WorldWideScience

Sample records for vhf frequency range

  1. High-resolution observation of field-aligned irregularities in the ionosphere using multi-frequency range imaging of VHF atmospheric radar

    Science.gov (United States)

    Chen, Jenn-Shyong; Furumoto, Jun-ichi; Su, Ching-Lun; Chu, Yen-Hsyang

    Field-aligned irregularity (FAI) in the ionosphere is a topic of interest to atmospheric radar community. In addition to the field-aligned characteristic, quasi-periodic (QP) appearance of FAI echoes has been observed frequently by very-high-frequency (VHF) atmospheric radar. The occurrence range of QP FAI echoes changes with time, and the slope of range versus time can be positive or negative, depending on occurrence time of the echoes. Several mechanisms responsible for the QP FAI echoes have been proposed, e.g., modulation in altitude by a passing atmospheric gravity wave, semidiurnal neutral-wind variation, and so on. Owing to the finite pulse length of radar in observation, the range resolution of measurement is limited within hundreds of meters. In view of this, the range imaging (RIM) using multiple frequencies has been employed to improve the range resolution of measurement. The multi-frequency technique transmits a set of slightly different frequencies sequentially during each radar pulse, and the radar returns at different transmitting frequencies are received, respectively. With adaptive retrieval algorithms for these radar returns, it is capable of resolving the echo structures at meter scale in the range direction. RIM has been employed in the lower atmosphere successfully. In this study, the performance of RIM for FAI was first carried out with the Middle and Upper atmosphere Radar (46 MHz; 34.85(°) N, 136.10(°) N; Japan) and the Chung-Li VHF radar (52 MHz; 24.9(°) N, 121.1(°) E; Taiwan). Some initial results of high-resolution FAI echoes within the range gate will be shown.

  2. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  3. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  4. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  5. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  6. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  7. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  8. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  9. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  10. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  11. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  12. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  13. Active laser ranging with frequency transfer using frequency comb

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hongyuan; Wei, Haoyun; Yang, Honglei; Li, Yan, E-mail: liyan@mail.tsinghua.edu.cn [State Key Laboratory of Precision Measurement Technology and Instruments, Department of Precision Instruments, Tsinghua University, Beijing 100084 (China)

    2016-05-02

    A comb-based active laser ranging scheme is proposed for enhanced distance resolution and a common time standard for the entire system. Three frequency combs with different repetition rates are used as light sources at the two ends where the distance is measured. Pulse positions are determined through asynchronous optical sampling and type II second harmonic generation. Results show that the system achieves a maximum residual of 379.6 nm and a standard deviation of 92.9 nm with 2000 averages over 23.6 m. Moreover, as for the frequency transfer, an atom clock and an adjustable signal generator, synchronized to the atom clock, are used as time standards for the two ends to appraise the frequency deviation introduced by the proposed system. The system achieves a residual fractional deviation of 1.3 × 10{sup −16} for 1 s, allowing precise frequency transfer between the two clocks at the two ends.

  14. Frequency ranges and attenuation of macroseismic effects

    Science.gov (United States)

    Tosi, Patrizia; De Rubeis, Valerio; Sbarra, Paola

    2017-09-01

    Macroseismic intensity is assessed on the basis of the effects caused by an earthquake. These effects reflect the expression of both the intensity and frequency of the ground motion, thus complicating prediction equation modelling. Here we analysed data of several macroseismic transitory effects caused by recent Italian earthquakes in order to study their attenuation as a function of magnitude and hypocentral distance and to obtain a specific prediction equation, of simple functional form, that could be applied to each of the effects under analysis. We found that the different attenuation behaviours could be clearly defined by the values of the specially formulated magnitude-distance scaling ratio (S), thus allowing to group the effects on the basis of the S value. The oscillation of hanging objects and liquids, together with the feeling of dizziness, were separated from most other variables, such as the effects of the earthquake on small objects, china and windows, which were caused by a vibration of higher frequency. Besides, the greater value of S, associated with the perception of the seismic sound, explained the peculiarity of this phenomenon. As a result, we recognized the frequency range associated with each effect through comparisons with the ground motion prediction equations and, in particular, with the 5 per cent damped horizontal response spectra. Here we show the importance of appropriately selecting the diagnostic elements to be used for intensity assessment in order to improve the correlation with ground motion.

  15. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  16. Characteristics of different frequency ranges in scanning electron microscope images

    Energy Technology Data Exchange (ETDEWEB)

    Sim, K. S., E-mail: kssim@mmu.edu.my; Nia, M. E.; Tan, T. L.; Tso, C. P.; Ee, C. S. [Faculty of Engineering and Technology, Multimedia University, 75450 Melaka (Malaysia)

    2015-07-22

    We demonstrate a new approach to characterize the frequency range in general scanning electron microscope (SEM) images. First, pure frequency images are generated from low frequency to high frequency, and then, the magnification of each type of frequency image is implemented. By comparing the edge percentage of the SEM image to the self-generated frequency images, we can define the frequency ranges of the SEM images. Characterization of frequency ranges of SEM images benefits further processing and analysis of those SEM images, such as in noise filtering and contrast enhancement.

  17. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  18. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  19. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  20. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  1. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  2. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  3. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  4. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  5. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  6. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  7. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  8. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  9. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  10. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  11. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  12. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  13. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  14. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  15. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  16. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  17. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  18. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  19. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  20. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  1. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  2. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  3. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  4. Discrete-time model reduction in limited frequency ranges

    Science.gov (United States)

    Horta, Lucas G.; Juang, Jer-Nan; Longman, Richard W.

    1991-01-01

    A mathematical formulation for model reduction of discrete time systems such that the reduced order model represents the system in a particular frequency range is discussed. The algorithm transforms the full order system into balanced coordinates using frequency weighted discrete controllability and observability grammians. In this form a criterion is derived to guide truncation of states based on their contribution to the frequency range of interest. Minimization of the criterion is accomplished without need for numerical optimization. Balancing requires the computation of discrete frequency weighted grammians. Close form solutions for the computation of frequency weighted grammians are developed. Numerical examples are discussed to demonstrate the algorithm.

  5. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  6. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  7. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  8. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  9. Energy based correlation criteria in the mid-frequency range

    Science.gov (United States)

    Biedermann, J.; Winter, R.; Wandel, M.; Böswald, M.

    2017-07-01

    Aircraft structures are characterized by their lightweight design. As such, they are prone to vibrations. Numerical models based on the Finite Element Method often show significant deviations when the mid-frequency range is considered, where strong interaction between vibrations and acoustics is present. Model validation based on experimental modal data is often not possible due to the high modal density that aircraft fuselage structures exhibit in this frequency range. Classical correlation criteria like the Modal Assurance Criterion require mode shapes and can therefore not be applied. Other correlation criteria using frequency response data, such as the Frequency Domain Assurance Criterion, are highly sensitive to even small structural modifications and fail to indicated the correlation between test and analysis data in the mid-frequency range. Nevertheless, validated numerical models for the mid- to high-frequency ranges are a prerequisite for acoustic comfort predictions of aircraft cabin. This paper presents a new method for the correlation of response data from test and analysis in the mid-frequency range to support model validation in the mid-frequency range and to enable the usage of finite element models in this frequency range. The method is validated on a stiffened cylindrical shell structure, which represents a scale-model of an aircraft fuselage. The correlation criterion presented here is inspired by Statistical Energy Analysis and is based on kinetic energies integrated over frequency bands and spatially integrated over surface areas of the structure. The objective is to indicate frequency bands where the finite element model needs to be adjusted to better match with experimental observations and to locate the areas where these adjustments should be applied.

  10. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  11. Predicting Achievable Fundamental Frequency Ranges in Vocalization Across Species.

    Directory of Open Access Journals (Sweden)

    Ingo Titze

    2016-06-01

    Full Text Available Vocal folds are used as sound sources in various species, but it is unknown how vocal fold morphologies are optimized for different acoustic objectives. Here we identify two main variables affecting range of vocal fold vibration frequency, namely vocal fold elongation and tissue fiber stress. A simple vibrating string model is used to predict fundamental frequency ranges across species of different vocal fold sizes. While average fundamental frequency is predominantly determined by vocal fold length (larynx size, range of fundamental frequency is facilitated by (1 laryngeal muscles that control elongation and by (2 nonlinearity in tissue fiber tension. One adaptation that would increase fundamental frequency range is greater freedom in joint rotation or gliding of two cartilages (thyroid and cricoid, so that vocal fold length change is maximized. Alternatively, tissue layers can develop to bear a disproportionate fiber tension (i.e., a ligament with high density collagen fibers, increasing the fundamental frequency range and thereby vocal versatility. The range of fundamental frequency across species is thus not simply one-dimensional, but can be conceptualized as the dependent variable in a multi-dimensional morphospace. In humans, this could allow for variations that could be clinically important for voice therapy and vocal fold repair. Alternative solutions could also have importance in vocal training for singing and other highly-skilled vocalizations.

  12. Inexpensive automatic ranging for digital voltmeters and frequency counters

    Science.gov (United States)

    Roller, R. F.

    1970-01-01

    Seven integrated circuits incorporated at very low cost into frequency counters and digital voltmeters performing a voltage-to-frequency conversion permit automatic range changing. Extra decades are switched into and out of the counting chain as a function of the counter during the previous counting period.

  13. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  14. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  15. Chaotic Colpitts Oscillator for the Ultrahigh Frequency Range

    DEFF Research Database (Denmark)

    Tamasevicius, A.; Mykolaitis, G.; Bumeliene, S.

    2006-01-01

    . Simulations indicate that chaotic oscillations observed experimentally at higher frequencies, e.g., at about 1000MHz are caused by parasites, like wiring inductances, loss resistance appearing due to skin effect, and collector-emitter capacitance of the transistor. Reliable and reproducible chaos can......PSpice simulation and experimental results demonstrating chaotic performance of the Colpitts oscillator in the ultrahigh frequency (300–1000 MHz) range are presented.Various combinations of the resonance tank parameters are considered to achieve a fundamental frequency as high as possible...... be generated at fundamental frequencies up to about 500MHz with the single-stage Colpitts oscillator using the microwave 9 GHz bipolar junction transistors....

  16. Bearing fault detection in the acoustic emission frequency range

    Science.gov (United States)

    Tavakoli, Massoud S.

