

    Mik-Meyer, Nanna; Villadsen, Kaspar

    approaches, their weaknesses and indicates some possibilities of theoretical integration. Including case studies of patients, nursing home residents, unemployed people, homeless people, and young offenders, from the USA, Denmark, France, Sweden, Canada, and Australia, Power and Welfare is designed...

  17. Power and welfare

    DEFF Research Database (Denmark)

    Mik-Meyer, Nanna; Villadsen, Kasper

    approaches, their weaknesses and indicates some possibilities of theoretical integration. Including case studies of patients, nursing home residents, unemployed people, homeless people, and young offenders, from the USA, Denmark, France, Sweden, Canada, and Australia, Power and Welfare is designed...

  18. On Student Power

    Science.gov (United States)

    Lewy, Guenter; Rothman, Stanley

    1970-01-01

    Beleaguered administrators and faculty who submit to student power" as a way of defusing student unrest and an indication of educational reform are compromising their authority and the future of democratic education. (IR)

  19. Economical Radioisotope Power Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Almost all robotic space exploration missions and all Apollo missions to the moon used Radioisotopic Thermoelectric Generators (RTGs) to provide electrical power to...

  20. Prognostics of Power MOSFET

    Data.gov (United States)

    National Aeronautics and Space Administration — This paper demonstrates how to apply prognostics to power MOSFETs (metal oxide field effect transistor). The methodology uses thermal cycling to age devices and...

  1. The Power of Small

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 12. The Power of Small: Championing the Underdogs of Modern Medicine. Suvasini Ramaswamy Anirban Mitra. General Article Volume 20 Issue 12 December 2015 pp 1136-1153 ...

  2. MHD Power Generation

    Science.gov (United States)

    Kantrowitz, Arthur; Rosa, Richard J.

    1975-01-01

    Explains the operation of the Magnetohydrodynamic (MHD) generator and advantages of the system over coal, oil or nuclear powered generators. Details the development of MHD generators in the United States and Soviet Union. (CP)

  3. Offshore Wind Power

    DEFF Research Database (Denmark)

    Negra, Nicola Barberis

    The aim of the project is to investigate the influence of wind farms on the reliability of power systems. This task is particularly important for large offshore wind farms, because failure of a large wind farm might have significant influence on the balance of the power system, and because offshore...... Carlo simulation is used for these calculations: this method, in spite of an extended computation time, has shown flexibility in performing reliability studies, especially in case of wind generation, and a broad range of results which can be evaluated. The modelling is then extended to the entire power...... system considering conventional power plants, distributed generation based on wind energy and CHP technology as well as the load and transmission facilities. In particular, the different models are used to represent two well-known test systems, the RBTS and the IEEE-RTS, and to calculate...

  4. Offshore Wind Power Data

    DEFF Research Database (Denmark)

    Cutululis, Nicolaos Antonio; Litong-Palima, Marisciel; Zeni, Lorenzo

    2012-01-01

    Wind power development scenarios are critical when trying to assess the impact of the demonstration at national and European level. The work described in this report had several objectives. The main objective was to prepare and deliver the proper input necessary for assessing the impact of Demo 4...... – Storm management at national and European level. For that, detailed scenarios for offshore wind power development by 2020 and 2030 were required. The aggregation level that is suitable for the analysis to be done is at wind farm level. Therefore, the scenarios for offshore wind power development offer...... details about the wind farms such as: capacity and coordinates. Since the focus is on the impact of storm fronts passage in Northen Europe, the offshore wind power scenarios were estimated only for the countries at North and Baltic Sea. The sources used are public sources, mentioned in the reference list...

  5. Wind power forecast

    Energy Technology Data Exchange (ETDEWEB)

    Pestana, Rui [Rede Electrica Nacional (REN), S.A., Lisboa (Portugal). Dept. Systems and Development System Operator; Trancoso, Ana Rosa; Delgado Domingos, Jose [Univ. Tecnica de Lisboa (Portugal). Seccao de Ambiente e Energia

    2012-07-01

    Accurate wind power forecast are needed to reduce integration costs in the electric grid caused by wind inherent variability. Currently, Portugal has a significant wind power penetration level and consequently the need to have reliable wind power forecasts at different temporal scales, including localized events such as ramps. This paper provides an overview of the methodologies used by REN to forecast wind power at national level, based on statistical and probabilistic combinations of NWP and measured data with the aim of improving accuracy of pure NWP. Results show that significant improvement can be achieved with statistical combination with persistence in the short-term and with probabilistic combination in the medium-term. NWP are also able to detect ramp events with 3 day notice to the operational planning. (orig.)

  6. Solar Power Use Claims

    Science.gov (United States)

    The U.S. EPA's Green Power Partnership is a voluntary program designed to reduce the environmental impact of electricity generation by promoting renewable energy. EPA evaluates partnership metrics annually to determine progress toward programmatic goals.

  7. Electric Power Transmission Lines

    Data.gov (United States)

    Department of Homeland Security — Transmission Lines are the system of structures, wires, insulators and associated hardware that carry electric energy from one point to another in an electric power...

  8. Balancing trust and power

    DEFF Research Database (Denmark)

    Broholm-Jørgensen, Marie; Guassora, Ann Dorrit; Reventlow, Susanne

    2017-01-01

    from the GPs' perspectives, and in what way trust and power affect and/or challenge strategies towards retaining patients without formal education. DESIGN: Data in this study were obtained through semi-structured interviews with GPs participating in an intervention project, as well as observations......OBJECTIVE: Little is known about how strategies of retaining patients are acted out by general practitioners (GPs) in the clinical encounter. With this study, we apply Grimens' (2009) analytical connection between trust and power to explore how trust and power appear in preventive health checks...... of power in the encounter. The GPs articulated that a balance was needed in preventive health checks in order to establish trust and thus retain the patient in the clinic. One way this balance of respect was carried out was with the use of humour. CONCLUSIONS: To retain patients without formal education...

  9. Danish Wind Power

    DEFF Research Database (Denmark)

    Lund, Henrik; Hvelplund, Frede; Østergaard, Poul Alberg

    In a normal wind year, Danish wind turbines generate the equivalent of approx. 20 percent of the Danish electricity demand. This paper argues that only approx. 1 percent of the wind power production is exported. The rest is used to meet domestic Danish electricity demands. The cost of wind power...... is paid solely by the electricity consumers and the net influence on consumer prices was as low as 1-3 percent on average in the period 2004-2008. In 2008, the net influence even decreased the average consumer price, although only slightly. In Denmark, 20 percent wind power is integrated by using both......, a study made by the Danish think tank CEPOS claimed the opposite, i.e. that most of the Danish wind power has been exported in recent years. However, this claim is based on an incorrect interpretation of statistics and a lack of understanding of how the international electricity markets operate...

  10. Philippines revises power plans

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, D.

    1988-02-01

    Following an unexpected surge in electricity demand the Philippines has revised its medium term power development programme. The sharp increase in electricity consumption follows three years of slack demand due to civil disturbances before the end of the Macros administration and the election of Corazon Aquino as President in 1986. Originally, the Aquino government's medium term power development plans called for about 500MW of generating capacity to be installed between 1986 and 1992. The three proposed plants were scheduled for commissioning in 1991 and 1992. However, a spurt in power demand growth during the past nine months has caused concern among industrialists that power shortages could occur by the end of the decade. So additional capacity will be installed to prevent an anticipated shortfall in electricity supplies by the early 1990s.

  11. Radioisotope Power Supply Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Between 1998 and 2003, Hi-Z Technology developed and built a 40 mW radioisotope power supply (RPS) that used a 1 watt radioisotope heater unit (RHU) as the energy...

  12. High Power Electronics

    Science.gov (United States)

    Pendharker, Sameer

    High Power Electronics Future Trends: New process, circuit and packaging technologies over the last 5 years have led to significant innovation and technological developments in high power electronics. In this topic, the trends and performance improvements achieved in the industry will be discussed with focus on gallium-nitride (GaN) and silicon carbide (SiC). Both GaN and SiC technologies have been around for many years but have seen limited adoption and proliferation in high power systems. With the improved transistor performance, power conversion efficiencies and densities previously unrealizable are now available leading to new applications and new system. Trends in these technologies will also be reviewed and remaining challenges to overcome before true mass market adoption can be expected.

  13. Wind Power in Georgia

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-11-01

    Georgia has good wind power potential. Preliminary analyses show that the technical wind power potential in Georgia is good. Meteorological data shows that Georgia has four main areas in Georgia with annual average wind speeds of over 6 m/s and two main areas with 5-6 m/s at 80m. The most promising areas are the high mountain zone of the Great Caucasus, The Kura river valley, The South-Georgian highland and the Southern part of the Georgian Black Sea coast. Czech company Wind Energy Invest has recently signed a Memorandum of Understanding with Georgian authorities for development of the first wind farm in Georgia, a 50MW wind park in Paravani, Southern Georgia, to be completed in 2014. Annual generation is estimated to 170.00 GWh and the investment estimated to 101 million US$. Wind power is suited to balance hydropower in the Georgian electricity sector Electricity generation in Georgia is dominated by hydro power, constituting 88% of total generation in 2009. Limited storage capacity and significant spring and summer peaks in river flows result in an uneven annual generation profile and winter time shortages that are covered by three gas power plants. Wind power is a carbon-free energy source well suited to balance hydropower, as it is available (often strongest) in the winter and can be exported when there is a surplus. Another advantage with wind power is the lead time for the projects; the time from site selection to operation for a wind power park (approximately 2.5 years) is much shorter than for hydro power (often 6-8 years). There is no support system or scheme for renewable sources in Georgia, so wind power has to compete directly with other energy sources and is in most cases more expensive to build than hydro power. In a country and region with rapidly increasing energy demands, the factors described above nevertheless indicate that there is a commercial niche and a role to play for Georgian wind power. Skra: An example of a wind power development

  14. Power conversion technologies

    Energy Technology Data Exchange (ETDEWEB)

    Newton, M. A.

    1997-02-01

    The Power Conversion Technologies thrust area identifies and sponsors development activities that enhance the capabilities of engineering at Lawrence Livermore National Laboratory (LLNL) in the area of solid- state power electronics. Our primary objective is to be a resource to existing and emerging LLNL programs that require advanced solid-state power electronic technologies.. Our focus is on developing and integrating technologies that will significantly impact the capability, size, cost, and reliability of future power electronic systems. During FY-96, we concentrated our research efforts on the areas of (1) Micropower Impulse Radar (MIR); (2) novel solid-state opening switches; (3) advanced modulator technology for accelerators; (4) compact accelerators; and (5) compact pulse generators.

  15. Power in Practice

    DEFF Research Database (Denmark)

    Adler-Nissen, Rebecca; Pouliot, Vincent

    2014-01-01

    . In this article we develop a framework to grasp the concrete workings of power in international politics. The notion of “emergent power” bridges two different understandings of power: as capability or relation. Emergent power refers to the generation and deployment of endogenous resources – social skills......How does power work in practice? Much of the “stuff” that state agents and other international actors do, on an everyday basis, remains impenetrable to existing IR theory. This is unfortunate, as the everyday performance of international practices actually helps shape world policy outcomes...... and competences – generated in particular practices. The framework is illustrated with an in-­‐depth analysis of the multilateral diplomatic process that led to 2011 international intervention in Libya. Through a detailed account of the negotiations at the UN, NATO and the EU, the article demonstrates how...

  16. Space Power Facility (SPF)

    Data.gov (United States)

    Federal Laboratory Consortium — The Space Power Facility (SPF) houses the world's largest space environment simulation chamber, measuring 100 ft. in diameter by 122 ft. high. In this chamber, large...