    The effectiveness of using bearing fault detection in the acoustic-emission frequency range is demonstrated using a vertical milling machine as the testbed. The experimental testbed is monitored by an accelerometer and an acoustic emission sensor, and the signals are demodulated by rms enveloping and then fast-Fourier-transformed. The analytical computation of the defect characteristic frequency is explained, and the time histories are given of the enveloped signal and its spectrum. The method is shown to be useful for extracting the repetition rate of the repetitive component of the general signal, and the signal generated by the bearing defect is identified in the frequency ranges of mechanical vibration and acoustic emission. The signal in the acoustic-emission frequency range is shown to be helpful for detecting bearing defects because it not affected by repetitive mechanical noise.

  17. Cross-Linguistic Differences in Bilinguals' Fundamental Frequency Ranges

    Science.gov (United States)

    Ordin, Mikhail; Mennen, Ineke

    2017-01-01

    Purpose: We investigated cross-linguistic differences in fundamental frequency range (FFR) in Welsh-English bilingual speech. This is the first study that reports gender-specific behavior in switching FFRs across languages in bilingual speech. Method: FFR was conceptualized as a behavioral pattern using measures of span (range of fundamental…

  18. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  19. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  20. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  1. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  2. Experimental Limits on Gravitational Waves in the MHz frequency Range

    Energy Technology Data Exchange (ETDEWEB)

    Lanza, Robert Jr. [Univ. of Chicago, IL (United States)

    2015-03-01

    This thesis presents the results of a search for gravitational waves in the 1-11MHz frequency range using dual power-recycled Michelson laser interferometers at Fermi National Accelerator Laboratory. An unprecedented level of sensitivity to gravitational waves in this frequency range has been achieved by cross-correlating the output fluctuations of two identical and colocated 40m long interferometers. This technique produces sensitivities better than two orders of magnitude below the quantum shot-noise limit, within integration times of less than 1 hour. 95% confidence level upper limits are placed on the strain amplitude of MHz frequency gravitational waves at the 10-21 Hz-1/2 level, constituting the best direct limits to date at these frequencies. For gravitational wave power distributed over this frequency range, a broadband upper limit of 2.4 x 10-21Hz-1/2 at 95% confidence level is also obtained. This thesis covers the detector technology, the commissioning and calibration of the instrument, the statistical data analysis, and the gravitational wave limit results. Particular attention is paid to the end-to-end calibration of the instrument’s sensitivity to differential arm length motion, and so to gravitational wave strain. A detailed statistical analysis of the data is presented as well.

  3. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  4. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  5. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  6. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  7. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  8. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  9. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  10. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  11. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  12. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  13. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  14. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  15. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  16. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  17. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  18. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  19. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  20. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  1. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  2. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  3. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  4. A range-rate extraction unit for determining Doppler effect

    Science.gov (United States)

    1970-01-01

    Active ranging technique devised for VHF or S-band radar systems divides target Doppler frequency by counter-generated number that is proportional to transmitting frequency, thus producing target velocity data in terms of speed and distance relative to target transponder.

  5. Dielectric characterization of materials at microwave frequency range

    Directory of Open Access Journals (Sweden)

    J. de los Santos

    2003-01-01

    Full Text Available In this study a coaxial line was used to connect a microwave-frequency Network Analyzer and a base moving sample holder for dielectric characterization of ferroelectric materials in the microwave range. The main innovation of the technique is the introduction of a special sample holder that eliminates the air gap effect by pressing sample using a fine pressure system control. The device was preliminary tested with alumina (Al2O3 ceramics and validated up to 2 GHz. Dielectric measurements of lanthanum and manganese modified lead titanate (PLTM ceramics were carried out in order to evaluate the technique for a high permittivity material in the microwave range. Results showed that such method is very useful for materials with high dielectric permittivities, which is generally a limiting factor of other techniques in the frequency range from 50 MHz to 2 GHz.

  6. Tunable and Broadband Differential Phase Sections in Terahertz Frequency Range

    Science.gov (United States)

    Kosiak, O. S.; Bezborodov, V. I.; Kuleshov, Ye. M.; Nesterov, P. K.

    2016-12-01

    Purpose: Studying the quasioptical tunable and broadband differential phase section (DPS) consisting of several birefringent elements (BE) on the basis of form birefringence effect. Design/methodology/approach: Using the polarization scattering matrix method, the impact of the mutual rotation axis of anisotropy of several BE by the amount of phase shift and the position of the plane of anisotropy of resulting DPS is considered. Findings: The DPS tunable in a wide range are shown to be possibly implemented in the case of quarter- wave DPS of two, and in the case of half-wave DPS of three, identical non-tunable BE. The analysis has shown to the possibility of creating a broadband quarter-wave and half-wave DPS. Conclusions: Experimental research has confirmed the possibility of constructing a tunable and broadband DPS. On this basis, tunable and broadband polarization converters, rotators of polarization plane, polarization phase shifters and frequency shifters in the terahertz frequency range can be created.

  7. Optical properties of human nails in THz frequency range

    Science.gov (United States)

    Guseva, Victoria A.; Gusev, Sviatoslav I.; Demchenko, Petr S.; Sedykh, Egor A.; Khodzitsky, Mikhail K.

    2017-03-01

    This work is devoted to investigation of optical properties (dispersion of refractive index, permittivity and absorption coefficient) of human nails in THz frequency range. These data were obtained by THz time-domain spectroscopy (TDS) technique in transmission mode. These results may be used to develop non-invasive technique of human pathologies control using nail as reference sample in reflection mode of THz TDS.

  8. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  9. 47 CFR 87.263 - Frequencies.

    Science.gov (United States)

    2010-10-01

    ... operating in support of offshore drilling operations in open sea areas beyond the range of VHF propagation... concerning runway, wind or weather conditions during the operating hours of a unicom. kHz 3449.0 5472.0 5167... Alaska. No airborne operations are permitted. Peak envelope power of stations operating on this frequency...

  10. Range and Frequency of Africanized Honey Bees in California (USA.

    Directory of Open Access Journals (Sweden)

    Yoshiaki Kono

    Full Text Available Africanized honey bees entered California in 1994 but few accounts of their northward expansion or their frequency relative to European honey bees have been published. We used mitochondrial markers and morphometric analyses to determine the prevalence of Africanized honeybees in San Diego County and their current northward progress in California west of the Sierra Nevada crest. The northernmost African mitotypes detected were approximately 40 km south of Sacramento in California's central valley. In San Diego County, 65% of foraging honey bee workers carry African mitochondria and the estimated percentage of Africanized workers using morphological measurements is similar (61%. There was no correlation between mitotype and morphology in San Diego County suggesting Africanized bees result from bidirectional hybridization. Seventy percent of feral hives, but only 13% of managed hives, sampled in San Diego County carried the African mitotype indicating that a large fraction of foraging workers in both urban and rural San Diego County are feral. We also found a single nucleotide polymorphism at the DNA barcode locus COI that distinguishes European and African mitotypes. The utility of this marker was confirmed using 401 georeferenced honey bee sequences from the worldwide Barcode of Life Database. Future censuses can determine whether the current range of the Africanized form is stable, patterns of introgression at nuclear loci, and the environmental factors that may limit the northern range of the Africanized honey bee.

  11. Long range ultra-high frequency (UHF) radio frequency identification (RFID) antenna design

    Science.gov (United States)

    Reynolds, Nathan D.

    There is an ever-increasing demand for radio frequency identification (RFID) tags that are passive, long range, and mountable on multiple surfaces. Currently, RFID technology is utilized in numerous applications such as supply chain management, access control, and public transportation. With the combination of sensory systems in recent years, the applications of RFID technology have been extended beyond tracking and identifying. This extension includes applications such as environmental monitoring and healthcare applications. The available sensory systems usually operate in the medium or high frequency bands and have a low read range. However, the range limitations of these systems are being overcome by the development of RFID sensors focused on utilizing tags in the ultra-high frequency (UHF) band. Generally, RFID tags have to be mounted to the object that is being identified. Often the objects requiring identification are metallic. The inherent properties of metallic objects have substantial effects on nearby electromagnetic radiation; therefore, the operation of the tag antenna is affected when mounted on a metallic surface. This outlines one of the most challenging problems for RFID systems today: the optimization of tag antenna performance in a complex environment. In this research, a novel UHF RFID tag antenna, which has a low profile, long range, and is mountable on metallic surfaces, is designed analytically and simulated using a 3-D electromagnetic simulator, ANSYS HFSS. A microstrip patch antenna is selected as the antenna structure, as patch antennas are low profile and suitable for mounting on metallic surfaces. Matching and theoretical models of the microstrip patch antenna are investigated. Once matching and theory of a microstrip patch antenna is thoroughly understood, a unique design technique using electromagnetic band gap (EBG) structures is explored. This research shows that the utilization of an EBG structure in the patch antenna design yields

  12. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  13. A wide-frequency-range air-jet shaker

    Science.gov (United States)

    Herr, Robert W

    1957-01-01

    This paper presents a description of a simple air-jet shaker. Its force can be calibrated statically and appears to be constant with frequency. It is relatively easy to use, and it has essentially massless characteristics. This shaker is applied to define the unstable branch of a frequency-response curve obtained for a nonlinear spring with a single degree of freedom.

  14. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  15. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  16. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  17. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  18. Very High Frequency Half Bridge DC/DC Converter

    DEFF Research Database (Denmark)

    Madsen, Mickey Pierre; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    This paper presents the first, off chip, class DE (resonant half bridge) converter working in the Very High Frequency (VHF) range. The benefits of using half bridge circuits both in the inverter and rectifier part of a VHF resonant dc/dc converter are analyzed and design equations for all...... components in the power stage are given. The circuit has been simulated to verify the accuracy of the presented equations and an efficiency of 89% has been shown. A prototype has been implemented with self-oscillating resonant gate drives driving the switches. The prototype has been used to drive an LED...

  19. Intensity autocorrelation measurements of frequency combs in the terahertz range

    Science.gov (United States)

    Benea-Chelmus, Ileana-Cristina; Rösch, Markus; Scalari, Giacomo; Beck, Mattias; Faist, Jérôme

    2017-09-01

    We report on direct measurements of the emission character of quantum cascade laser based frequency combs, using intensity autocorrelation. Our implementation is based on fast electro-optic sampling, with a detection spectral bandwidth matching the emission bandwidth of the comb laser, around 2.5 THz. We find the output of these frequency combs to be continuous even in the locked regime, but accompanied by a strong intensity modulation. Moreover, with our record temporal resolution of only few hundreds of femtoseconds, we can resolve correlated intensity modulation occurring on time scales as short as the gain recovery time, about 4 ps. By direct comparison with pulsed terahertz light originating from a photoconductive emitter, we demonstrate the peculiar emission pattern of these lasers. The measurement technique is self-referenced and ultrafast, and requires no reconstruction. It will be of significant importance in future measurements of ultrashort pulses from quantum cascade lasers.

  20. Range-based covariance estimation using high-frequency data: The realized co-range

    NARCIS (Netherlands)

    K. Bannouh (Karim); D.J.C. van Dijk (Dick); M.P.E. Martens (Martin)

    2008-01-01

    textabstractWe introduce the realized co-range, utilizing intraday high-low price ranges to estimate asset return covariances. Using simulations we find that for plausible levels of bid-ask bounce and infrequent and non-synchronous trading the realized co-range improves upon the realized covariance,

  1. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  2. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  3. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  4. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  5. Bendable, low-loss Topas fibers for the terahertz frequency range

    DEFF Research Database (Denmark)

    Nielsen, Kristian; Rasmussen, Henrik K.; Adam, Aurèle J.L.

    2009-01-01

    structure proves that the fiber is single-moded over a wide frequency range, and we see the onset of higher-order modes at high frequencies as well as indication of microporous guiding at low frequencies and high porosity of the fiber. Transmission spectroscopy demonstrates low-loss propagation (

  6. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  7. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  8. Effect of skin dielectric properties on the read range of epidermal ultra-high frequency radio-frequency identification tags.

    Science.gov (United States)

    Oyeka, Dumtoochukwu O; Batchelor, John C; Ziai, Ali Mohamad

    2017-04-01

    This Letter presents an investigation of the effect of human tissue conductivity and permittivity on the performance of epidermal transfer tattoo ultra-high frequency radio-frequency identification (RFID) tags. The measurements were carried out on 20 individuals and the variations in the measured dielectric properties correlate well with variations in the measured tag read range on the individuals and to a lesser extent with their body mass index values. Simulation results also showed the effects of permittivity and conductivity on the designed resonance frequency of the RFID tag.

  9. Effect of skin dielectric properties on the read range of epidermal ultra-high frequency radio-frequency identification tags

    Science.gov (United States)

    Batchelor, John C.; Ziai, Ali Mohamad

    2017-01-01

    This Letter presents an investigation of the effect of human tissue conductivity and permittivity on the performance of epidermal transfer tattoo ultra-high frequency radio-frequency identification (RFID) tags. The measurements were carried out on 20 individuals and the variations in the measured dielectric properties correlate well with variations in the measured tag read range on the individuals and to a lesser extent with their body mass index values. Simulation results also showed the effects of permittivity and conductivity on the designed resonance frequency of the RFID tag. PMID:28461902

  10. Extending the Effective Ranging Depth of Spectral Domain Optical Coherence Tomography by Spatial Frequency Domain Multiplexing

    Directory of Open Access Journals (Sweden)

    Tong Wu

    2016-11-01

    Full Text Available We present a spatial frequency domain multiplexing method for extending the imaging depth range of a spectral domain optical coherence tomography (SDOCT system without any expensive device. This method uses two galvo scanners with different pivot-offset distances in two independent reference arms for spatial frequency modulation and multiplexing. The spatial frequency contents corresponding to different depth regions of the sample can be shifted to different frequency bands. The spatial frequency domain multiplexing SDOCT system provides an approximately 1.9-fold increase in the effective ranging depth compared with that of a conventional full-range SDOCT system. The reconstructed images of phantom and biological tissue demonstrate the expected increase in ranging depth. The parameters choice criterion for this method is discussed.

  11. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  12. Optical conductivity of warm dense matter in wide frequency range within quantum statistical and kinetic approach

    CERN Document Server

    Veysman, M; Winkel, M; Reinholz, H

    2016-01-01

    Fundamental properties of warm dense matter are described by the dielectric function, which gives access to the frequency-dependent electrical conductivity, absorption, emission and scattering of radiation, charged particles stopping and further macroscopic properties. Different approaches to the dielectric function and the related dynamical collision frequency are compared in a wide frequency range. The high-frequency limit describing inverse bremsstrahlung and the low-frequency limit of the dc conductivity are considered. Sum rules and Kramers-Kronig relation are checked for the generalized linear response theory and the standard approach following kinetic theory. The results are discussed in application to aluminum, xenon and argon plasmas.

  13. Buried Object Detection Method Using Optimum Frequency Range in Extremely Shallow Underground

    Science.gov (United States)

    Sugimoto, Tsuneyoshi; Abe, Touma

    2011-07-01

    We propose a new detection method for buried objects using the optimum frequency response range of the corresponding vibration velocity. Flat speakers and a scanning laser Doppler vibrometer (SLDV) are used for noncontact acoustic imaging in the extremely shallow underground. The exploration depth depends on the sound pressure, but it is usually less than 10 cm. Styrofoam, wood (silver fir), and acrylic boards of the same size, different size styrofoam boards, a hollow toy duck, a hollow plastic container, a plastic container filled with sand, a hollow steel can and an unglazed pot are used as buried objects which are buried in sand to about 2 cm depth. The imaging procedure of buried objects using the optimum frequency range is given below. First, the standardized difference from the average vibration velocity is calculated for all scan points. Next, using this result, underground images are made using a constant frequency width to search for the frequency response range of the buried object. After choosing an approximate frequency response range, the difference between the average vibration velocity for all points and that for several points that showed a clear response is calculated for the final confirmation of the optimum frequency range. Using this optimum frequency range, we can obtain the clearest image of the buried object. From the experimental results, we confirmed the effectiveness of our proposed method. In particular, a clear image of the buried object was obtained when the SLDV image was unclear.

  14. Optimal frequency range for medical radar measurements of human heartbeats using body-contact radar.

    Science.gov (United States)

    Brovoll, Sverre; Aardal, Øyvind; Paichard, Yoann; Berger, Tor; Lande, Tor Sverre; Hamran, Svein-Erik

    2013-01-01

    In this paper the optimal frequency range for heartbeat measurements using body-contact radar is experimentally evaluated. A Body-contact radar senses electromagnetic waves that have penetrated the human body, but the range of frequencies that can be used are limited by the electric properties of the human tissue. The optimal frequency range is an important property needed for the design of body-contact radar systems for heartbeat measurements. In this study heartbeats are measured using three different antennas at discrete frequencies from 0.1 - 10 GHz, and the strength of the received heartbeat signal is calculated. To characterize the antennas, when in contact with the body, two port S-parameters(†) are measured for the antennas using a pork rib as a phantom for the human body. The results shows that frequencies up to 2.5 GHz can be used for heartbeat measurements with body-contact radar.

  15. A current drive by using the fast wave in frequency range higher than two timeslower hybrid resonance frequency on tokamaks

    Directory of Open Access Journals (Sweden)

    Kim Sun Ho

    2017-01-01

    Full Text Available An efficient current drive scheme in central or off-axis region is required for the steady state operation of tokamak fusion reactors. The current drive by using the fast wave in frequency range higher than two times lower hybrid resonance (w>2wlh could be such a scheme in high density, high temperature reactor-grade tokamak plasmas. First, it has relatively higher parallel electric field to the magnetic field favorable to the current generation, compared to fast waves in other frequency range. Second, it can deeply penetrate into high density plasmas compared to the slow wave in the same frequency range. Third, parasitic coupling to the slow wave can contribute also to the current drive avoiding parametric instability, thermal mode conversion and ion heating occured in the frequency range w<2wlh. In this study, the propagation boundary, accessibility, and the energy flow of the fast wave are given via cold dispersion relation and group velocity. The power absorption and current drive efficiency are discussed qualitatively through the hot dispersion relation and the polarization. Finally, those characteristics are confirmed with ray tracing code GENRAY for the KSTAR plasmas.

  16. Motion Compensation of Moving Targets for High Range Resolution Stepped-Frequency Radar

    Directory of Open Access Journals (Sweden)

    Xiqin Wang

    2008-05-01

    Full Text Available High range resolution (HRR profiling using stepped-frequency pulse trains suffers from range shift and the attenuation/dispersion of range profiles while the target of interest is moving. To overcome these two drawbacks, a new algorithm based on the maximum likelihood (ML estimation is proposed in this paper. Without altering the conventional stepped-frequency waveform, this algorithm can estimate the target velocity and thereby compensate the phase errors caused by the target’s motion. It is shown that the velocity can be accurately estimated and the range profile can be correctly reconstructed.

  17. Thrombolysis using multi-frequency high intensity focused ultrasound at MHz range: an in vitro study.

    Science.gov (United States)

    Suo, Dingjie; Guo, Sijia; Lin, Weili; Jiang, Xiaoning; Jing, Yun

    2015-09-21

    High intensity focused ultrasound (HIFU) based thrombolysis has emerged as a promising drug-free treatment approach for ischemic stroke. The large amount of acoustic power required by this approach, however, poses a critical challenge to the future clinical translation. In this study, multi-frequency acoustic waves at MHz range (near 1.5 MHz) were introduced as HIFU excitations to reduce the required power for treatment as well as the treatment time. In vitro bovine blood clots weighing around 150 mg were treated by single-frequency and multi-frequency HIFU. The pulse length was 2 ms for all experiments except the ones where the duty cycle was changed. It was found that dual-frequency thrombolysis efficiency was statistically better than single-frequency under the same acoustic power and excitation condition. When varying the acoustic power but fixing the duty cycle at 5%, it was found that dual-frequency ultrasound can save almost 30% power in order to achieve the same thrombolysis efficiency. In the experiment where the duty cycle was increased from 0.5% to 10%, it was shown that dual-frequency ultrasound can achieve the same thrombolysis efficiency with only half of the duty cycle of single-frequency. Dual-frequency ultrasound could also accelerate the thrombolysis by a factor of 2-4 as demonstrated in this study. No significant differences were found between dual-frequencies with different frequency differences (0.025, 0.05, and 0.1 MHz) and between dual-frequency and triple-frequency. The measured cavitation doses of dual-frequency and triple-frequency excitations were at about the same level but both were significantly higher than that of single-frequency.