  17. Focusing America's National Powers

    National Research Council Canada - National Science Library

    Kabana, Dana P

    2006-01-01

    .... The National Security Counsel (NSC) should modify its efforts to take full advantage of all sources of power to ensure national security by first establishing the NSC/Deputies Committee as the element mandated to manage the interagency process...

  18. Developments in tidal power

    Science.gov (United States)

    Charlier, R. H.

    Successful, planned, and potential tidal power plants and sites are discussed. Units are in operation in France and Russia, with the French plant using reversible blade turbines being used as a design guide for plants in Argentina and Australia. The U.S. is studying the feasibility of a plant in Passamaquaddy Bay, and Canada is pursuing construction of a plant in the Bay of Fundy. The Severn River in Great Britain is receiving a site study, and over a hundred plants have been built as local power systems in China. Bulb-type turbines, which enhance the volume emptying and filling the retaining basin, are considered as the highest performing power unit. Simpler one-way flow turbines have been suggested as more economical to install. Governmental, institutional, and investor impediments to tidal power plant are explored.

  19. Power Curve Measurements FGW

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Villanueva, Héctor

    This report describes power curve measurements carried out on a given turbine in a chosen period. The measurements are carried out in accordance to IEC 61400-12-1 Ed. 1 and FGW Teil 2.......This report describes power curve measurements carried out on a given turbine in a chosen period. The measurements are carried out in accordance to IEC 61400-12-1 Ed. 1 and FGW Teil 2....

  20. Foundation trusts. Power sharing.

    Science.gov (United States)

    Jobanputra, Renu; Buchan, James

    2003-05-01

    Foundation trusts will in theory have greater freedoms over pay, non-pay rewards and recruitment, although details are still unclear. Foundations are likely to differ in their use of these powers, partly because of desire and partly because of practical limits. Taking advantage of new powers for short-term gain, at the expense of other trusts, will have negative effects if not part of a wider development of HR practice.

  1. Village power in Thailand

    Energy Technology Data Exchange (ETDEWEB)

    Bergey, M.

    1997-12-01

    This paper presents an overview of the electric power system in Thailand. 99% of the country is electrified, but much of this is with diesel generators which leaves high costs but a high level of service. The paper discusses renewable energy projects which have been sited in the country, and examples of hybrid systems which have been retrofit into existing diesel generator systems. Photovoltaic and hydroelectric power projects are described. Dedicated systems have been installed for water pumping and battery charging applications.

  2. Printed battery power management

    OpenAIRE

    Josefsson, Magnus

    2015-01-01

    Printed electronics and low power radio has evolved significantly in recent years. This has made it possible to implement electronic worn on the body or clothing. Printed batteries internal resistance is much higher compared to regular batteries. Unless a battery power management circuit is used, the radio peak current makes that the terminal voltage may drop to a level below the specified supply voltage for the radio, causing operation failure. A large capacitor solves this but a large surfa...

  3. Power transformers quality assurance

    CERN Document Server

    Dasgupta, Indrajit

    2009-01-01

    About the Book: With the view to attain higher reliability in power system operation, the quality assurance in the field of distribution and power transformers has claimed growing attention. Besides new developments in the material technology and manufacturing processes of transformers, regular diagnostic testing and maintenance of any engineering product may be ascertained by ensuring: right selection of materials and components and their quality checks. application of correct manufacturing processes any systems engineering. the user`s awareness towards preventive maintenance. The

  4. Power vacuum tubes handbook

    CERN Document Server

    Whitaker, Jerry

    2012-01-01

    Providing examples of applications, Power Vacuum Tubes Handbook, Third Edition examines the underlying technology of each type of power vacuum tube device in common use today. The author presents basic principles, reports on new development efforts, and discusses implementation and maintenance considerations. Supporting mathematical equations and extensive technical illustrations and schematic diagrams help readers understand the material. Translate Principles into Specific Applications This one-stop reference is a hands-on guide for engineering personnel involved in the design, specification,

  5. Enabling Wind Power Nationwide

    Energy Technology Data Exchange (ETDEWEB)

    Jose Zayas, Michael Derby, Patrick Gilman and Shreyas Ananthan,

    2015-05-01

    Leveraging this experience, the U.S. Department of Energy’s (DOE’s) Wind and Water Power Technologies Office has evaluated the potential for wind power to generate electricity in all 50 states. This report analyzes and quantifies the geographic expansion that could be enabled by accessing higher above ground heights for wind turbines and considers the means by which this new potential could be responsibly developed.

  6. Power plants to go

    Energy Technology Data Exchange (ETDEWEB)

    Valenti, M.

    1996-05-01

    Simple-cycle portable power stations have been used to increase the electrical capacity in developing countries and in emergency situations. This article describes the first power barge using combined-cycle technology which has began operation in the Dominican Republic. The construction of a new mobile power plant in Puerto Plata, the Dominican Republic, marks the first time a power barge has been coupled with the efficiency of combined-cycle generation. The 185-megawatt plant, which became fully operational in January, provides 25% of the power required by the Dominican state-owned utility, the Corporacion Dominicana de Electricidad (CDE). The new plant is designed to end the power shortages and blackouts that have traditionally plagued the Caribbean nation. The Puerto Plata plant consists of two barges that were built in the US, transported to the Dominican Republic, installed, and backfilled into place. One barge, delivered in May 1994, contains a 76-megawatt gas turbine. The second barge, installed in April 1995, contains a 45-megawatt heat-recovery steam generator to recover heat energy from the turbine exhaust, two auxiliary boilers to produce additional steam, and a 118-megawatt steam-turbine generator.

  7. Low power interconnect design

    CERN Document Server

    Saini, Sandeep

    2015-01-01

    This book provides practical solutions for delay and power reduction for on-chip interconnects and buses.  It provides an in depth description of the problem of signal delay and extra power consumption, possible solutions for delay and glitch removal, while considering the power reduction of the total system.  Coverage focuses on use of the Schmitt Trigger as an alternative approach to buffer insertion for delay and power reduction in VLSI interconnects. In the last section of the book, various bus coding techniques are discussed to minimize delay and power in address and data buses.   ·         Provides practical solutions for delay and power reduction for on-chip interconnects and buses; ·         Focuses on Deep Sub micron technology devices and interconnects; ·         Offers in depth analysis of delay, including details regarding crosstalk and parasitics;  ·         Describes use of the Schmitt Trigger as a versatile alternative approach to buffer insertion for del...

  8. Powering the Future

    Science.gov (United States)

    2002-01-01

    Stirling Technology Company (STC) developed the RG-350 convertor using components from separate Goddard Space Center and U.S. Army Natick SBIR contracts. Based on the RG-350, STC commercialized a product line of Stirling cycle generator sets, known as RemoteGen(TM), with power levels ranging from 10We to 3kWe. Under SBIR agreements with Glenn Research Center, the company refined and extended the capabilities of the RemoteGen convertors. They can provide power in remote locations by efficiently producing electricity from multiple-fuel sources, such as propane, alcohol, gasoline, diesel, coal, solar energy, or wood pellets. Utilizing any fuel source that can create heat, RemoteGen enables the choice of the most appropriate fuel source available. The engines operate without friction, wear, or maintenance. These abilities pave the way for self-powered appliances, such as refrigerators and furnaces. Numerous applications for RemoteGen include quiet, pollution-free generators for RVs and yachts, power for cell phone towers remote from the grid, and off-grid residential power variously using propane, ethanol, and solid biomass fuels. One utility and the National Renewable Energy Laboratory are evaluating a solar dish concentrator version with excellent potential for powering remote irrigation pumps.

  9. New power quality indices

    Energy Technology Data Exchange (ETDEWEB)

    Leonowicz, Z. [Wroclaw Univ. of Technology, Wroclaw (Poland). Dept. of Electrical Engineering

    2007-07-01

    The proliferation of nonlinear loads connected to power systems has led to growing concerns about power quality. This study used a high-resolution spectrum estimation method to measure the spectral parameters of distorted waveforms encountered in power systems. Power quality indices were developed using the method, and the frequency and amplitude estimation errors were compared with errors obtained using Fourier-based techniques. The root multiple signal classification (MUSIC) method used an estimated covariance matrix to compute the signal zeros from the power system. The MUSIC method was compared with the estimation of signal parameters via rotational invariance technique (ESPRIT), which used the naturally existing shift invariance between discrete time series that resulted in rotational invariance between corresponding signal subspaces. The study demonstrated that the main sources of errors using ESPRIT occurred in estimates of the matrix. Matrix errors cause errors in eigenvalue estimations, which can in turn be regarded as a performance index of ESPRIT. The mean square error method was computed. The study showed that the ESPRIT method was faster during shorter data runs, but became slower than the MUSIC method as data lengths increased. The study also demonstrated that higher values obtained using Fourier-based techniques were caused by spectral leakage. It was concluded that parametric spectral estimation methods can be used to accurately analyze waveforms in power systems. 18 refs., 5 figs.

  10. Solar Panel Maximum Power Point Tracker for Power Utilities

    National Research Council Canada - National Science Library

    Sandeep Banik; Dr P.K.Saha

    2014-01-01

    ―Solar Panel Maximum Power Point Tracker For power utilities‖ As the name implied, it is a photovoltaic system that uses the photovoltaic array as a source of electrical power supply and since every photovoltaic (PV...

  11. Power electronics and control for wind power systems

    DEFF Research Database (Denmark)

    Iov, Florin; Blaabjerg, Frede

    2009-01-01

    the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. Another is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most emerging...... renewable energy sources, wind energy, which by means of power electronics are changing from being minor energy sources to be acting as important power sources in the electrical network....

  12. Wind farm - A power source in future power systems

    DEFF Research Database (Denmark)

    Chen, Zhe; Blaabjerg, Frede

    2009-01-01

    The paper describes modern wind power systems, introduces the issues of large penetration of wind power into power systems, and discusses the possible methods of making wind turbines/farms act as a power source, like conventional power plants in power systems. Firstly, the paper describes modern...... wind turbines and wind farms, and then introduces the wind power development and wind farms. An optimization platform for designing electrical systems of offshore wind farms is briefed. The major issues related to the grid connection requirements and the operation of wind turbines/farms in power...

  13. Wind power plant system services

    DEFF Research Database (Denmark)

    Basit, Abdul; Altin, Müfit

    Traditionally, conventional power plants have the task to support the power system, by supplying power balancing services. These services are required by the power system operators in order to secure a safe and reliable operation of the power system. However, as in the future the wind power...... is going more and more to replace conventional power plants, the sources of conventional reserve available to the system will be reduced and fewer conventional plants will be available on-line to share the regulation burden. The reliable operation of highly wind power integrated power system might...... then beat risk unless the wind power plants (WPPs) are able to support and participate in power balancing services. The objective of this PhD project is to develop and analyse control strategies which can increase the WPPs capability to provide system services, such as active power balancing control...

  14. War Powers Resolution: Presidential Compliance

    National Research Council Canada - National Science Library

    Grimmett, Richard F

    2009-01-01

    .... One issue concerns the division of war powers between the President and Congress, whether the use of armed forces falls within the purview of the congressional power to declare war and the War Powers Resolution (WPR...

  15. The Discourse of the Power

    OpenAIRE

    Adina Elena Sandu; Ciprian Roscaneanu

    2016-01-01

    Power it's in the middle of the international system. The behavior of each state and the dynamism of the international system rise in the structure and the distribution of the global power. Power represents the keystone of the international relationships. All the realistic theories consider that the worries about power, the balance of the power, the dynamism of the power, represents the engine of the international business. Also, it represents a basic instrument, if it isn’t the o...