  18. Outdoor stocking density in free-range laying hens: radio-frequency identification of impacts on range use.

    Science.gov (United States)

    Campbell, D L M; Hinch, G N; Dyall, T R; Warin, L; Little, B A; Lee, C

    2017-01-01

    The number and size of free-range laying hen (Gallus gallus domesticus) production systems are increasing within Australia in response to consumer demand for perceived improvement in hen welfare. However, variation in outdoor stocking density has generated consumer dissatisfaction leading to the development of a national information standard on free-range egg labelling by the Australian Consumer Affairs Ministers. The current Australian Model Code of Practice for Domestic Poultry states a guideline of 1500 hens/ha, but no maximum density is set. Radio-frequency identification (RFID) tracking technology was used to measure daily range usage by individual ISA Brown hens housed in six small flocks (150 hens/flock - 50% of hens tagged), each with access to one of three outdoor stocking density treatments (two replicates per treatment: 2000, 10 000, 20 000 hens/ha), from 22 to 26, 27 to 31 and 32 to 36 weeks of age. There was some variation in range usage across the sampling periods and by weeks 32 to 36 individual hens from the lowest stocking density on average used the range for longer each day (Paccessed the range with 2% of tagged hens in each treatment never venturing outdoors and a large proportion that accessed the range daily (2000 hens/ha: 80.5%; 10 000 hens/ha: 66.5%; 20 000 hens/ha: 71.4%). On average, 38% to 48% of hens were seen on the range simultaneously and used all available areas of all ranges. These results of experimental-sized flocks have implications for determining optimal outdoor stocking densities for commercial free-range laying hens but further research would be needed to determine the effects of increased range usage on hen welfare.

  19. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  20. Ultrafast acoustics in the middle UV range: coherent phonons at higher frequencies and in smaller objects.

    Science.gov (United States)

    Ayrinhac, S; Devos, A; Le Louarn, A; Mante, P-A; Emery, P

    2010-10-15

    We show that the propagation of coherent acoustic phonons generated by femtosecond optical excitation can be clearly resolved using a probe laser in the middle UV (MUV) range. The MUV probe is easily produced from a high-repetition-rate femtosecond laser and a homemade frequency tripler. We present various experimental results that demonstrate efficient and high frequency detection of acoustic phonons. Thus, we show that the MUV range offers a unique way to reach higher frequencies and probe smaller objects in ultrafast acoustics.

  1. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  2. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  3. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  4. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  5. Absorption properties of water-in-oil emulsions in the low THz frequency range

    DEFF Research Database (Denmark)

    Møller, Uffe; Folkenberg, Jacob Riis; Jepsen, Peter Uhd

    We use transmission THz spectroscopy to investigate the absorption properties of water-in-oil emulsions with water content varying in the 0-20% range, relevant for a range of food products. We find that at low frequencies the effective absorption coefficient of the emulsion is suppressed compared...

  6. Study on The Extended Range Weather Forecast of Low Frequency Signal Based on Period Analysis Method

    Science.gov (United States)

    Li, X.

    2016-12-01

    Although many studies have explored the MJO and its application for weather forecasting, low-frequency oscillation has been insufficiently studied for the extend range weather forecasting over middle and high latitudes. In China, low-frequency synoptic map is a useful tool for meteorological operation department to forecast extend range weather. It is therefore necessary to develop objective methods to serve the need for finding low-frequency signal, interpretation and application of this signal in the extend range weather forecasting. In this paper, method of Butterworth band pass filter was applied to get low-frequency height field at 500hPa from 1980 to 2014 by using NCEP/NCAR daily grid data. Then period analysis and optimal subset regression methods were used to process the low frequency data of 150 days before the first forecast day and extend the low frequency signal of 500hPa low-frequency high field to future 30 days in the global from June to August during 2011-2014. Finally, the results were test. The main results are as follows: (1) In general, the fitting effect of low frequency signals of 500hPa low-frequency height field by period analysis in the northern hemisphere was better than that in the southern hemisphere, and was better in the low latitudes than that in the high latitudes. The fitting accuracy gradually reduced with the increase of forecast time length, which tended to be stable during the late forecasting period. (2) The fitting effects over the 6 key regions in China showed that except filtering result over Xinjiang area in the first 10 days and 30 days, filtering results over the other 5 key regions throughout the whole period have passed reliability test with level more than 95%. (3) The center and scope of low and high low frequency systems can be fitted well by using the methods mentioned above, which is consist with the corresponding use of the low-frequency synoptic map for the prediction of the extended period. Application of the

  7. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  8. The BDS Triple Frequency Pseudo-range Correlated Stochastic Model of Single Station Modeling Method

    Directory of Open Access Journals (Sweden)

    HUANG Lingyong

    2017-05-01

    Full Text Available In order to provide a reliable pseudo-range stochastic model, a method is studied to estimate the BDS triple-frequency pseudo-range related stochastic model based on three BDS triple-frequency pseudo-range minus carrier (GIF combinations using the data of a single station. In this algorithm, the low order polynomial fitting method is used to fit the GIF combination in order to eliminate the error and other constants except non pseudo noise at first. And then, multiple linear regression analysis method is used to model the stochastic function of three linearly independent GIF combinations. Finally the related stochastic model of the original BDS triple-frequency pseudo-range observations is obtained by linear transformation. The BDS triple-frequency data verification results show that this algorithm can get a single station related stochastic model of BDS triple-frequency pseudo-range observation, and it is advantageous to provide accurate stochastic model for navigation and positioning and integrity monitoring.

  9. Floquet engineering of long-range p -wave superconductivity: Beyond the high-frequency limit

    Science.gov (United States)

    Li, Zeng-Zhao; Lam, Chi-Hang; You, J. Q.

    2017-10-01

    It has been shown that long-range p -wave superconductivity in a Kitaev chain can be engineered via an ac field with a high frequency [M. Benito et al., Phys. Rev. B 90, 205127 (2014), 10.1103/PhysRevB.90.205127]. For its experimental realization, however, theoretical understanding of Floquet engineering with a broader range of driving frequencies becomes important. In this paper, focusing on the ac-driven tunneling interactions of a Kitaev chain, we investigate effects from the leading correction to the high-frequency limit on the emergent p -wave superconductivity. Importantly, we find new engineered long-range p -wave pairing interactions that can significantly alter the ones in the high-frequency limit at long interaction ranges. We also find that the leading correction additionally generates nearest-neighbor p -wave pairing interactions with a renormalized pairing energy, long-range tunneling interactions, and, in particular, multiple pairs of Floquet Majorana edge states that are destroyed in the high-frequency limit.

  10. UTag: Long-range Ultra-wideband Passive Radio Frequency Tags

    Energy Technology Data Exchange (ETDEWEB)

    Dowla, F

    2007-03-14

    Long-range, ultra-wideband (UWB), passive radio frequency (RF) tags are key components in Radio Frequency IDentification (RFID) system that will revolutionize inventory control and tracking applications. Unlike conventional, battery-operated (active) RFID tags, LLNL's small UWB tags, called 'UTag', operate at long range (up to 20 meters) in harsh, cluttered environments. Because they are battery-less (that is, passive), they have practically infinite lifetimes without human intervention, and they are lower in cost to manufacture and maintain than active RFID tags. These robust, energy-efficient passive tags are remotely powered by UWB radio signals, which are much more difficult to detect, intercept, and jam than conventional narrowband frequencies. The features of long range, battery-less, and low cost give UTag significant advantage over other existing RFID tags.

  11. An atomic magnetometer with autonomous frequency stabilization and large dynamic range

    Energy Technology Data Exchange (ETDEWEB)

    Pradhan, S., E-mail: spradhan@barc.gov.in, E-mail: pradhans75@gmail.com; Poornima,; Dasgupta, K. [Laser and Plasma Technology Division, Bhabha Atomic Research Centre, Mumbai 85 (India); Homi Bhabha National Institute, Department of Atomic Energy, Mumbai 85 (India); Mishra, S.; Behera, R. [Laser and Plasma Technology Division, Bhabha Atomic Research Centre, Mumbai 85 (India)

    2015-06-15

    The operation of a highly sensitive atomic magnetometer using elliptically polarized resonant light is demonstrated. It is based on measurement of zero magnetic field resonance in degenerate two level systems using polarimetric detection. The transmitted light through the polarimeter is used for laser frequency stabilization, whereas reflected light is used for magnetic field measurement. Thus, the experimental geometry allows autonomous frequency stabilization of the laser frequency leading to compact operation of the overall device and has a preliminary sensitivity of <10 pT/Hz{sup 1/2} @ 1 Hz. Additionally, the dynamic range of the device is improved by feedback controlling the bias magnetic field without compromising on its sensitivity.

  12. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  13. Evaluation of the spectral fit algorithm as functions of frequency range and deltakaeff.

    Science.gov (United States)

    Bigelow, Timothy A; O'Brien, William D

    2005-11-01

    Considerable effort has been directed at quantifying the properties of the tissue microstructure (i.e., scatterer correlation length) to diagnose disease and monitor treatment. In vivo assessments have had limited success due to frequency-dependent attenuation along the propagation path (i.e., total attenuation) masking the frequency dependence of the scattering from the tissue microstructure. Previously, both total attenuation and scatterer correlation length, given by the effective radius, were solved simultaneously by a two-parameter minimization of the mean squared error between a reference spectrum, modified by the attenuation and scatterer effective radius, and the backscattered waveforms using an algorithm termed the spectral fit algorithm. Herein, the impact of frequency range (largest frequency minus smallest frequency) and deltakaeff (largest kaeff value minus smallest kaeff value; k is wave number and aeff is scatterer effective radius) used by the spectral fit algorithm on estimating the scatterer effective radius, and total attenuation was assessed by computer simulations while excluding frequencies of the backscattered power spectrum dominated by electronic noise. The simulations varied the effective radius of the scatterers (5 microm to 150 microm), the attenuation of the region (0 to 1 dB/cm-MHz), the bandwidth of the source, and the amount of electronic noise added to the radio frequency (rf) waveforms. The center frequency of the source was maintained at 8 MHz. Comparable accuracy and precision of the scatterer effective radius were obtained for all the simulations whenever the same deltakaeff was used to obtain the estimates. A deltakaeff of 1 gave an accuracy and precision of approximately 15% +/- 35%, and a width of 1.5 gave an accuracy and precision of approximately 5% +/- 15% consistently for all of the simulations. Similarly, the accuracy and precision of the total attenuation estimate were improved by increasing the frequency range used by

  14. The effects of tones on speaking frequency and intensity ranges in Mandarin and Min dialects

    Science.gov (United States)

    Chen, Sheng H.

    2005-05-01

    The differences of speaking frequency and intensity in different tonal dialects has not been widely investigated. The purposes of this study were (1) to compare the speaking frequency and speaking intensity ranges of Mandarin and Min and (2) to compare the speaking frequency and intensity ranges of Mandarin and Min to those of American English. The subjects were 80 normal Taiwanese adults divided into two dialect groups, Mandarin and Min. The speaking F0, the highest speaking F0, the lowest speaking F0, the maximum range of speaking F0, and the intensity counterpart were obtained from reading in their native dialects. Statistical analysis revealed that Min speakers had a significantly greater maximum range of speaking intensity and a smaller lowest speaking intensity than Mandarin speakers, which indicated tonal effects by speakers of the Min dialect. Moreover, Mandarin and Min speakers had a greater maximum range of speaking F0 and maximum range of speaking intensity than American English speakers. The data may provide an assessment tool for Mandarin speakers and Min speakers. .

  15. Long-range vibration sensor based on correlation analysis of optical frequency-domain reflectometry signals.

    Science.gov (United States)

    Ding, Zhenyang; Yao, X Steve; Liu, Tiegen; Du, Yang; Liu, Kun; Han, Qun; Meng, Zhuo; Chen, Hongxin

    2012-12-17

    We present a novel method to achieve a space-resolved long- range vibration detection system based on the correlation analysis of the optical frequency-domain reflectometry (OFDR) signals. By performing two separate measurements of the vibrated and non-vibrated states on a test fiber, the vibration frequency and position of a vibration event can be obtained by analyzing the cross-correlation between beat signals of the vibrated and non-vibrated states in a spatial domain, where the beat signals are generated from interferences between local Rayleigh backscattering signals of the test fiber and local light oscillator. Using the proposed technique, we constructed a standard single-mode fiber based vibration sensor that can have a dynamic range of 12 km and a measurable vibration frequency up to 2 kHz with a spatial resolution of 5 m. Moreover, preliminarily investigation results of two vibration events located at different positions along the test fiber are also reported.

  16. Frequency Comb Driven Raman Transitions in the THz Range: High Precision Isotope Shift Measurements in Ca+

    DEFF Research Database (Denmark)

    Meyer, Steffen

    2017-01-01

    to picoseconds in the previous experiments. For the broad spectrum, the additional effect of group delay dispersion (GDD) has to be taken into account, since the Raman process relies on the coherent interaction of all frequency components of the spectrum, with GDD influencing the relative phase which leads......This thesis presents for the first time the experimental implementation of coherent Raman oscillations with a femtosecond frequency comb for transition frequencies in the THz range. The technique has been successfully demonstrated before to drive Raman transitions between hyperfine structure states...... to destructive interference. Therefore, GDD is compensated using a prism compressor and it is shown quantitatively that the measured GDD matches the theoretically predicted effect on the total Raman Rabi frequency. For the measurements and compensation of GDD, the techniques of interferometric autocorrelation...

  17. Tuning Range Optimization of a Planar Inverted F Antenna for LTE Low Frequency Bands

    DEFF Research Database (Denmark)

    Barrio, Samantha Caporal Del; Pelosi, Mauro; Franek, Ondrej

    2011-01-01

    This paper presents a Planar Inverted F Antenna (PIFA) tuned with a fixed capacitor to the low frequency bands supported by the Long Term Evolution (LTE) technology. The tuning range is investigated and optimized with respect to the bandwidth and the efficiency of the resulting antenna. Simulations...

  18. Semiannual Status Report. [excitation of electromagnetic waves in the whistler frequency range

    Science.gov (United States)

    1994-01-01

    During the last six months, we have continued our study of the excitation of electromagnetic waves in the whistler frequency range and the role that these waves will play in the acceleration of electrons and ions in the auroral region. A paper entitled 'Electron Beam Excitation of Upstream Waves in the Whistler Mode Frequency Range' was listed in the Journal of Geophysical Research. In this paper, we have shown that an anisotropic electron beam (or gyrating electron beam) is capable of generating both left-hand and right-hand polarized electromagnetic waves in the whistler frequency range. Since right-hand polarized electromagnetic waves can interact with background electrons and left-hand polarized waves can interact with background ions through cyclotron resonance, it is possible that these beam generated left-hand and right-hand polarized electromagnetic waves can accelerate either ions or electrons (or both), depending on the physical parameters under consideration. We are currently carrying out a comprehensive study of the electromagnetic whistler and lower hybrid like waves observed in the auroral zone using both wave and particle data. Our first task is to identify these wave modes and compare it with particle observations. Using both the DE-1 particle and wave measurements, we can positively identify those electromagnetics lower hybrid like waves as fast magnetosonic waves and the upper cutoff of these waves is the local lower hybrid frequency. From the upper cutoff of the frequency spectrum, one can infer the particle density and the result is in very good agreement with the particle data. Since these electromagnetic lower hybrid like waves can have frequencies extended down to the local ion cyclotron frequency, it practically confirms that they are not whistler waves.

  19. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  20. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  1. Excitation of Lamb waves over a large frequency-thickness product range for corrosion detection

    Science.gov (United States)

    Zeng, Liang; Luo, Zhi; Lin, Jing; Hua, Jiadong

    2017-09-01

    For corrosion detection, it is often desirable that a Lamb wave mode is highly sensitive to surface thinning and enjoys some degree of mode purity at a particular frequency. In view of this, this paper aims to generate a variety of Lamb wave modes over broad frequency bands to ensure an abundant supply of candidates for corrosion detection, and further, establish a strategy to find appropriate operation points efficiently and effectively. Firstly, a short-duration laser pulse is applied to generate Lamb waves over a large frequency-thickness product range. The selection of symmetric modes or anti-symmetric modes is obtained by addition or subtraction of signals captured by two identical transducers which are symmetrically coupled on both sides of the plate. Subsequently, the S0 mode at a non-dispersive frequency bandwidth is employed to improve the accuracy of the transmitter-receiver distance. Based on those, three selection criteria including mode separability, amplitude ratio and corrosion sensitivity, are presented to efficiently determine the suitable operation points (i.e., mode types and frequencies). The experimental results show that the simulated corrosion could be correctly detected and accurately localized at the chosen modes and frequencies.

  2. Wide-range dynamic strain measurements based on K-BOTDA and frequency-agile technique

    Science.gov (United States)

    Zhou, Dengwang; Dong, Yongkang; Wang, Benzhang; Zhang, Hongying; Lu, Zhiwei

    2017-04-01

    We propose and demonstrate a novel fast Brillouin optical time-domain analysis system using the coefficient K spectrum which is defined as the ratio of phase-shift and gain of Brillouin amplification, where K features linear response, immune to the variation of pump power and a wide measure range. For a 30ns-square pump pulse, the frequency span of K spectrum can reach up to 200MHz. In dynamic strain experiment, a multi-slope assisted K-BOTDA with the measured strain of 5358.3μɛ and the vibration frequency of 6.01Hz and 12.05Hz are demonstrated.

  3. An impedance bridge measuring the capacitance ratio in the high frequency range up to 1 MHz

    Science.gov (United States)

    Bee Kim, Dan; Kew Lee, Hyung; Kim, Wan-Seop

    2017-02-01

    This paper describes a 2-terminal-pair impedance bridge, measuring the capacitance ratio in the high frequency range up to 1 MHz. The bridge was configured with two voltage sources and a phase control unit which enabled the bridge balance by synchronizing the voltage sources with an enhanced phase resolution. Without employing the transformers such as inductive voltage divider, injection and detection transformers, etc, the bridge system is quite simple to set up, and the balance procedure is quick and easy. Using this dual-source coaxial bridge, the 1:1 and 10:1 capacitance ratios were measured with 1 pF-1 nF capacitors in the frequency range from 1 kHz to 1 MHz. The measurement values obtained by the dual-source bridge were then compared with reference values measured using a commercial precision capacitance bridge of AH2700A, the Z-matrix method developed by ourselves, and the 4-terminal-pair coaxial bridge by the Czech Metrological Institute. All the measurements agreed within the reference uncertainty range of an order of 10-6-10-5, proving the bridge ability as a trustworthy tool for measuring the capacitance ratio in the high frequency range.

  4. Impact of energetic particle orbits on long range frequency chirping of BGK modes

    Science.gov (United States)

    Hezaveh, H.; Qu, Z. S.; Layden, B.; Hole, M. J.

    2017-12-01

    Long range frequency chirping of Bernstein-Greene-Kruskal modes, whose existence is determined by the fast particles, is investigated in cases where these particles do not move freely and their motion is bounded to restricted orbits. A nonuniform equilibrium magnetic field is included into the bump-on-tail instability problem of a plasma wave. The parallel field gradients account for the existence of different orbit topologies of energetic particles. With respect to fast particles dynamics, the extended model captures the range of particles motion (trapped/passing) with energy and thus represents a more realistic 1D picture of the long range sweeping events observed for weakly damped modes, e.g. global Alfven eigenmodes, in tokamaks. The Poisson equation is solved numerically along with bounce averaging the Vlasov equation in the adiabatic regime. We demonstrate that the shape and the saturation amplitude of the nonlinear mode structure depends not only on the amount of deviation from the initial eigenfrequency but also on the initial energy of the resonant electrons in the equilibrium magnetic field. Similarly, the results reveal that the resonant electrons following different equilibrium orbits in the nonuniform field lead to different rates of frequency evolution. As compared to the previous model (Breizman 2010 Nucl. Fusion 50 084014), it is shown that the frequency sweeps with lower rates. The additional physics included in the model enables a more complete 1D description of the range of phenomena observed in experiments.

  5. Waveguiding Effect in the Gigahertz Frequency Range in Pillar-based Phononic-Crystal Slabs

    Science.gov (United States)

    Pourabolghasem, Reza; Dehghannasiri, Razi; Eftekhar, Ali Asghar; Adibi, Ali

    2018-01-01

    The waveguiding effect for a phononic-crystal (PnC)-based device operating in the gigahertz (GHz) frequency regime is experimentally demonstrated. To that end, a metallic pillar-based PnC membrane with a PnC band gap in the GHz frequency range is designed, and, based on that, an acoustic waveguide operating in the GHz regime is designed and fabricated. To characterize the fabricated PnC waveguide, a set of focusing interdigital transducers is designed and fabricated, enabling efficient excitation and detection of acoustic signals inside the PnC waveguide. The finite-element method is used to study the acoustic properties of the proposed structures and optimize their design. Experimental evidence supporting the existence of the waveguiding effect in the proposed structure in the GHz frequency regime is provided, showing reasonable agreement with the numerical calculations.

  6. Electrodynamic properties of porous PZT-Pt films at terahertz frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Komandin, Gennady A.; Porodinkov, Oleg E.; Spektor, Igor E.; Volkov, Alexander A. [Prokhorov General Physics Institute, Russian Academy of Sciences, Moscow (Russian Federation); Vorotilov, Konstantin A.; Seregin, Dmitry S.; Sigov, Alexander S. [Moscow Technological University (MIREA), Moscow (Russian Federation)

    2017-01-15

    Electrodynamics of Si-SiO{sub 2}-TiO{sub 2}-Pt-PZT heterostructures is studied in the frequency range from 5 to 5000 cm{sup -1} by monochromatic BWO (backward wave oscillator) and infrared Fourier-transform spectroscopy techniques to derive the dielectric characteristics of the sol-gel porous ferroelectric PbZr{sub 0.48}Ti{sub 0.52}O{sub 3} films. Broad frequency band dielectric response of PZT films with different density is constructed using the oscillator dispersion models. The main contribution to the film permittivity is found to form at frequencies below 100 cm{sup -1} depending strongly and non-linearly on the film medium density. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Propagation in a shearing plasma. II - Turbulence and the frequency range of pulsar microstructure

    Science.gov (United States)

    Harding, A. K.; Tademaru, E.