  16. Beloyarsk Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-08-01

    The Beloyarsk Nuclear Power Plant (BNPP) is located in Zarechny, approximately 60 km east of Ekaterinberg along the Trans-Siberian Highway. Zarechny, a small city of approximately 30,000 residents, was built to support BNPP operations. It is a closed city to unescorted visitors. Residents must show identification for entry. BNPP is one of the first and oldest commercial nuclear power plants in Russia and began operations in 1964. As for most nuclear power plants in the Russian Federation, BNPP is operated by Rosenergoatom, which is subordinated to the Ministry of Atomic Energy of the Russian Federation (Minatom). BNPP is the site of three nuclear reactors, Units 1, 2, and 3. Units 1 and 2, which have been shut-down and defueled, were graphite moderated reactors. The units were shut-down in 1981 and 1989. Unit 3, a BN-600 reactor, is a 600 MW(electric) sodium-cooled fast breeder reactor. Unit 3 went on-line in April 1980 and produces electric power which is fed into a distribution grid and thermal power which provides heat to Zarechny. The paper also discusses the SF NIKIET, the Sverdiovsk Branch of NIKIET, Moscow, which is the research and development branch of the parent NIKEIT and is primarily a design institute responsible for reactor design. Central to its operations is a 15 megawatt IVV research reactor. The paper discusses general security and fissile material control and accountability at these two facilities.

  17. Laser satellite power systems

    Energy Technology Data Exchange (ETDEWEB)

    Walbridge, E.W.

    1980-01-01

    A laser satellite power system (SPS) converts solar power captured by earth-orbiting satellites into electrical power on the earth's surface, the satellite-to-ground transmission of power being effected by laser beam. The laser SPS may be an alternative to the microwave SPS. Microwaves easily penetrate clouds while laser radiation does not. Although there is this major disadvantage to a laser SPS, that system has four important advantages over the microwave alternative: (1) land requirements are much less, (2) radiation levels are low outside the laser ground stations, (3) laser beam sidelobes are not expected to interfere with electromagnetic systems, and (4) the laser system lends itself to small-scale demonstration. After describing lasers and how they work, the report discusses the five lasers that are candidates for application in a laser SPS: electric discharge lasers, direct and indirect solar pumped lasers, free electron lasers, and closed-cycle chemical lasers. The Lockheed laser SPS is examined in some detail. To determine whether a laser SPS will be worthy of future deployment, its capabilities need to be better understood and its attractiveness relative to other electric power options better assessed. First priority should be given to potential program stoppers, e.g., beam attenuation by clouds. If investigation shows these potential program stoppers to be resolvable, further research should investigate lasers that are particularly promising for SPS application.

  18. Solar photovoltaic power stations

    Science.gov (United States)

    Chowaniec, C. R.; Pittman, P. F.; Ferber, R. R.; Marshall, B. W.

    1977-01-01

    The subsystems of a solar photovoltaic central power system are identified and the cost of major components are estimated. The central power system, which would have a peak power capability in the range of 50 to 1000 MW, utilizes two types of subsystems - a power conditioner and a solar array. Despite differences in costs of inverters, the overall cost of the total power conditioning subsystem is about the same for all approaches considered. A combination of two inverters operating from balanced dc buses as a pair of 6-pulse groups is recommended. A number of different solar cell modules and tracking array structures were analyzed. It is concluded that when solar cell costs are high (greater than $500/kW), high concentration modules are more cost effective than those with low concentration. Vertical-axis tracking is the most effective of the studied tracking modes. For less expensive solar cells (less than $400/kW), fixed tilt collector/reflector modules are more cost effective than those which track.

  19. Normative Power Europe

    DEFF Research Database (Denmark)

    Manners, Ian

    2009-01-01

    The chapter develops a normative power approach to European studies that can be applied across and beyond its constitutive disciplines in order to interrogate and transgress the ideas and spaces on/of Europe. In four parts the chapter explores the terms ‘normative', ‘power', and ‘Europe', before......' - in order to make sense of ideas of the common good. Part two looks at three different types of power - ‘relational', ‘structural', and ‘normative' - as a means of understanding the power of ideas of the common good. Part three considers three different means of understanding Europe - ‘civilizational......', ‘categorical', and ‘cultural' - to show how the power of ideas of the common good shape our means of comprehending contemporary Europe. Part four attempts to apply the approach to the question of a European counter-terrorist response. This example was chosen because of the challenges it presents...

  20. Advanced Power Electronics Components

    Science.gov (United States)

    Schwarze, Gene E.

    2004-01-01

    This paper will give a description and status of the Advanced Power Electronics Materials and Components Technology program being conducted by the NASA Glenn Research Center for future aerospace power applications. The focus of this research program is on the following: 1) New and/or significantly improved dielectric materials for the development of power capacitors with increased volumetric efficiency, energy density, and operating temperature. Materials being investigated include nanocrystalline and composite ceramic dielectrics and diamond-like carbon films; 2) New and/or significantly improved high frequency, high temperature, low loss soft magnetic materials for the development of transformers/inductors with increased power/energy density, electrical efficiency, and operating temperature. Materials being investigated include nanocrystalline and nanocomposite soft magnetic materials; 3) Packaged high temperature, high power density, high voltage, and low loss SiC diodes and switches. Development of high quality 4H- and 6H- SiC atomically smooth substrates to significantly improve device performance is a major emphasis of the SiC materials program; 4) Demonstration of high temperature (> 200 C) circuits using the components developed above.

  1. Power from triticale straw

    Energy Technology Data Exchange (ETDEWEB)

    Dassanayake, M.; Kumar, A. [Alberta Univ., Edmonton, AB (Canada). Dept. of Mechanical Engineering

    2010-07-01

    This study examined the feasibility of using triticale straw for production of electricity in Canada. Triticale is a manmade hybrid of wheat and rye and it has a high potential of growth in Canada. The cost ($/MWh) of producing electricity from triticale straw was estimated using a data intensive techno-economic model. The study also determined the optimum size of a biomass power plant (MW) which is a trade-off between capital cost of the plant and transportation cost of biomass. Cost curves were also developed in order to evaluate the impact of scale on power production costs. The location of the power plant and the future expansion of triticale were among the factors considered in the techno-economic mode. The scope of the work included all the processes beginning with the collection of straw to the conversion to electricity through direct combustion at the power plant. According to the preliminary results, the cost of producing power from triticale straw is higher than coal-based electricity production in western Canada.

  2. Power plant siting

    Energy Technology Data Exchange (ETDEWEB)

    Winter, J.V.; Conner, D.A.

    1978-01-01

    Just to keep up with expected demand, the US will need over 500 new power generation units by 1985. Where these power plants will be located is the subject of heated debate among utility officials, government leaders, conservationists, concerned citizens and a multitude of special interest groups. This book offers a balanced review of all of the salient factors that must be taken into consideration in selecting power plant locations. To deal with this enormously complex subject, the authors (1) offer a general overview of the history and reasoning behind present legislation on the state and national levels; (2) describe the many different agencies that have jurisdiction in power plant location, from local water authorities and city councils to state conservation boards and the Nuclear Regulatory Commission; and (3) include a state-by-state breakdown of siting laws, regulations and present licensing procedures. Architects, engineers, contractors, and others involved in plant construction and site evaluation will learn of the trade-offs that must be made in balancing the engineering, economic, and environmental impacts of plant location. The book covers such areas as availability of water supplies for generation or cooling; geology, typography, and demography of the proposed site; and even the selection of the fuel best suited for the area. Finally, the authors examine the numerous environmental aspects of power plant siting.

  3. LHC Power Distribution

    CERN Document Server

    Pedersen, J

    1999-01-01

    The power distribution for the LHC machine and its experiments will be realised making extensive use of the existing infrastructure for the LEP. The overall power requirement is approximately the same, about 125 MW. The load distribution will however change. The even points will loose in importance and the points 1 and 5 will, due to the installation of ATLAS and CMS, gain. A thorough reorganisation of the 18 kV distribution will thus be necessary. Due to the important cryogenic installations required for the LHC, the 3.3 kV distribution system, supplying mainly cryogenic compressors, will be extended with a number of new substations. The important number of new surface buildings, underground caverns and other underground structures all will receive general service installations: Lighting and power. The new injection tunnels will require complete installations: A.C. supplies for the power converters and for general service, and D.C. cabling for the magnets of the beam line. Special safe power installations ar...

  4. Sustainable tidal power

    Energy Technology Data Exchange (ETDEWEB)

    Walsum, E. van

    2003-07-01

    North America is increasingly searching for ways to achieve energy self-sufficiency. This paper discussed the tidal power potential of the Upper Bay of Fundy, located on Canada's east coast. The Bay of Fundy has the largest tides in the world. It is also close to a major electricity market. Tidal power plants could mean substantial quantities of clean, renewable energy. Some of the environmental concerns with the development of tidal power plants on the Bay of Fundy include: siltation, shorebird survival, fish-stock survival, sea-mammal survival, drainage of agricultural lands, and changes in the tidal regime of the Bay of Fundy-Gulf of Maine Basin. In this paper, the author proved that it is possible to qualitatively assess those concerns, but that the quantitative assessment is more complex. A quantitative assessment of the effect on living organisms would require assessing the overall performance of an ecologically designed, built and operated pilot tidal power plant. The author argued that a full-fledged tidal power plant construction can take place once a pilot plant has been proven to operate symbiotically with a thriving marine shore-based flora and fauna. 18 refs., 2 tabs., 6 figs.

  5. Electric power industry in China

    Energy Technology Data Exchange (ETDEWEB)

    Zisheng Jiang [Ministry of Electric Power, Beijing (China). Bureau of Electric Power Machinery

    1995-07-01

    This document presents the status of the electric power in China, highlighting the following aspects: recent achievement, electricity increased sharing in the total energy consumption, technical economic indexes, nuclear power, renewable energy sources, rural electrification, transmission and power network, transmission lines and substations, present status and development trends for power network, regulation of power system dispatching, power system communication. The document also presents the future developing plan, approaching the outlook and strategy, development targets of the electric power industry and the administrative system reforming of the electric power industry.

  6. Power, control and optimization

    CERN Document Server

    Vasant, Pandian; Barsoum, Nader

    2013-01-01

    The book consists of chapters based on selected papers of international conference „Power, Control and Optimization 2012”, held in Las Vegas, USA. Readers can find interesting chapters discussing various topics from the field of power control, its distribution and related fields. Book discusses topics like energy consumption impacted by climate, mathematical modeling of the influence of thermal power plant on the aquatic environment, investigation of cost reduction in residential electricity bill using electric vehicle at peak times or allocation and size evaluation of distributed generation using ANN model and others.  Chapter authors are to the best of our knowledge the originators or closely related to the originators of presented ideas and its applications. Hence, this book certainly is one of the few books discussing the benefit from intersection of those modern and fruitful scientific fields of research with very tight and deep impact on real life and industry. This book is devoted to the studies o...

  7. Concentrating Solar Power

    Science.gov (United States)

    Mehos, Mark

    2008-09-01

    Concentrating Solar Power (CSP) has the potential to contribute significantly to the generation of electricity by renewable energy resources in the U.S.. Thermal storage can extend the duty cycle of CSP beyond daytime hours to early evening where the value of electricity is often the highest. The potential solar resource for the southwest U.S. is identified, along with the need to add power lines to bring the power to consumers. CSP plants in the U.S. and abroad are described. The CSP cost of electricity at the busbar is discussed. With current incentives, CSP is approaching competiveness with conventional gas-fired systems during peak-demand hours when the price of electricity is the highest. It is projected that a mature CSP industry of over 4 GWe will be able to reduce the energy cost by about 50%, and that U.S. capacity could be 120 GW by 2050.