    1980-01-01

    Numerical calculations are presented which explore the propagation of radio waves and pulses through a turbulent shearing plasma. A stochastic model is used to describe the turbulent velocity field, in which random fluctuations are superposed on a mean profile. Both Gaussian wave packets and shot-noise pulses polarized in the plane of shearing acquire quasi-periodic intensity modulations above the rest-frame plasma frequency. The frequency range over which these modulations appear is shown to depend on the spatial correlation length of the turbulent fluctuations and on their standard deviation from the mean velocity. The period of the modulations is variable from one realization of the random process to the next, and the average period is frequency dependent. The results of these calculations lend further support to a model for pulsar microstructure in which periodic micropulses are pure temporal modulations of the emitted radiation due to propagation effects in magnetospheric shearing regions. It is shown that turbulence on a scale of approximately 10 cm can produce these quasi-periodic modulations over a frequency range comparable to that of observed microstructure.

  8. Structure and dielectric properties in the radio frequency range of polymer composites based on vanadium dioxide

    Directory of Open Access Journals (Sweden)

    Kolbunov V.R.

    2015-06-01

    Full Text Available Polymer composites with active fillers are recently considered to be promising materials for the design of new functional devices with controllable properties and are intensively investigated. Dielectric studies are one of the most effective methods for studying structural features and mechanisms of conductivity formation for this type of two-component systems. The paper presents research results of the dielectric characteristics in the range of radio frequency of 50 kHz — 10 MHz and temperature range of 30—60°C of polyethylene composites of vanadium dioxide with different volume fractions of filler. Two dispersion areas were found: a high-frequency area caused by the Maxwell charge separation on the boundaries of the polyethylene matrix — conductive filler of VI2 crystallites, and a low frequency area associated with the presence of the transition layer at this boundary. The relative permittivity of the composite has a tendency to a decrease in absolute value with increasing temperature. The analysis of the low-frequency dependence of the dielectric constant of the value of the filler’s volume fraction revealed that the investigated composite belongs to two-component statistical mixtures with a transition layer between the components.

  9. An OFDM Carrier Frequency Offset Estimation Scheme with Wide Fractional Offset Estimation Range

    Directory of Open Access Journals (Sweden)

    C. Yu

    2013-04-01

    Full Text Available In this paper, we propose a carrier frequency offset (CFO estimation scheme which is robust to the fractional CFO variation for orthogonal frequency division multiplexing (OFDM systems. The proposed scheme first performs the envelope equalization process to convert the offset estimation problem to a carrier estimation problem, and then, estimates the integer and fractional parts of CFO by using periodogram of the received signal. Especially, in the estimation stage for fraction CFO, the ratio of the square-roots of periodograms is employed enlarging the estimation range of the stage than that of the conventional scheme. Numerical results demonstrate that the proposed scheme has better estimation performance than the conventional scheme for wider fractional CFO range in various channel conditions.

  10. Artificial Temperature Anisotropy of Crystals in X-Ray Frequency Range

    Science.gov (United States)

    Mkrtchyan, Vahram P.; Gasparyan, Laura G.; Balyan, Minas K.

    2010-04-01

    The effect of artificial temperature anisotropy of crystals in X-ray frequency range was observed for the first time and an effort to theoretically interpret this effect in Bragg-Laue diffraction case was made. It was established that an isotropic crystal optically turns into an artificially anisotropic one with optical axis along the direction of applied external influence as a symmetry axis, giving rise to the double refraction.

  11. Polarization-Entangled Photon Pairs From Periodically-Poled Crystalline Waveguides Over a Range of Frequencies.

    Science.gov (United States)

    Heberle, Dylan A; Levine, Zachary H

    2013-01-01

    We propose a method to extend the frequency range of polarization entanglement in periodically poled rubidium-doped potassium titanyl phosphate (Rb:KTP) waveguides. Our calculations predict that output wavelengths from 1130 nm to 1257 nm may be achieved using Rb:KTP by the appropriate selection of a direction of propagation for the waveguide. The fidelity using a poling period of 1 mm is approximately 0.98.

  12. Low-power wide-locking-range injection-locked frequency divider for OFDM UWB systems

    Energy Technology Data Exchange (ETDEWEB)

    Yin Jiangwei; Li Ning; Zheng Renliang; Li Wei; Ren Junyan, E-mail: lining@fudan.edu.c [State Key Laboratory of ASIC and System, Fudan University, Shanghai 201203 (China)

    2009-05-01

    This paper describes a divide-by-two injection-locked frequency divider (ILFD) for frequency synthesizers as used in multiband orthogonal frequency division multiplexing (OFDM) ultra-wideband (UWB) systems. By means of dual-injection technique and other conventional tuning techniques, such as DCCA and varactor tuning, the divider demonstrates a wide locking range while consuming much less power. The chip was fabricated in the Jazz 0.18 mum RF CMOS process. The measurement results show that the divider achieves a locking range of 4.85 GHz (6.23 to 11.08 GHz) at an input power of 8 dBm. The core circuit without the test buffer consumes only 3.7 mA from a 1.8 V power supply and has a die area of 0.38 x 0.28 mm{sup 2}. The wide locking range combined with low power consumption makes the ILFD suitable for its application in UWB systems.

  13. Frequency-Modulated, Continuous-Wave Laser Ranging Using Photon-Counting Detectors

    Science.gov (United States)

    Erkmen, Baris I.; Barber, Zeb W.; Dahl, Jason

    2014-01-01

    Optical ranging is a problem of estimating the round-trip flight time of a phase- or amplitude-modulated optical beam that reflects off of a target. Frequency- modulated, continuous-wave (FMCW) ranging systems obtain this estimate by performing an interferometric measurement between a local frequency- modulated laser beam and a delayed copy returning from the target. The range estimate is formed by mixing the target-return field with the local reference field on a beamsplitter and detecting the resultant beat modulation. In conventional FMCW ranging, the source modulation is linear in instantaneous frequency, the reference-arm field has many more photons than the target-return field, and the time-of-flight estimate is generated by balanced difference- detection of the beamsplitter output, followed by a frequency-domain peak search. This work focused on determining the maximum-likelihood (ML) estimation algorithm when continuous-time photoncounting detectors are used. It is founded on a rigorous statistical characterization of the (random) photoelectron emission times as a function of the incident optical field, including the deleterious effects caused by dark current and dead time. These statistics enable derivation of the Cramér-Rao lower bound (CRB) on the accuracy of FMCW ranging, and derivation of the ML estimator, whose performance approaches this bound at high photon flux. The estimation algorithm was developed, and its optimality properties were shown in simulation. Experimental data show that it performs better than the conventional estimation algorithms used. The demonstrated improvement is a factor of 1.414 over frequency-domainbased estimation. If the target interrogating photons and the local reference field photons are costed equally, the optimal allocation of photons between these two arms is to have them equally distributed. This is different than the state of the art, in which the local field is stronger than the target return. The optimal

  14. An Ultrasonic Multiple-Access Ranging Core Based on Frequency Shift Keying Towards Indoor Localization

    Directory of Open Access Journals (Sweden)

    Laurent Segers

    2015-07-01

    Full Text Available This paper describes a new approach and implementation methodology for indoor ranging based on the time difference of arrival using code division multiple access with ultrasound signals. A novel implementation based on a field programmable gate array using finite impulse response filters and an optimized correlation demodulator implementation for ultrasound orthogonal signals is developed. Orthogonal codes are modulated onto ultrasound signals using frequency shift keying with carrier frequencies of 24.5 kHz and 26 kHz. This implementation enhances the possibilities for real-time, embedded and low-power tracking of several simultaneous transmitters. Due to the high degree of parallelism offered by field programmable gate arrays, up to four transmitters can be tracked simultaneously. The implementation requires at most 30% of the available logic gates of a Spartan-6 XC6SLX45 device and is evaluated on accuracy and precision through several ranging topologies. In the first topology, the distance between one transmitter and one receiver is evaluated. Afterwards, ranging analyses are applied between two simultaneous transmitters and one receiver. Ultimately, the position of the receiver against four transmitters using trilateration is also demonstrated. Results show enhanced distance measurements with distances ranging from a few centimeters up to 17 m, while keeping a centimeter-level accuracy.

  15. An Ultrasonic Multiple-Access Ranging Core Based on Frequency Shift Keying Towards Indoor Localization.

    Science.gov (United States)

    Segers, Laurent; Van Bavegem, David; De Winne, Sam; Braeken, An; Touhafi, Abdellah; Steenhaut, Kris

    2015-07-30

    This paper describes a new approach and implementation methodology for indoor ranging based on the time difference of arrival using code division multiple access with ultrasound signals. A novel implementation based on a field programmable gate array using finite impulse response filters and an optimized correlation demodulator implementation for ultrasound orthogonal signals is developed. Orthogonal codes are modulated onto ultrasound signals using frequency shift keying with carrier frequencies of 24.5 kHz and 26 kHz. This implementation enhances the possibilities for real-time, embedded and low-power tracking of several simultaneous transmitters. Due to the high degree of parallelism offered by field programmable gate arrays, up to four transmitters can be tracked simultaneously. The implementation requires at most 30% of the available logic gates of a Spartan-6 XC6SLX45 device and is evaluated on accuracy and precision through several ranging topologies. In the first topology, the distance between one transmitter and one receiver is evaluated. Afterwards, ranging analyses are applied between two simultaneous transmitters and one receiver. Ultimately, the position of the receiver against four transmitters using trilateration is also demonstrated. Results show enhanced distance measurements with distances ranging from a few centimeters up to 17 m, while keeping a centimeter-level accuracy.

  16. Very High Frequency Galvanic Isolated Offline Power Supply

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf

    inverters with a single combined rectifier. The converter designed to deliver 9 W to a 60 V LED load and is achieving an efficiency of 89.4% and a power density of 2.14 W3 . The development of this converter proof that offline VHF converter can be implemented with high efficiencies even for low power applications...... converters. During this Ph.D. thesis, different areas of an offline VHF converters are described, dur-ing the project different areas have been investigated such as, gate drive, synchronous rectifiers, PCB transformers, control of a resonant converter, galvanic isolation, EMC performance, power factor......During the last decades many researchers have turned their attention to raising the operation frequency of power converters to the very high frequency (VHF) range going from 30 MHz to 300 MHz. Increasing the operating frequency of a power converter leads to smaller energy storing components...

  17. Supplementary Golay pair for range side lobe suppression in dual-frequency tissue harmonic imaging.

    Science.gov (United States)

    Shen, Che-Chou; Wu, Chi; Peng, Jun-Kai

    2015-02-01

    In dual-frequency (DF) harmonic imaging, the second harmonic signal at second harmonic (2f0) frequency and the inter-modulation harmonic signal at fundamental (f0) frequency are simultaneously imaged for spectral compounding. When the phase-encoded Golay pair is utilized to improve the harmonic signal-to-noise ratio (SNR), however, the DF imaging suffers from range side lobe artifacts due to spectral cross-talk with other harmonic components at DC and third harmonic (3f0) frequency. In this study, a supplementary Golay pair is developed to suppress the range side lobes in combination with the original Golay pair. Since the phase code of the DC interference cannot be manipulated, the supplementary Golay is designed to reverse the polarity of the 3f0 interference and the f0 signal while keeping the 2f0 signal unchanged. For 2f0 imaging, the echo summation of the supplementary and the original Golay can cancel the 3f0 interference. On the contrary, the echo difference between the two Golay pairs can eliminate the DC interference for f0 imaging. Hydrophone measurements indicate that the range side lobe level (RSLL) increases with the signal bandwidth of DF harmonic imaging. By using the combination of the two Golay pairs, the achievable suppression of RSLL can be 3 and 14 dB, respectively for the f0 and 2f0 harmonic signal. B-mode phantom imaging also verifies the presence of range side lobe artifacts when only the original Golay pair is utilized. In combination with the supplementary Golay pair, the artifacts are effectively suppressed. The corresponding range side lobe magnitude reduces by about 8 dB in 2f0 imaging but remains unchanged in f0 imaging. Meanwhile, the harmonic SNR improves by 8-10 dB and the contrast-to-noise ratio of harmonic image increases from about 1 to 1.2 by spectral compounding. For DF tissue harmonic imaging, the spectral cross-talk in Golay excitation results in severe range side lobe artifacts. To restore the image quality, two particular

  18. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  19. A nonlinear model of magnetorheological elastomer with wide amplitude range and variable frequencies

    Science.gov (United States)

    Wang, Qi; Dong, Xufeng; Li, Luyu; Ou, Jinping

    2017-06-01

    To develop control algorithms that taking maximum advantage of rapidly varying rheological properties of MR elastomer devices, models must be developed that can adequately characterize the smart material’s intrinsic nonlinearity. However, most existing MRE models are only effective within a narrow strain amplitude range and under certain loading frequencies. To derive a MRE model with better applicability, MR elastomer samples were fabricated and their steady-state response under harmonic loading with different strain amplitudes, frequencies and magnetic fields were tested. Following a review of several existing models of MR elastomer, a new revised Bouc-Wen model is proposed that can effectively portray the behavior of the material. Comparison with experimental results indicates that the model is accurate over a wide range of frequencies, strain amplitudes and magnetic flux densities. A simplified model was then proposed after parametric study. As the magnetic field is the only determinant of the parameters, the simplified model is adequate for base isolation devices design and simulation.

  20. Complex magnetic susceptibility setup for spectroscopy in the extremely low-frequency range.

    Science.gov (United States)

    Kuipers, B W M; Bakelaar, I A; Klokkenburg, M; Erné, B H

    2008-01-01

    A sensitive balanced differential transformer was built to measure complex initial parallel magnetic susceptibility spectra in the 0.01-1000 Hz range. The alternating magnetic field can be chosen sufficiently weak that the magnetic structure of the samples is only slightly perturbed and the low frequencies make it possible to study the rotational dynamics of large magnetic colloidal particles or aggregates dispersed in a liquid. The distinguishing features of the setup are the novel multilayered cylindrical coils with a large sample volume and a large number of secondary turns (55 000) to measure induced voltages with a good signal-to-noise ratio, the use of a dual channel function generator to provide an ac current to the primary coils and an amplitude- and phase-adjusted compensation voltage to the dual phase differential lock-in amplifier, and the measurement of several vector quantities at each frequency. We present the electrical impedance characteristics of the coils, and we demonstrate the performance of the setup by measurement on magnetic colloidal dispersions covering a wide range of characteristic relaxation frequencies and magnetic susceptibilities, from chi approximately -10(-5) for pure water to chi>1 for concentrated ferrofluids.

  1. Performance Analysis of Frequency Shift Keyed Signals in a Sonar Ranging System

    Science.gov (United States)

    Kodama, Tetsuji; Nakahira, Kenji; Koyama, Yuu; Murakami, Junichi

    Pulsed ultrasonic distance measurement systems are frequently used in robotics applications, thanks to their low cost and small size. The pulse compression techniques, originally developed by radar engineers, were adopted to eliminate frequent misreadings caused by crosstalk or external ultrasound sources. High-performance computing systems for the implementation of pulse compression techniques enable reliable and accurate distance measurement. In most cases however, they significantly increase the complexity of the total system, cutting down one of the advantages of ultrasonic systems. The ultrasonic ranging using a digital polarity correlator can overcome this drawback, because the cost of realizing delay and multiplication for each point on the polarity correlation function as a parallel operation is very low. This paper presents an analysis of the binary coded frequency shift keyed signals for the ultrasonic ranging using a digital polarity correlator. The spectra of the frequency shift keyed signals have been observed to be narrow compared with the spectra of the corresponding phase shift keyed signals. This suggests the possibility of a more reliable and accurate distance measurement with the frequency shift keyed signals in terms of occupied bandwidth.

  2. Hematite from Natural Iron Stones as Microwave Absorbing Material on X-Band Frequency Ranges

    Science.gov (United States)

    Zainuri, Mochamad

    2017-05-01

    This study has been investigated the effect of hematite as microwave absorbing materials (RAM) on X-Band frequency ranges. Hematite was succesfully processed by coprecipitation method and calcined at 500 °C for 5 hour. It was synthesized from natural iron stones from Tanah Laut, South Kalimantan, Indonesia. The products were characterized by X-ray diffraxtion (XRD), conductivity measurement, Vibrating Sample Magnetometer (VSM), and Vector Network Analyzer (VNA). The result was shown that hematite has conductivity value on (2.5-3).10-7 S/cm and be included as dielectric materials. The hysterisis curve was shown that hematite was a super paramagnetic materials. The product was mixed on paint with procentage 10% of total weight and coated on steel grade AH36 with spray methods. Then, the maximum of reflection loss on x - band’s frequency range (8,2-12,4) GHz was -7 dB on frequency of 10.5 GHz. It mean that almost 50% electromagnetic energy was absorbed by hematite.

  3. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  4. Estimation of the RF Characteristics of Absorbing Materials in Broad RF Frequency Ranges

    CERN Document Server

    Fandos, R

    2008-01-01

    Absorbing materials are very often used in RF applications. Their electromagnetic characteristics (relative permittivity εr, loss tangent tan δ and conductivity σ) are needed in order to obtain a high-quality design of the absorbing pieces in the frequency range of interest. Unfortunately, suppliers often do not provide these quantities. A simple technique to determine them, based on the RF measurement of the disturbance created by the insertion of a piece of absorber in a waveguide, is presented in this note. Results for samples of two different materials, silicon carbide and aluminum nitride are presented. While the former has a negligible conductivity at the working frequencies, the conductivity of the latter has to be taken into account in order to obtain a meaningful estimation of εr and tan δ. The equations of Kramers & Kronig have been applied to the data as a cross check, confirming the results.

  5. Active stabilization of error field penetration via control field and bifurcation of its stable frequency range

    Science.gov (United States)

    Inoue, S.; Shiraishi, J.; Takechi, M.; Matsunaga, G.; Isayama, A.; Hayashi, N.; Ide, S.

    2017-11-01

    An active stabilization effect of a rotating control field against an error field penetration is numerically studied. We have developed a resistive magnetohydrodynamic code ‘AEOLUS-IT’, which can simulate plasma responses to rotating/static external magnetic field. Adopting non-uniform flux coordinates system, the AEOLUS-IT simulation can employ high magnetic Reynolds number condition relevant to present tokamaks. By AEOLUS-IT, we successfully clarified the stabilization mechanism of the control field against the error field penetration. Physical processes of a plasma rotation drive via the control field are demonstrated by the nonlinear simulation, which reveals that the rotation amplitude at a resonant surface is not a monotonic function of the control field frequency, but has an extremum. Consequently, two ‘bifurcated’ frequency ranges of the control field are found for the stabilization of the error field penetration.

  6. Multimode/Multifrequency Low Frequency Airborne Radar Design

    Directory of Open Access Journals (Sweden)

    Sandra Costanzo

    2013-01-01

    Full Text Available This work deals with the design of multimode/multifrequency airborne radar suitable for imaging and subsurface sounding. The system operates at relatively low frequencies in the band ranging from VHF to UHF. It is able to work in two different modalities: (i nadir-looking sounder in the VHF band (163 MHz and (ii side-looking imager (SAR in the UHF band with two channels at 450 MHz and 860 MHz. The radar has been completely designed by CO.Ri.S.T.A. for what concerns the RF and the electronic aspect, and by the University of Calabria for what concerns the design, realization, and test of SAR antennas. The radar has been installed on a civil helicopter and its operation has been validated in flight in both sounder and imager modality. Preliminary surveys have been carried out over different areas of Campania region, South Italy.

  7. Diversification Rates and the Evolution of Species Range Size Frequency Distribution

    Directory of Open Access Journals (Sweden)

    Silvia Castiglione

    2017-11-01

    Full Text Available The geographic range sizes frequency distribution (RFD within clades is typically right-skewed with untransformed data, and bell-shaped or slightly left-skewed under the log-transformation. This means that most species within clades occupy diminutive ranges, whereas just a few species are truly widespread. A number of ecological and evolutionary explanations have been proposed to account for this pattern. Among the latter, much attention has been given to the issue of how extinction and speciation probabilities influence RFD. Numerous accounts now convincingly demonstrate that extinction rate decreases with range size, both in living and extinct taxa. The relationship between range size and speciation rate, though, is much less obvious, with either small or large ranged species being proposed to originate more daughter taxa. Herein, we used a large fossil database including 21 animal clades and more than 80,000 fossil occurrences distributed over more than 400 million years of marine metazoans (exclusive of vertebrates evolution, to test the relationship between extinction rate, speciation rate, and range size. As expected, we found that extinction rate almost linearly decreases with range size. In contrast, speciation rate peaks at the large (but not the largest end of the range size spectrum. This is consistent with the peripheral isolation mode of allopatric speciation being the main mechanism of species origination. The huge variation in phylogeny, fossilization potential, time of fossilization, and the overarching effect of mass extinctions suggest caution must be posed at generalizing our results, as individual clades may deviate significantly from the general pattern.