  8. Phasor power electronics

    CERN Document Server

    Rim, Chun T

    2016-01-01

    This book presents a comprehensive introduction to the principles of power electronics, focusing on the switched transformer concept and phasor transformation techniques as employed in the analysis and design of power electronic circuits. Phasor transformations, as introduced in this book, make the time-varying nature of a switching converter simple and easy to handle, transforming it into an equivalent time-invariant circuit. The book starts with an introduction to the philosophy and fundamental principles of power electronics. The switched transformer concept, which is applicable to any switching converter, is introduced, and it is shown how DC-DC converters analyses are then so straightforward that very little equational manipulation is needed. Then the phasor transformation techniques are comprehensively explained over three parts. Single phase and multi-phase AC systems are dealt with through the single phase phasor transformation and circuit DQ transformation, respectively. A general unified phasor tran...

  9. Power as Sumbolon

    DEFF Research Database (Denmark)

    Dean, Mitchell

    2017-01-01

    While Foucault was concerned with power throughout his entire work, it is in the 1970s that it receives his most explicit treatment. As a way of summarizing his manifold contributions to problems of the relation of sovereignty and governmentality, I propose the figure of the sumbolon, which he...... himself used in his lectures during that decade. This figure and its “rule of halves” prevent us from reducing his analysis of power to one of liberal or economic government. This provides us with a framework for both how the international domain is approached in these investigations and how we might...... remain loyally unfaithful to his approach to the international and to power more broadly. I indicate three ways we might enact this ethos: by identifying a liberal international dispositif alongside Foucault’s diplomatic-military one associated with reason of state; by the comparative investigation...

  10. Coping with power dispersion?

    DEFF Research Database (Denmark)

    2014-01-01

    The last decades have witnessed a significant shift in policy competences away from central governments in Europe. The reallocation of competences spans over three dimensions: upwards; sideways; and downwards. This collection takes the dispersion of powers as a starting point and seeks to assess...... how the actors involved cope with the new configurations. In this introduction, we discuss the conceptualization of power dispersion and highlight the ways in which the contributions add to this research agenda. We then outline some general conclusions and end by indicating future avenues of research....... Taken together, the collection contributes some answers to the challenge of defining and measuring – in a comparative way – the control and co-ordination mechanisms which power dispersion generates. It also explores the tension between political actors' quest for autonomy and the acknowledgement...

  11. Balancing trust and power

    DEFF Research Database (Denmark)

    Broholm-Jørgensen, Marie; Guassora, Ann Dorrit; Reventlow, Susanne

    2017-01-01

    OBJECTIVE: Little is known about how strategies of retaining patients are acted out by general practitioners (GPs) in the clinical encounter. With this study, we apply Grimens' (2009) analytical connection between trust and power to explore how trust and power appear in preventive health checks...... from the GPs' perspectives, and in what way trust and power affect and/or challenge strategies towards retaining patients without formal education. DESIGN: Data in this study were obtained through semi-structured interviews with GPs participating in an intervention project, as well as observations...... of clinical encounters. RESULTS: From the empirical data, we identified three dimensions of respect: respect for the patient's autonomy, respect for professional authority and respect as a mutual exchange. A balance of respect influenced trust in the relationship between GP and patients and the transfer...

  12. Power converter connection configuration

    Science.gov (United States)

    Beihoff, Bruce C.; Kehl, Dennis L.; Gettelfinger, Lee A.; Kaishian, Steven C.; Phillips, Mark G.; Radosevich, Lawrence D.

    2008-11-11

    EMI shielding is provided for power electronics circuits and the like via a direct-mount reference plane support and shielding structure. The thermal support may receive one or more power electronic circuits. The support may aid in removing heat from the circuits through fluid circulating through the support. The support forms a shield from both external EMI/RFI and from interference generated by operation of the power electronic circuits. Features may be provided to permit and enhance connection of the circuitry to external circuitry, such as improved terminal configurations. Modular units may be assembled that may be coupled to electronic circuitry via plug-in arrangements or through interface with a backplane or similar mounting and interconnecting structures.

  13. The solar power satellite

    Energy Technology Data Exchange (ETDEWEB)

    Combes, P.F.

    1982-01-01

    The construction, launch, components, and operations of satellite solar power systems (SSPS) for direct beaming of solar energy converted to electricity to earth stations are outlined. The reference designs of either Si or concentrator GaAs solar cell assemblies large enough to project 5 GW of power are described. The beam will be furnished by klystrons or amplitrons for reception by rectennas on earth. Conforming to the law of amplitude and the equiphase law will permit high efficiencies, pointing accuracy, and low power deposition/sq cm, thus avoiding environmental problems, although some telecommunications systems may suffer interference. The construction of the dipole rectenna grid is sketched, noting that one receiver would be an ellipse sized at 10 x 13 km. Various forms of pollution which could result from the construction of an SSPS are examined.

  14. Wind Power Meteorology

    DEFF Research Database (Denmark)

    Lundtang Petersen, Erik; Mortensen, Niels Gylling; Landberg, Lars

    Wind power meteorology has evolved as an applied science, firmly founded on boundary-layer meteorology, but with strong links to climatology and geography. It concerns itself with three main areas: siting of wind turbines, regional wind resource assessment, and short-term prediction of the wind...... resource. The history, status and perspectives of wind power meteorology are presented, with emphasis on physical considerations and on its practical application. Following a global view of the wind resource, the elements of boundary layer meteorology which are most important for wind energy are reviewed......: wind profiles and shear, turbulence and gust, and extreme winds. The data used in wind power meteorology stem mainly from three sources: onsite wind measurements, the synoptic networks, and the re-analysis projects. Wind climate analysis, wind resource estimation and siting further require a detailed...

  15. Power Systems Development Facility

    Energy Technology Data Exchange (ETDEWEB)

    Southern Company Services

    2009-01-31

    In support of technology development to utilize coal for efficient, affordable, and environmentally clean power generation, the Power Systems Development Facility (PSDF), located in Wilsonville, Alabama, has routinely demonstrated gasification technologies using various types of coals. The PSDF is an engineering scale demonstration of key features of advanced coal-fired power systems, including a Transport Gasifier, a hot gas particulate control device, advanced syngas cleanup systems, and high-pressure solids handling systems. This final report summarizes the results of the technology development work conducted at the PSDF through January 31, 2009. Twenty-one major gasification test campaigns were completed, for a total of more than 11,000 hours of gasification operation. This operational experience has led to significant advancements in gasification technologies.

  16. Power Curve Measurements REWS

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Villanueva, Héctor

    This report describes the power curve measurements carried out on a given wind turbine in a chosen period. The measurements were carried out following the measurement procedure in the draft of IEC 61400-12-1 Ed.2 [1], with some deviations mostly regarding uncertainty calculation. Here, the refere......This report describes the power curve measurements carried out on a given wind turbine in a chosen period. The measurements were carried out following the measurement procedure in the draft of IEC 61400-12-1 Ed.2 [1], with some deviations mostly regarding uncertainty calculation. Here......, the reference wind speed used in the power curve is the equivalent wind speed obtained from lidar measurements at several heights between lower and upper blade tip, in combination with a hub height meteorological mast. The measurements have been performed using DTU’s measurement equipment, the analysis...

  17. Discontinuous Mode Power Supply

    Science.gov (United States)

    Lagadinos, John; Poulos, Ethel

    2012-01-01

    A document discusses the changes made to a standard push-pull inverter circuit to avoid saturation effects in the main inverter power supply. Typically, in a standard push-pull arrangement, the unsymmetrical primary excitation causes variations in the volt second integral of each half of the excitation cycle that could lead to the establishment of DC flux density in the magnetic core, which could eventually cause saturation of the main inverter transformer. The relocation of the filter reactor normally placed across the output of the power supply solves this problem. The filter reactor was placed in series with the primary circuit of the main inverter transformer, and is presented as impedance against the sudden changes on the input current. The reactor averaged the input current in the primary circuit, avoiding saturation of the main inverter transformer. Since the implementation of the described change, the above problem has not reoccurred, and failures in the main power transistors have been avoided.

  18. Compensating active power imbalances in power system with large-scale wind power penetration

    DEFF Research Database (Denmark)

    Basit, Abdul; Hansen, Anca Daniela; Altin, Müfit

    2016-01-01

    Large-scale wind power penetration can affectthe supply continuity in the power system. This is a matterof high priority to investigate, as more regulating reservesand specified control strategies for generation control arerequired in the future power system with even more highwind power...... penetration. This paper evaluates the impact oflarge-scale wind power integration on future power systems.An active power balance control methodology is usedfor compensating the power imbalances between thedemand and the generation in real time, caused by windpower forecast errors. The methodology...... for the balancepower control of future power systems with large-scalewind power integration is described and exemplified consideringthe generation and power exchange capacities in2020 for Danish power system....

  19. Geothermal Power Technologies

    DEFF Research Database (Denmark)

    Montagud, Maria E. Mondejar; Chamorro, C.R.

    2017-01-01

    Although geothermal energy has been widely deployed for direct use in locations with especial geologic manifestations, its potential for power generation has been traditionally underestimated. Recent technology developments in drilling techniques and power conversion technologies from low......-temperature heat resources are bringing geothermal energy to the spotlight as a renewable baseload energy option for a sustainable energy mix. Although the environmental impact and economic viability of geothermal exploitation must be carefully evaluated for each case, the use of deep low-temperature geothermal...

  20. Wind power today

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-04-01

    This publication highlights initiatives of the US DOE`s Wind Energy Program. 1997 yearly activities are also very briefly summarized. The first article describes a 6-megawatt wind power plant installed in Vermont. Another article summarizes technical advances in wind turbine technology, and describes next-generation utility and small wind turbines in the planning stages. A village power project in Alaska using three 50-kilowatt turbines is described. Very brief summaries of the Federal Wind Energy Program and the National Wind Technology Center are also included in the publication.

  1. Google Power Search

    CERN Document Server

    Spencer, Stephan

    2011-01-01

    Behind Google's deceptively simple interface is immense power for both market and competitive research-if you know how to use it well. Sure, basic searches are easy, but complex searches require specialized skills. This concise book takes you through the full range of Google's powerful search-refinement features, so you can quickly find the specific information you need. Learn techniques ranging from simple Boolean logic to URL parameters and other advanced tools, and see how they're applied to real-world market research examples. Incorporate advanced search operators such as filetype:, intit

  2. Multiplex tokamak power plant

    Energy Technology Data Exchange (ETDEWEB)

    Dabiri, A.E.

    1986-07-01

    The concept of multiplexing for a fusion power core as an option for producing power is explored. Superconducting, as well as normal magnet, coils in either first or second stability regimes are considered. The results show that multiplex plants with superconducting magnets operating in the second stability regime could be competitive with the single-unit plants in some unit sizes. The key issues that impact the expected benefits of multiplexing must be investigated further. These are factory fabrication, economy of scale, the extent of equipment sharing, inherent safety, maintainability, and utility load management.

  3. Virtual power plant auctions

    Energy Technology Data Exchange (ETDEWEB)

    Ausubel, Lawrence M.; Cramton, Peter [Department of Economics, University of Maryland, College Park, MD 20742 (United States)

    2010-12-15

    Since their advent in 2001, virtual power plant (VPP) auctions have been implemented widely. In this paper, we describe the simultaneous ascending-clock auction format that has been used for virtually all VPP auctions to date, elaborating on other design choices that most VPP auctions have had in common as well as discussing a few aspects that have varied significantly among VPP auctions. We then evaluate the various objectives of regulators in requiring VPP auctions, concluding that the auctions have been effective devices for facilitating new entry into electricity markets and for developing wholesale power markets. (author)

  4. Leadership, power and symmetry

    DEFF Research Database (Denmark)

    Spaten, Ole Michael

    2016-01-01

    Research publications concerning managers who coach their own employees are barely visible despite its wide- spread use in enterprises (McCarthy & Milner, 2013; Gregory & Levy, 2011; Crabb, 2011). This article focuses on leadership, power and moments of symmetry in the coaching relationship...... regarding managers coaching their employees and it is asked; what contributes to coaching of high quality when one reflects on the power aspect as being immanent? Fourteen middle managers coached five of their employees, and all members of each party wrote down cues and experiences immediately after each...

  5. Optimal Power Flow Pursuit

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Anese, Emiliano

    2016-08-01

    Past works that focused on addressing power-quality and reliability concerns related to renewable energy resources (RESs) operating with business-as-usual practices have looked at the design of Volt/VAr and Volt/Watt strategies to regulate real or reactive powers based on local voltage measurements, so that terminal voltages are within acceptable levels. These control strategies have the potential of operating at the same time scale of distribution-system dynamics, and can therefore mitigate disturbances precipitated fast time-varying loads and ambient conditions; however, they do not necessarily guarantee system-level optimality, and stability claims are mainly based on empirical evidences. On a different time scale, centralized and distributed optimal power flow (OPF) algorithms have been proposed to compute optimal steady-state inverter setpoints, so that power losses and voltage deviations are minimized and economic benefits to end-users providing ancillary services are maximized. However, traditional OPF schemes may offer decision making capabilities that do not match the dynamics of distribution systems. Particularly, during the time required to collect data from all the nodes of the network (e.g., loads), solve the OPF, and subsequently dispatch setpoints, the underlying load, ambient, and network conditions may have already changed; in this case, the DER output powers would be consistently regulated around outdated setpoints, leading to suboptimal system operation and violation of relevant electrical limits. The present work focuses on the synthesis of distributed RES-inverter controllers that leverage the opportunities for fast feedback offered by power-electronics interfaced RESs. The overarching objective is to bridge the temporal gap between long-term system optimization and real-time control, to enable seamless RES integration in large scale with stability and efficiency guarantees, while congruently pursuing system-level optimization objectives. The

  6. Electric power distribution handbook

    CERN Document Server

    Short, Thomas Allen

    2014-01-01

    Of the ""big three"" components of electrical infrastructure, distribution typically gets the least attention. In fact, a thorough, up-to-date treatment of the subject hasn't been published in years, yet deregulation and technical changes have increased the need for better information. Filling this void, the Electric Power Distribution Handbook delivers comprehensive, cutting-edge coverage of the electrical aspects of power distribution systems. The first few chapters of this pragmatic guidebook focus on equipment-oriented information and applications such as choosing transformer connections,

  7. New nuclear power sources

    Science.gov (United States)

    Nuclear electric-power generation sources for the future include two viable candidates as viewed now: the fast breeder and the nuclear fusion reactors. Breeder reactors, which produce more radioactive fuels than they consume, are in the realm of existing technology. They are also categorized as potentially most harmful to the environment. Nuclear fusion reactors, on the other hand, will not be available in this century, based on current levels of development. However, they will be categorized as inherently much safer and thus potentially least harmful to the environment of all fueled electric-power generators.

  8. BPL (Broadband Power Line)

    OpenAIRE

    Peralta, Arturo

    2010-01-01

    El mundo actual requiere cada vez más el estar conectados con la sociedad de la Información y el Conocimiento, esto demanda que en los hogares, lugares de turismo, trabajos, universidades, etcétera, se cuente con una conexión a Internet de Alta Velocidad, que además sea segura y confiable. En este documento se presenta las características más importantes de la tecnología BPL (Broadband Power Line) o PLC (Power Line Comunication), la cual permite brindar el servicio de Internet ...

  9. Safe reactor power

    Energy Technology Data Exchange (ETDEWEB)

    Menegus, R.L.; Ring, H.F.; Bernath, L.

    1956-05-15

    The upper limit on reactor operating power is established not only by safety considerations during steady-state operation but also by the requirement that during an accident no permanent damage be inflicted upon the reactor or the fuel charge. Two general categories of accidents are recognized; they are the ``nuclear runaway`` and the ``loss of coolant flow`` incidents. In this memorandum an incident of the latter type is analyzed. It is assumed that the safety rods function normally, and a method is defined for establishing the highest operating power that may be permitted if the postulated accident is to do no damage.

  10. Prognostics of Power MOSFET

    Science.gov (United States)

    Celaya, Jose Ramon; Saxena, Abhinav; Vashchenko, Vladislay; Saha, Sankalita; Goebel, Kai Frank

    2011-01-01

    This paper demonstrates how to apply prognostics to power MOSFETs (metal oxide field effect transistor). The methodology uses thermal cycling to age devices and Gaussian process regression to perform prognostics. The approach is validated with experiments on 100V power MOSFETs. The failure mechanism for the stress conditions is determined to be die-attachment degradation. Change in ON-state resistance is used as a precursor of failure due to its dependence on junction temperature. The experimental data is augmented with a finite element analysis simulation that is based on a two-transistor model. The simulation assists in the interpretation of the degradation phenomena and SOA (safe operation area) change.

  11. MOSFET Power Controller

    Science.gov (United States)

    Mitchell, J.; Jones, K.

    1986-01-01

    High current and voltage controlled remotely. Remote Power Conroller includes two series-connected banks of parallel-connected MOSFET's to withstand high current and voltage. Voltage sharing between switch banks, low-impedance, gate-drive circuits used. Provided controlled range for turn on. Individually trimmable to insure simultaneous switching within few nanoseconds during both turn on and turn off. Control circuit for each switch bank and over-current trip circuit float independently and supplied power via transformer T1 from inverter. Control of floating stages by optocouplers.

  12. Wireless power pad with local power activation for portable devices

    NARCIS (Netherlands)

    Waffenschmidt, E.; Zheglov, V.

    2007-01-01

    Wireless power transfer by magnetic induction offers a simple to use way to recharge mobile devices like e.g. mobile phone, music players or medical sensors. As shown by a previous report and an existing Power Pad demonstrator, wireless inductive power transfer is possible with a good power

  13. Power Diplomacy in the Orbit of Power Security

    Directory of Open Access Journals (Sweden)

    E F Chernenko

    2010-09-01

    Full Text Available Actual problems of power diplomacy are touched upon in the article. The author considers power policy as an important subject in modern international relations. Power policy of different countries under crises conditions and Russian position in the world markets are discussed as well. Special attention is paid to alternative sourses of power as an object of world policy and diplomacy.

  14. Characteristics of the E - and F -region field-aligned irregularities in middle latitudes: Initial results obtained from the Daejeon 40.8 MHz VHF radar in South Korea

    Directory of Open Access Journals (Sweden)

    Young-Sil Kwak

    2014-03-01

    Full Text Available We present preliminary observations of the field-aligned-irregularities (FAIs in the E and F regions during the solar minimum (2009 - 2010 using the 40.8 MHz coherent backscatter radar at Daejeon (36.18°N, 127.14°E, 26.7°N dip latitude in South Korea. The radar, which consists of 24 Yagi antennas, observes the FAIs using a single beam with a peak power of 24 kW. The radar has been continuously operated since December 2009. Depending on the manner of occurrence of the backscatter echoes, the E-region echoes are largely divided into two types: quasi-periodic (QP and continuous echoes. Our observations show that the QP echoes occur frequently above an altitude of 105 km in the post-sunset period and continuous echoes occur preferentially around an altitude of 105 km in the post-sunrise period. QP echoes appear as striated discrete echoes for a period of about 10 - 20 min. The QP-type echoes occur more frequently than the continuoustype echoes do and the echo intensity of the QP type is stronger than that of the continuous type. In the F region, the FAIs occur at night at an altitude interval of 250 - 450 km. As time proceeds, the occurrence height of the FAIs gradually increases until early in the morning and then decreases. The duration of the F-region FAIs is typically a few hours at night, although, in rare cases, FAIs persist throughout the night or appear even after sunrise. We discuss the similarities and differences of the FAIs observed by the Daejeon radar in comparison with other radar observations.

  15. Solar powered actuator with continuously variable auxiliary power control

    Science.gov (United States)

    Nola, F. J.

    1984-12-01

    A solar powered system is disclosed in which a load such as a compressor is driven by a main induction motor powered by a solar array. An auxiliary motor shares the load with the solar powered motor in proportion to the amount of sunlight available, is provided with a power factor controller for controlling voltage applied to the auxiliary motor in accordance with the loading on that motor. In one embodiment, when sufficient power is available from the solar cell, the auxiliary motor is driven as a generator by excess power from the main motor so as to return electrical energy to the power company utility lines.

  16. Power Quality in DC Power Distribution Systems and Microgrids

    Directory of Open Access Journals (Sweden)

    Stephen Whaite

    2015-05-01

    Full Text Available This review paper discusses power quality considerations for direct current (DC electric power distribution systems, particularly DC microgrids. First, four selected sample DC architectures are discussed to provide motivation for the consideration of power quality in DC systems. Second, a brief overview of power quality challenges in conventional alternating current (AC distribution systems is given to establish the field of power quality. Finally, a survey of literature addressing power quality issues in DC systems is presented, and necessary power quality considerations in DC distribution system design and operation are discussed.

  17. Power System Operation with Large Scale Wind Power Integration

    DEFF Research Database (Denmark)

    Suwannarat, A.; Bak-Jensen, B.; Chen, Z.

    2007-01-01

    The Danish power system starts to face problems of integrating thousands megawatts of wind power, which produce in a stochastic behavior due to natural wind fluctuations. With wind power capacities increasing, the Danish Transmission System Operator (TSO) is faced with new challenges related...... to the uncertain nature of wind power. In this paper, proposed models of generations and control system are presented which analyze the deviation of power exchange at the western Danish-German border, taking into account the fluctuating nature of wind power. The performance of the secondary control of the thermal...... power plants and the spinning reserves control from the Combined Heat and Power (CHP) units to achieve active power balance with the increased wind power penetration is presented....

  18. An Enhanced Islanding Microgrid Reactive Power, Imbalance Power, and Harmonic Power Sharing Scheme

    DEFF Research Database (Denmark)

    He, Jinwei; Lin, Yun Wei; Blaabjerg, Frede

    2015-01-01

    To address inaccurate power sharing problems in autonomous islanding microgrids, an enhanced droop control method through online virtual impedance adjustment is proposed. First, a term associated with DG reactive power, imbalance power, or harmonic power is added to the conventional real power......-frequency droop control. The transient real power variations caused by this term are captured to realize DG series virtual impedance tuning. With the regulation of DG virtual impedance at fundamental positive sequence, fundamental negative sequence, and harmonic frequencies, an accurate power sharing can...... unit local controllers. The feasibility of the proposed method is verified by simulated and experimental results from a low-power three-phase microgrid prototype....

  19. Wireless powering for low-power distributed sensors

    Directory of Open Access Journals (Sweden)

    Popović Zoya B.

    2006-01-01

    Full Text Available In this paper, an overview of the field of wireless powering is presented with an emphasis on low-power applications. Several rectenna elements and arrays are discussed in more detail: (1 a 10-GHz array for powering sensors in aircraft wings; (2 a single antenna in the 2.4-GHz ISM band for low-power assisted-living sensors; and (3 a broadband array for power harvesting in the 2-18GHz frequency range.

  20. PowerPoint Presentation

    Indian Academy of Sciences (India)

    Table of contents. PowerPoint Presentation · CHANDIPURA VIRUS · Slide 3 · Slide 4 · Slide 5 · VIRUSES · PROPERTIES OF VIRUSES · CLASSIFICATION OF VIRUSES · VIRUS FAMILIES · VIRUS FAMILIES – contd · General Classification · Slide 12 · Slide 13 · Slide 14 · Slide 15 · Slide 16 · Slide 17 · Slide 18 · Slide 19.

  1. Stagings of Divine Power

    DEFF Research Database (Denmark)

    Holm, Bent

    2011-01-01

    is investigated up to the 18. century. Particilarly three fields of reference are exposed - the Christian, the Antique, and the Norse - in a context of European notions and manifestations of royal and state power. Three approaches are especially significant: Divine Monarchy, Divine Monarch, The long Baroque....

  2. Nacelle lidar power curve

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Wagner, Rozenn

    This report describes the power curve measurements performed with a nacelle LIDAR on a given wind turbine in a wind farm and during a chosen measurement period. The measurements and analysis are carried out in accordance to the guidelines in the procedure “DTU Wind Energy-E-0019” [1]. The reporting...

  3. Nuclear Power Plant Technician

    Science.gov (United States)

    Randall, George A.

    1975-01-01

    The author recognizes a body of basic knowledge in nuclear power plant technoogy that can be taught in school programs, and lists the various courses, aiming to fill the anticipated need for nuclear-trained manpower--persons holding an associate degree in engineering technology. (Author/BP)

  4. Perpetuating power through autoethnography

    NARCIS (Netherlands)

    Koot; , Stasja

    2017-01-01

    In this article, I reflect on my longitudinal relation with the indigenous Hai//om Bushmen of the resettlement farm Tsintsabis, in Namibia, exploring my position of power as a development fieldworker. I have been connected to the Hai//om since 1999, doing research and living and working with them

  5. Power Electronics Thermal Management

    Energy Technology Data Exchange (ETDEWEB)

    Moreno, Gilberto [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-08-07

    Thermal modeling was conducted to evaluate and develop thermal management strategies for high-temperature wide-bandgap (WBG)-based power electronics systems. WBG device temperatures of 175 degrees C to 250 degrees C were modeled under various under-hood temperature environments. Modeling result were used to identify the most effective capacitor cooling strategies under high device temperature conditions.

  6. The Power of Atmosphere

    DEFF Research Database (Denmark)

    Wieczorek, Izabela

    2014-01-01

    composed of bubbles of affects – that is, the particles that are charged with power and normativity. References Grtiffero, T. (2014 (2010)). Atmospheres: Aesthetics of Emotional Spaces. Ashgate Philippopoulos-Mihalopoulos, A. (2013). Atmospheres of law: Senses, affects, lawscapes, in Emotion, Space...

  7. Power and personality

    DEFF Research Database (Denmark)

    Bondebjerg, Ib

    2007-01-01

    This article is a comparative analysis of the websites of four of the most powerful leaders in the world: two presidents (George W. Bush and Jacques Chirac) and two prime ministers (Angela Merkel and Tony Blair). The analysis focuses on the structure and content of the websites; the relation...

  8. Intersectional embodiment and power

    DEFF Research Database (Denmark)

    Elg, Camilla; Jensen, Sune Qvotrup

    Through almost two decades the term ‘intersectionality' has gained influence in post colonial studies, gender studies, feminist theory and other research fields occupied with how social differences are distributed and how individuals are socially constructed  in stratified societies. The ‘interse...... differences and discuss the implications this has for our understanding of power relations....

  9. Investigating Wireless Power Transfer

    Science.gov (United States)

    St. John, Stuart A.

    Understanding Physics is a great end in itself, but is also crucial to keep pace with developments in modern technology. Wireless power transfer, known to many only as a means to charge electric toothbrushes, will soon be commonplace in charging phones, electric cars and implanted medical devices. This article outlines how to produce and use a…

  10. KiloPower Program

    Energy Technology Data Exchange (ETDEWEB)

    McClure, Patrick Ray [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-04

    These are the slides for a phone interview with Aerospace America magazine of the AIAA. It goes over the KiloPower Program at Los Alamos National Laboratory (LANL), and covers the following: 1 kWe Kilopower, 10 kWe Kilopower, Kilopower Reactor Using Stirling Technology (KRUSTY) Integration Test (DAF), Reactor Configuration, and Platen Positions.

  11. Rechargeable power supply

    NARCIS (Netherlands)

    Den Uijl, S.; Bouman, C.; Smit, W.

    2006-01-01

    The invention relates to a rechargeable power supply suitable to be used in a battery-operated device comprising at least one supercapacitor and at least a first and a second DC-DC converter connected in series, wherein the supercapacitor is connectable to an entry of the first DC-DC converter and

  12. Electrochemical Power Sources

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Electrochemical Power Sources - Rechargeable Batteries. A K Shukla S K Martha. General Article Volume 6 Issue 7 July 2001 pp 52-63. Fulltext. Click here to view fulltext PDF. Permanent link:

  13. Tracking Politics with POWER

    Science.gov (United States)

    Moreira, Silvio; Batista, David S.; Carvalho, Paula; Couto, Francisco M.; Silva, Mario J.

    2013-01-01

    Purpose: POWER is an ontology of political processes and entities. It is designed for tracking politicians, political organizations and elections, both in mainstream and social media. The aim of this paper is to propose a data model to describe political agents and their relations over time. Design/methodology/approach: The authors propose a data…

  14. X Power Tools

    CERN Document Server

    Tyler, Chris

    2008-01-01

    This book puts you in charge of the most flexible and adaptable graphical interface in the computer industry. The X Window System underlies graphical desktops on Linux and Unix systems, and supports advanced features of modern graphics cards. This unique inside look at X gives you a lot of useful ways to harness the power of this system effectively.

  15. Wealth and Power.

    Science.gov (United States)

    Martz, Carlton

    2000-01-01

    This theme issue examines three historical and current problems surrounding wealth and power. The first article looks at King Leopold of Belgium and his exploitation of the Congo. The second article explores John D. Rockefeller and the Standard Oil monopoly. The final article examines the antitrust case against the Microsoft Corporation. Each…

  16. Power to the logs!

    CERN Multimedia

    CERN. Geneva; MACMAHON, Joseph

    2015-01-01

    Are you tired of using grep, vi and emacs to read your logs? Do you feel like you’re missing the big picture? Does the word "statistics" put a smile on your face? Then it’s time to give power to the logs!

  17. Power system reliability

    Energy Technology Data Exchange (ETDEWEB)

    Allan, R.; Billinton, Roy (Manchester Univ. (United Kingdom). Inst. of Science and Technology Saskatchewan Univ., Saskatoon, SK (Canada))

    1994-01-01

    The function of an electric power system is to satisfy the system load as economically as possible and with a reasonable assurance of continuity or reliability. The application of quantitative reliability techniques in planning and operation has increased considerably in the past few years. Reliability evaluation is now becoming an integral part of the economic comparison of alternatives (6 figures, 17 references) (Author)

  18. Solar Thermal Power.

    Science.gov (United States)

    McDaniels, David K.

    The different approaches to the generation of power from solar energy may be roughly divided into five categories: distributed collectors; central receivers; biomass; ocean thermal energy conversion; and photovoltaic devices. The first approach (distributed collectors) is the subject of this module. The material presented is designed to…

  19. Solar Sea Power

    Science.gov (United States)

    Zener, Clarence

    1976-01-01

    In their preoccupation with highly complex new energy systems, scientists and statesmen may be overlooking the possibilities of Ocean Thermal Energy Conversion (OTEC). That is the view of a Carnegie-Mellon University physicist who is in the forefront of solar sea power investigation. (Author/BT)

  20. Pioneering with Solar Power.

    Science.gov (United States)

    Pollack, George; Pollack, Mary

    1982-01-01

    Describes the development of Mississippi County Community College's (MCCC's) solar energy system. Explains the functioning of the campus's computer-controlled photovoltaic concentrator system, MCCC's cooperative agreement with the Arkansas-Missouri Power Company, program funding, the integration of the solar system with other building components,…

  1. Nuclear-Powered Debate.

    Science.gov (United States)

    Arce, Gary

    1992-01-01

    Describes an exercise to develop interest and understanding about nuclear energy in which students make presentations regarding a proposal to build a hypothetical nuclear power plant. Students spend two weeks researching the topic; give testimony before a "Senate Energy Committee"; and vote on the proposal. Background information is…

  2. Thailand power profile

    Energy Technology Data Exchange (ETDEWEB)

    Breeze, Paul.

    1988-01-01

    After briefly outlining the recent political history in Thailand, the organization of the electricity supply system is described. The growth in power plants and the variety of their fuels are discussed. The government is currently pursuing an energy policy with an emphasis on indigenous resources and the electricity generators are encouraged to use natural gas.

  3. Investigating Wireless Power Transfer

    Science.gov (United States)

    St. John, Stuart A.

    2017-01-01

    Understanding Physics is a great end in itself, but is also crucial to keep pace with developments in modern technology. Wireless power transfer, known to many only as a means to charge electric toothbrushes, will soon be commonplace in charging phones, electric cars and implanted medical devices. This article outlines how to produce and use a…

  4. Student Power in Africa

    African Journals Online (AJOL)

    for Internationalization of Education (ANIE). ... higher education governance in Africa, the studies done by the Higher Education and ... for higher education. Student representation is premised on three conditions. Firstly, there must be democratic procedures in place which confer collective student powers on student.

  5. Balance of Power

    NARCIS (Netherlands)

    Boone, J.

    2004-01-01

    This paper argues that the efficiency distribution of players in a game determines how aggressively these players interact.We formalize the idea of balance of power: players fight very inefficient players but play softly versus equally (or more) efficient players.This theory of conduct predicts that

  6. The Power to Nudge

    NARCIS (Netherlands)

    Schmidt, Andreas T.

    Nudging policies rely on behavioral science to improve people's decisions through small changes in the environments within which people make choices. This article first seeks to rebut a prominent objection to this approach: furnishing governments with the power to nudge leads to relations of alien

  7. How Soft Power Works

    Science.gov (United States)

    2009-09-03

    power is similar to cultural influence. Prominent examples of this view include those of British historian Niall Ferguson and German publicist Josef...Stability (New York: Kluwer Academic, 1999), p. 412; Tricia S. Jones and Ross Brinkert, Conflict Couching: Conflict Management Strategies and Skills for

  8. Resolving-Power Quantization

    CERN Document Server

    Neuberger, Herbert

    2016-01-01

    Starting with a general discussion, a program is sketched for a quantization based on dilations. This resolving-power quantization is simplest for scalar field theories. The hope is to find a way to relax the requirement of locality so that the necessity to fine tune mass parameters is eliminated while universality is still preserved.

  9. Power Curve Measurements

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Georgieva Yankova, Ginka

    This report describes the power curve measurements performed with a nacelle LIDAR on a given wind turbine in a wind farm and during a chosen measurement period. The measurements and analysis are carried out in accordance to the guidelines in the procedure “DTU Wind Energy-E-0019” [1]. The reporting...

  10. Perpetuating power through autoethnography

    NARCIS (Netherlands)

    Koot; , Stasja

    2016-01-01

    In this article, I reflect on my longitudinal relation with the indigenous Hai//om Bushmen of the resettlement farm Tsintsabis, in Namibia, exploring my position of power as a development fieldworker. I have been connected to the Hai//om since 1999, doing research and living and working with them

  11. PowerPoint Presentation

    Indian Academy of Sciences (India)

    Table of contents. PowerPoint Presentation · There are 5 Speakers- The Ultimate dream is to get the Road map for connectivity to NE · Witnessing the Revolution · Some History · Slide 5 · Itanium® Processor Family Roadmap ... Growth of Wireless & Internet- Source Motorola · Convergence · Internet Alone is Not Enough…

  12. ELECTROCHEMICAL POWER FOR TRANSPORTATION

    Energy Technology Data Exchange (ETDEWEB)

    Cairns, Elton J.; Hietbrink, Earl H.

    1981-01-01

    This section includes some historical background of the rise and fall and subsequent rebirth of the electric vehicle; and a brief discussion of current transportation needs, and environmental and energy utilization issues that resulted in the renewed interest in applying electrochemical energy conversion technology to electric vehicle applications. Although energy utilization has evolved to be the most significant and important issue, the environmental issue will be discussed first in this section only because of its chronological occurrence. The next part of the chapter is a review of passenger and commercial electric vehicle technology with emphasis on vehicle design and demonstrated performance of vehicles with candidate power sources being developed. This is followed by a discussion of electrochemical power source requirements associated with future electric vehicles that can play a role in meeting modern transportation needs. The last part of the chapter includes first a discussion of how to identify candidate electrochemical systems that might be of interest in meeting electric vehicle power source requirements. This is then followed by a review of the current technological status of these systems and a discussion of the most significant problems that must be resolved before each candidate system can be a viable power source.

  13. Power curve report

    DEFF Research Database (Denmark)

    Vesth, Allan; Kock, Carsten Weber

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present...

  14. Power Curve Measurements

    DEFF Research Database (Denmark)

    Georgieva Yankova, Ginka; Villanueva, Héctor

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present anal...

  15. Power Curve Measurements REWS

    DEFF Research Database (Denmark)

    Villanueva, Héctor; Vesth, Allan

    This report describes the power curve measurements carried out on a given wind turbine in a chosen period. The measurements were carried out following the measurement procedure in the draft of IEC 61400-12-1 Ed.2 [1], with some deviations mostly regarding uncertainty calculation. Here, the refere...

  16. Power curve investigation

    DEFF Research Database (Denmark)

    Villanueva, Héctor; Vesth, Allan

    This report describes the analysis carried out with data from a given turbine in a wind farm and a chosen period. The purpose of the analysis is to correlate the power output of the wind turbine to the wind speed measured by a nacelle-mounted anemometer. The measurements and analysis are not perf...

  17. Power Curve Measurements, REWS

    DEFF Research Database (Denmark)

    Villanueva, Héctor; Gómez Arranz, Paula

    This report describes the power curve measurements carried out on a given wind turbine in a chosen period. The measurements were carried out following the measurement procedure in the draft of IEC 61400-12-1 Ed.2 [1], with some deviations mostly regarding uncertainty calculation. Here, the refere...

  18. Power Curve Measurements FGW

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Villanueva, Héctor

    The report describes power curve measurements carried out on a given wind turbine. The measurements are carried out in accordance to Ref. [1]. A site calibration has been carried out; see Ref. [2], and the measured flow correction factors for different wind directions are used in the present anal...

  19. Power and corruption.

    Science.gov (United States)

    Úbeda, Francisco; Duéñez-Guzmán, Edgar A

    2011-04-01

    Cooperation is ubiquitous in the natural world. What seems nonsensical is why natural selection favors a behavior whereby individuals would lose out by benefiting their competitor. This conundrum, for almost half a century, has puzzled scientists and remains a fundamental problem in biology, psychology, and economics. In recent years, the explanation that punishment can maintain cooperation has received much attention. Individuals who punish noncooperators thrive when punishment does not entail a cost to the punisher. However when punishment is costly, cooperation cannot be preserved. Most literature on punishment fails to consider that punishers may act corruptly by not cooperating when punishing noncooperators. No research has considered that there might be power asymmetries between punishers and nonpunishers that turn one of these type of individuals more or less susceptible to experiencing punishment. Here, we formulate a general game allowing corruption and power asymmetries between punishers and nonpunishers. We show that cooperation can persist if punishers possess power and use it to act corruptly. This result provides a new interpretation of recent data on corrupt policing in social insects and the psychology of power and hypocrisy in humans. These results suggest that corruption may play an important role in maintaining cooperation in insects and human societies. In contrast with previous research, we contend that costly punishment can be beneficial for social groups. This work allows us to identify ways in which corruption can be used to the advantage of a society. © 2010 The Author(s). Evolution© 2010 The Society for the Study of Evolution.

  20. Dynamic influences of wind power on the power system

    Energy Technology Data Exchange (ETDEWEB)

    Rosas, Pedro

    2003-03-01

    The thesis first presents the basics influences of wind power on the power system stability and quality by pointing out the main power quality issues of wind power in a small-scale case and following, the expected large-scale problems are introduced. Secondly, a dynamic wind turbine model that supports power quality assessment of wind turbines is presented. Thirdly, an aggregate wind farm model that support power quality and stability analysis from large wind farms is presented. The aggregate wind farm model includes the smoothing of the relative power fluctuation from a wind farm compared to a single wind turbine. Finally, applications of the aggregate wind farm model to the power systems are presented. The power quality and stability characteristics influenced by large-scale wind power are illustrated with three cases. In this thesis, special emphasis has been given to appropriate models to represent the wind acting on wind farms. The wind speed model to a single wind turbine includes turbulence and tower shadow effects from the wind and the rotational sampling turbulence due to the rotation of the blades. In a park scale, the wind speed model to the wind farm includes the spatial coherence between different wind turbines. Here the wind speed model is applied to a constant rotational speed wind turbine/farm, but the model is suitable to variable speed wind turbine/farm as well. The cases presented here illustrate the influences of the wind power on the power system quality and stability. The flicker and frequency deviations are the main power quality parameters presented. The power system stability concentrates on the voltage stability and on the power system oscillations. From the cases studied, voltage and the frequency variations were smaller than expected from the large-scale wind power integration due to the low spatial correlation of the wind speed. The voltage quality analysed in a Brazilian power system and in the Nordel power system from connecting large

  1. Power and Autistic Traits

    Directory of Open Access Journals (Sweden)

    Geir Overskeid

    2016-08-01

    Full Text Available Autistic traits can help people gain and sustain power, and has probably done so throughout history, says the present paper. A number of testable claims follow from this assumption. First, the powerful should have more autistic traits than others – which they do appear to have. Among other things, powerful people, and those with many autistic traits, tend to prefer solitary activities and are often aloof. Moreover, they are often rigid and socially insensitive, low on empathy and with low scores on the trait of agreeableness -- and as a rule they do not have many friends. Both groups are also more self-centered than others, more honest, less submissive, more sensitive to slights, and with a stronger tendency to engage in abstract thinking. They tend to behave in bossy or dominant ways, and their moral judgment is more based on rules than on feelings. In addition to experimental evidence, I cite biographies showing that a surprising number of presidents, prime ministers and other powerful people seem to have had traits like those in question – and interestingly, in animals, leaders are often rigid and insensitive to group members’ needs and feelings, mostly acting the way they are themselves inclined to, not responding much to others. Problem solving is important in leadership, and people with many autistic traits appear often to be better thinkers than typical subjects with similar IQs. However, these and other congruities could be coincidences. Hence the question of whether traits the two groups have in common also have a common cause constitutes a strong test of the paper’s thesis – and a common cause does appear to exist, in the form of testosterone’s effects on the central nervous system. Finally, there is evidence that, other things equal, powerful men have more reproductive success than others. If men wielding power do indeed have more autistic traits than those less powerful, this will lead to, other things equal, such traits

  2. Power and Autistic Traits

    Science.gov (United States)

    Overskeid, Geir

    2016-01-01

    Autistic traits can help people gain and sustain power, and has probably done so throughout history, says the present paper. A number of testable claims follow from this assumption. First, the powerful should have more autistic traits than others – which they do appear to have. Among other things, powerful people, and those with many autistic traits, tend to prefer solitary activities and are often aloof. Moreover, they are often rigid and socially insensitive, low on empathy and with low scores on the trait of agreeableness – and as a rule they do not have many friends. Both groups are also more self-centered than others, more honest, less submissive, more sensitive to slights, and with a stronger tendency to engage in abstract thinking. They tend to behave in bossy or dominant ways, and their moral judgment is more based on rules than on feelings. In addition to experimental evidence, I cite biographies showing that a surprising number of presidents, prime ministers and other powerful people seem to have had traits like those in question – and interestingly, in animals, leaders are often rigid and insensitive to group members’ needs and feelings, mostly acting the way they are themselves inclined to, not responding much to others. Problem solving is important in leadership, and people with many autistic traits appear often to be better thinkers than typical subjects with similar IQs. However, these and other congruities could be coincidences. Hence the question of whether traits the two groups have in common also have a common cause constitutes a strong test of the paper’s thesis – and a common cause does appear to exist, in the form of testosterone’s effects on the central nervous system. Finally, there is evidence that, other things equal, powerful men have more reproductive success than others. If men wielding power do indeed have more autistic traits than those less powerful, this will lead to, other things equal, such traits becoming more

  3. Concentrating solar thermal power.

    Science.gov (United States)

    Müller-Steinhagen, Hans

    2013-08-13

    In addition to wind and photovoltaic power, concentrating solar thermal power (CSP) will make a major contribution to electricity provision from renewable energies. Drawing on almost 30 years of operational experience in the multi-megawatt range, CSP is now a proven technology with a reliable cost and performance record. In conjunction with thermal energy storage, electricity can be provided according to demand. To date, solar thermal power plants with a total capacity of 1.3 GW are in operation worldwide, with an additional 2.3 GW under construction and 31.7 GW in advanced planning stage. Depending on the concentration factors, temperatures up to 1000°C can be reached to produce saturated or superheated steam for steam turbine cycles or compressed hot gas for gas turbine cycles. The heat rejected from these thermodynamic cycles can be used for sea water desalination, process heat and centralized provision of chilled water. While electricity generation from CSP plants is still more expensive than from wind turbines or photovoltaic panels, its independence from fluctuations and daily variation of wind speed and solar radiation provides it with a higher value. To become competitive with mid-load electricity from conventional power plants within the next 10-15 years, mass production of components, increased plant size and planning/operating experience will be accompanied by technological innovations. On 30 October 2009, a number of major industrial companies joined forces to establish the so-called DESERTEC Industry Initiative, which aims at providing by 2050 15 per cent of European electricity from renewable energy sources in North Africa, while at the same time securing energy, water, income and employment for this region. Solar thermal power plants are in the heart of this concept.

  4. ASPEC: Solar power satellite

    Science.gov (United States)

    1991-01-01

    The solar power satellite (SPS) will provide a clean, reliable source of energy for large-scale consumption. The system will use satellites in geostationary orbits around the Earth to capture the Sun's energy. The intercepted sunlight will be converted to laser beam energy that can be transmitted to the Earth's surface. Ground systems on the Earth will convert the transmissions from space into electric power. The preliminary design for the SPS consists of one satellite in orbit around the Earth transmitting energy to a single ground station. The SPS design uses multilayer solar cell technology arranged on a 20 km squared planar array to intercept sunlight and convert it to an electric voltage. Power conditioning devices then send the electricity to a laser, which transmits the power to the surface of the Earth. A ground station will convert the beam into electricity. Typically, a single SPS will supply 5 GW of power to the ground station. Due to the large mass of the SPS, about 41 million kg, construction in space is needed in order to keep the structural mass low. The orbit configuration for this design is to operate a single satellite in geosynchronous orbit (GEO). The GEO allows the system to be positioned above a single receiving station and remain in sunlight 99 percent of the time. Construction will take place in low Earth orbit (LEO); array sections, 20 in total, will be sailed on solar wind out to the GEO location in 150 days. These individual transportation sections are referred to as solar sailing array panels (SSAP's). The primary truss elements used to support the array are composed of composite tubular members in a pentahedral arrangement. Smart segments consisting of passive and active damping devices will increase the control of dynamic SPS modes.

  5. The Power Distribution Innovation achieves

    Indian Academy of Sciences (India)

    And at the same time have 24x7 DC power at each home. Adequate for Lowest income homes; Mid and high Income homes will install solar. Could help Manage Subsidy. Power Distribution Companies unconstrained: would become financially viable. uninterrupted DC power supply at low tariff; AC power can be charged at ...

  6. The foundations of organization power

    NARCIS (Netherlands)

    Clegg, S.R.

    2009-01-01

    I shall argue that the foundations of organization power were laid down in practice through theories of power - in the sense that they sought to explain power - but through quite pragmatic practices that were not necessarily regarded as embodying a theory of power, which I shall maintain they most

  7. Credibility and Perceived Power Ratings.

    Science.gov (United States)

    Nesler, Mitchell S.; And Others

    French and Raven (1959) proposed five bases of social power: referent, expert, legitimate, reward, and coercive power. Other power bases, such as information control and ecological control, have also been proposed. Another factor which might be considered a power base is the credibility of a source. A 2 x 3 factorial design was used to manipulate…

  8. Power System for Intelligent House

    Directory of Open Access Journals (Sweden)

    Michal Jahelka

    2010-01-01

    Full Text Available Power supply of intelligent houses or house phones is possible to do with standard transformer with voltage stabilizer or with intelligent power supply. Standard solution can has as a result of failure fuse blown or fire occurrence. Intelligent power supply switch off power and tests with little current whether short circuit is removed. After it resume system power supply. At the same time it cares of system backup with accumulator, informs control system about short circuit or failure net power supply, or can switch off all system power after command from control system.

  9. Autonomously managed electrical power systems

    Science.gov (United States)

    Callis, Charles P.

    1986-01-01

    The electric power systems for future spacecraft such as the Space Station will necessarily be more sophisticated and will exhibit more nearly autonomous operation than earlier spacecraft. These new power systems will be more reliable and flexible than their predecessors offering greater utility to the users. Automation approaches implemented on various power system breadboards are investigated. These breadboards include the Hubble Space Telescope power system test bed, the Common Module Power Management and Distribution system breadboard, the Autonomusly Managed Power System (AMPS) breadboard, and the 20 kilohertz power system breadboard. Particular attention is given to the AMPS breadboard. Future plans for these breadboards including the employment of artificial intelligence techniques are addressed.

  10. High-Efficiency Power Module

    Science.gov (United States)

    Simons, Rainee N. (Inventor); Wintucky, Edwin G. (Inventor)

    2015-01-01

    One or more embodiments of the present invention pertain to an all solid-state microwave power module. The module includes a plurality of solid-state amplifiers configured to amplify a signal using a low power stage, a medium power stage, and a high power stage. The module also includes a power conditioner configured to activate a voltage sequencer (e.g., bias controller) when power is received from a power source. The voltage sequencer is configured to sequentially apply voltage to a gate of each amplifier and sequentially apply voltage to a drain of each amplifier.

  11. Social Power, Law and Society

    Directory of Open Access Journals (Sweden)

    Saulo Casali Bahia

    2016-10-01

    Full Text Available The article aims to discuss some aspects of the formal centers of social power. Thus, it seeks to answer how power becomes institutionalized in formal social organizations; what is the source of political power and how it is converted into institutions of governance; how legal power is generated by society and how it grows; what is the relationship between legal power and those who are governed; what is the role of the legal system and human rights in fostering the distribution of social power; and how a society has enhanced access to and equitable distribution of power in recent centuries.

  12. Free-space power transmission

    Energy Technology Data Exchange (ETDEWEB)

    1989-11-01

    NASA Lewis Research Center organized a workshop on technology availability for free-space power transmission (beam power). This document contains a collection of viewgraph presentations that describes the effort by academia, industry, and the national laboratories in the area of high-frequency, high-power technology applicable to free-space power transmission systems. The areas covered were rectenna technology, high-frequency, high-power generation (gyrotrons, solar pumped lasers, and free electron lasers), and antenna technology.

  13. High Power Amplifier and Power Supply

    Science.gov (United States)

    Duong, Johnny; Stride, Scot; Harvey, Wayne; Haque, Inam; Packard, Newton; Ng, Quintin; Ispirian, Julie Y.; Waian, Christopher; Janes, Drew

    2008-01-01

    A document discusses the creation of a high-voltage power supply (HVPS) that is able to contain voltages up to -20 kV, keep electrical field strengths to below 200 V/mil (approximately equal to 7.87 kV/mm), and can provide a 200-nanosecond rise/fall time focus modulator swinging between cathode potential of 16.3 kV and -19.3 kV. This HVPS can protect the 95-GHz, pulsed extended interaction klystron (EIK) from arcs/discharges from all sources, including those from within the EIK fs vacuum envelope. This innovation has a multi-winding pulse transformer design, which uses new winding techniques to provide the same delays and rise/fall times (less than 10 nanoseconds) at different potential levels ranging from -20 kV to -16 kV. Another feature involves a high-voltage printed-wiring board that was corona-free at -20 kV DC with a 3- kV AC swing. The corona-free multilayer high-voltage board is used to simulate fields of less than 200 V/mil (approximately equal to 7.87 kV/mm) at 20 kV DC. Drive techniques for the modulator FETs (field-effect transistors) (four to 10 in a series) were created to change states (3,000-V swing) without abrupt steps, while still maintaining required delays and transition times. The packing scheme includes a potting mold to house a ten-stage modulator in the space that, in the past, only housed a four-stage modulator. Problems keeping heat down were solved using aluminum oxide substrate in the high-voltage section to limit temperature rise to less than 10 while withstanding -20 kV DC voltage and remaining corona-free.

  14. Comprehensive Power Losses Model for Electronic Power Transformer

    DEFF Research Database (Denmark)

    Yue, Quanyou; Li, Canbing; Cao, Yijia

    2018-01-01

    The electronic power transformer (EPT) has highe rpower losses than the conventional transformer. However, the EPT can correct the power factor, compensate the unbalanced current and reduce the line power losses in the distribution network.Therefore, the higher losses of the EPT and the consequent......-losses and considering the impact of the non-unity power factor and the three-phase unbalanced current, the overall power losses in the distribution network when using the EPT to replace the conventional transformer is analyzed, and the conditions in which the application of the EPT can cause less power losses...... reduced power losses in the distribution network require a comprehensive consideration when comparing the power losses of theEPT and conventional transformer. In this paper, a comprehensive power losses analysis model for the EPT in distribution networks is proposed. By analyzing the EPT self...

  15. Power marketers flex at FERC

    Energy Technology Data Exchange (ETDEWEB)

    Garner, W.L.; Burkhart, L.A.

    1995-02-01

    Electric utilities beware. Power marketers are not only here to stay, but their ranks are growing. The Federal Energy Regulatory Commission (FERC) logged approximately 81 applications in 1994, compared to nine in 1993. About half have been acted on already. The fledgling industry is also staking out its regulatory territory. Notably, on December 14, the FERC ordered the Tennessee Valley Authority (TVA) to provide nonfirm transmission service to AES Power Inc. of Atlanta, GA, a power marketing subsidiary of AES Corp.-to accommodate AES Power`s current and future bulk-power marketing transactions (Docket No. TX94-7-000). This marks the first time the FERC has granted a power marketer`s request to require wheeling from a federal power agency. As a power marketer, AES Power takes title to electric power that it purchases and sells for resale, thus qualifying as a public utility under the Federal Power Act. In its filing, AES Power sought nonfirm, point-to-point transmission service under an umbrella agreement that would establish the rates, terms, and conditions under which AES could request specific transactions without applying under section 211 each time. AES Power also sought assurances that it would not be charged more than other parties, including TVA itself, for comparable service. The power marketer agreed to be subject to a postage-stamp ceiling rate that gives TVA the flexibility to quote any rate up to the ceiling.

  16. An accurate autonomous islanding microgrid reactive power, imbalance power and harmonic power sharing scheme

    DEFF Research Database (Denmark)

    He, Jinwei; Li, Yun Wei; Blaabjerg, Frede

    2013-01-01

    To address inaccurate power sharing problems in autonomous islanding microgrids, an enhanced droop control method through adaptive virtual impedance adjustment is proposed. First, a term associated with DG reactive power, imbalance power or harmonic power is added to the conventional real power......-frequency droop control. The transient real power variations caused by this additional term are captured to realize DG series virtual impedance tuning. With the regulation of DG virtual impedance at fundamental positive sequence, fundamental negative sequence, and harmonic frequencies, an accurate power sharing...

  17. PowerFactory applications for power system analysis

    CERN Document Server

    Gonzalez-Longatt, Francisco

    2014-01-01

    This book presents a comprehensive set of guidelines and applications of DIgSILENT PowerFactory, an advanced power system simulation software package, for different types of power systems studies. Written by specialists in the field, it combines expertise and years of experience in the use of DIgSILENT PowerFactory with a deep understanding of power systems analysis. These complementary approaches therefore provide a fresh perspective on how to model, simulate and analyse power systems. It presents methodological approaches for modelling of system components, including both classical and non-

  18. The electric power engineering handbook power system stability and control

    CERN Document Server

    Grisby, Leonard L

    2012-01-01

    With contributions from worldwide leaders in the field, Power System Stability and Control, Third Edition (part of the five-volume set, The Electric Power Engineering Handbook) updates coverage of recent developments and rapid technological growth in essential aspects of power systems. Edited by L.L. Grigsby, a respected and accomplished authority in power engineering, and section editors Miroslav Begovic, Prabha Kundur, and Bruce Wollenberg, this reference presents substantially new and revised content. Topics covered include: * Power System Protection * Power System Dynamics and Stability *

  19. Concentrating Solar Power

    Energy Technology Data Exchange (ETDEWEB)

    Weinstein, Lee A.; Loomis, James; Bhatia, Bikram; Bierman, David M.; Wang, Evelyn N.; Chen, Gang

    2015-12-09

    Solar energy is a bountiful renewable energy resource: the energy in the sunlight that reaches Earth in an hour exceeds the energy consumed by all of humanity in a year.(1) While the phrase “solar energy conversion” probably brings photovoltaic (PV) cells to mind first, PV is not the only option for generating electricity from sunlight. Another promising technology for solar energy conversion is solar–thermal conversion, commonly referred to as concentrating solar power (CSP).(2) The first utility-scale CSP plants were constructed in the 1980s, but in the two decades that followed, CSP saw little expansion.(3, 4) More recent years, however, have seen a CSP renaissance due to unprecedented growth in the adoption of CSP.(3, 5) Photographs of two operating CSP plants, a parabolic trough collector plant and a central receiver (or “power tower”), are shown here.

  20. The Power of Hybridization

    CERN Multimedia

    CERN. Geneva

    2011-01-01

    Programming languages always seem to do some things well but not others: Python punts when it comes to user interfaces, Java’s artificial complexity prevents rapid development and produces tangles, and it will be awhile before we see benefits from C++ concurrency work. The cognitive load of languages and their blind spots increases the cost of experimentation, impeding your ability to fail fast and iterate. If you use a single language to solve your problem, you are binding yourself to the worldview limitations and the mistakes made by the creator of that language. Consider increasing your wiggle room by crossing language boundaries, complementing a language that is powerful in one area with a different language powerful in another. Language hybridization can speed development to quickly discover your real problems, giving you more time to fix them. After making a case for hybridizing your thinking in general, I will present a number of simple examples; first showing the benefits of using other languages...