  8. Nanostructured composite layers for electromagnetic shielding in the GHz frequency range

    Science.gov (United States)

    Suchea, M.; Tudose, I. V.; Tzagkarakis, G.; Kenanakis, G.; Katharakis, M.; Drakakis, E.; Koudoumas, E.

    2015-10-01

    We report on preliminary results regarding the applicability of nanostructured composite layers for electromagnetic shielding in the frequency range of 4-20 GHz. Various combinations of materials were employed including poly(3,4-ethylenedioxythiophene)-poly(styrenesulfonate) (PEDOT:PSS), polyaniline, graphene nanoplatelets, carbon nanotubes, Cu nanoparticles and Poly(vinyl alcohol). As shown, paint-like nanocomposite layers consisting of graphene nanoplatelets, polyaniline PEDOT:PSS and Poly(vinyl alcohol) can offer quite effective electromagnetic shielding, similar or even better than that of commercial products, the response strongly depending on their thickness and resistivity.

  9. Wideband Monopole Fractal Heptagonal Antenna Implementation in X-Band Frequency Range

    Science.gov (United States)

    Iqbal, Muhammad Naeem; Ur-Rahman, Hamood; Tauqeer, T.; Ramer, Rodica

    2017-10-01

    A wideband heptagonal fractal monopole antenna with coplanar waveguide feed is designed and fabricated in X-band frequency range. Comparison of heptagonal fractal monopole antennas with two different substrates to achieve optimum efficiency for UWB applications is presented. FR4 and RT/Duroid 5880 substrates are used for antenna design and fabrication. Four iterations of base shape are used. Fractal antenna has omni-directional radiation pattern. Simulated and measured results showed that monopole fractal antenna with RT/Duroid 5880 substrate has better performance than fractal antenna with FR4 substrate in terms of bandwidth and return loss. Major application area of proposed antenna is wireless body area networks.

  10. A New Algorithm for Joint Range-DOA-Frequency Estimation of Near-Field Sources

    Directory of Open Access Journals (Sweden)

    Jian-Feng Chen

    2004-03-01

    Full Text Available This paper studies the joint estimation problem of ranges, DOAs, and frequencies of near-field narrowband sources and proposes a new computationally efficient algorithm, which employs a symmetric uniform linear array, uses eigenvalues together with the corresponding eigenvectors of two properly designed matrices to estimate signal parameters, and does not require searching for spectral peak or pairing among parameters. In addition, the proposed algorithm can be applied in arbitrary Gaussian noise environment since it is based on the fourth-order cumulants, which is verified by extensive computer simulations.

  11. Dielectric properties of the lithium-titanium ferrite ceramics in a wide frequency range

    Science.gov (United States)

    Surzhikov, A. P.; Gyngazov, S. A.; Lysenko, E. N.; Frangul'yan, T. S.; Malyshev, A. V.

    2015-06-01

    Electrophysical properties of the Li-Ti ferrite ceramics with the spinel structure (Li0.649Fe1.598Ti0.5Zn0.2Mn0.051O4) are studied in the frequency interval 0.5-2.5 GHz at temperatures ranging from room temperature to 530 K. The thermal emf of the ferrite ceramic samples is studied. It is demonstrated that the sample under study exhibits electron conduction. The calculated results are used to interpret the conduction mechanism using the hopping model.

  12. Mid-frequency sound propagation through internal waves at short range with synoptic oceanographic observations.

    Science.gov (United States)

    Rouseff, Daniel; Tang, Dajun; Williams, Kevin L; Wang, Zhongkang; Moum, James N

    2008-09-01

    Preliminary results are presented from an analysis of mid-frequency acoustic transmission data collected at range 550 m during the Shallow Water 2006 Experiment. The acoustic data were collected on a vertical array immediately before, during, and after the passage of a nonlinear internal wave on 18 August, 2006. Using oceanographic data collected at a nearby location, a plane-wave model for the nonlinear internal wave's position as a function of time is developed. Experimental results show a new acoustic path is generated as the internal wave passes above the acoustic source.

  13. A Fixed-Frequency Bidirectional Resonant DC-DC Converter Suitable for Wide Voltage Gain Range

    DEFF Research Database (Denmark)

    Shen, Yanfeng; Wang, Huai; Blaabjerg, Frede

    2017-01-01

    . It is realized by configuring a full-bridge mode and a half-bridge mode operation during each switching cycle. The fixed-frequency phase-shift control schemes are applied and the normalized voltage gain can be always from 0.5 to 1, regardless of the load. The transformer root-mean-square (RMS) currents in both...... the forward and the reverse modes have a negligible variation with respect to the voltage gain, which is beneficial to low conduction losses throughout a wide voltage range. Moreover, the applied MOSFETs are soft-switched, allowing for minimum switching losses. Both the operation principles...

  14. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  15. Intermediate frequency band digitized high dynamic range radiometer system for plasma diagnostics and real-time Tokamak control

    NARCIS (Netherlands)

    Bongers, W. A.; van Beveren, V.; Thoen, D. J.; Nuij, Pjwm; M.R. de Baar,; Donne, A. J. H.; Westerhof, E.; Goede, A. P. H.; Krijger, B.; van den Berg, M. A.; Kantor, M.; M. F. Graswinckel,; Hennen, B.A.; Schüller, F. C.

    2011-01-01

    An intermediate frequency (IF) band digitizing radiometer system in the 100-200 GHz frequency range has been developed for Tokamak diagnostics and control, and other fields of research which require a high flexibility in frequency resolution combined with a large bandwidth and the retrieval of the

  16. Intermediate frequency band digitized high dynamic range radiometer system for plasma diagnostics and real-time Tokamak control

    NARCIS (Netherlands)

    Bongers, WA.; Van Beveren, V.; Thoen, D.J.; Nuij, P.J.W.M.; De Baar, M.R.; Donné, A.J.H.; Westerhof, E.; Goede, A.P.H.; Krijger, B.; Van den Berg, M.A.; Kantor, M.; Graswinckel, M.F.; Hennen, B.A.; Schüller, F.C.

    2011-01-01

    An intermediate frequency (IF) band digitizing radiometer system in the 100–200 GHz frequency range has been developed for Tokamak diagnostics and control, and other fields of research which require a high flexibility in frequency resolution combined with a large bandwidth and the retrieval of the

  17. Nanostructured composite layers for electromagnetic shielding in the GHz frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Suchea, M. [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Chemistry and Physics, “Al.I. Cuza” University of Iasi, Iasi (Romania); Tudose, I.V. [Chemistry and Physics, “Al.I. Cuza” University of Iasi, Iasi (Romania); Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Tzagkarakis, G. [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Electrical Engineering Department, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Kenanakis, G. [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Institute of Electronic Structure & Laser (IESL), Foundation for Research and Technology (FORTH) Hellas, Heraklion (Greece); Katharakis, M. [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Drakakis, E. [Electrical Engineering Department, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Koudoumas, E., E-mail: koudoumas@staff.teicrete.gr [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Electrical Engineering Department, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece)

    2015-10-15

    Graphical abstract: - Highlights: • Paint-like nanocomposite layers consisting of graphene nanoplatelets, PANI:HCl and PEDOT:PSS present very effective attenuation of electromagnetic radiation in the frequency range 4–20 GHz. • The shielding performance is based mostly on the graphene nanoplatelets and supported by PANI:HCl. In contrast, PEDOT:PSS plays mainly the role of the binder. • Increasing resistivity was observed to reduce the shielding effect, while increasing thickness to favor it. - Abstract: We report on preliminary results regarding the applicability of nanostructured composite layers for electromagnetic shielding in the frequency range of 4–20 GHz. Various combinations of materials were employed including poly(3,4-ethylenedioxythiophene)-poly(styrenesulfonate) (PEDOT:PSS), polyaniline, graphene nanoplatelets, carbon nanotubes, Cu nanoparticles and Poly(vinyl alcohol). As shown, paint-like nanocomposite layers consisting of graphene nanoplatelets, polyaniline PEDOT:PSS and Poly(vinyl alcohol) can offer quite effective electromagnetic shielding, similar or even better than that of commercial products, the response strongly depending on their thickness and resistivity.

  18. flatFLIM: enhancing the dynamic range of frequency domain FLIM.

    Science.gov (United States)

    Schuermann, Klaus C; Grecco, Hernán E

    2012-08-27

    Fluorescence Lifetime Imaging Microscopy (FLIM) is a quantitative technique to probe the nanoenvironment of fluorescent molecules. It is the most robust way to quantify Förster Resonance Energy Transfer (FRET) as it allows reliable differentiation between concentration changes and quenching. In this way, molecular interactions can be imaged in single living cells. The most common wide-field implementation is homodyne Frequency Domain (FD) FLIM, which determines the fluorescence lifetime by measuring the phase and modulation changes of the fluorescence in each pixel upon excitation with a light source modulated at a high frequency. The fluorescence lifetimes are derived from a stack of images acquired at different phase shifts between excitation and detection. In this work we describe a simple method to enhance the dynamic range of FD-FLIM based on precompensating the expected fluorescence modulation by varying the laser power through the phase stack. We show theoretically and experimentally that most of the dynamic range of the camera can be recovered to quantify cells with different intensities. This improvement can be added to any FD-FLIM setup with minimal modifications, enhancing the throughput of information content.

  19. Acoustic metamaterial panel for both fluid passage and broadband soundproofing in the audible frequency range

    Science.gov (United States)

    Jung, Jae Woong; Kim, Jae Eun; Lee, Jin Woo

    2018-01-01

    We present the design, including an experimental demonstration, of an acoustic metamaterial panel aimed at reducing incoming broadband noise in the audible frequency range while allowing an incoming fluid to pass through the holes formed in the panel. The noise reduction performance of the proposed acoustic metamaterial panel is attributed to an array of annular cavities enclosing the fluid passage holes. The acoustic behavior of the acoustic metamaterial panel is theoretically analyzed by the transfer matrix method, and an equivalent acoustic impedance of each annular cavity is included with its effective length in the derived transfer matrix. The effective bulk modulus for the acoustic metamaterial panel is then extracted from the transmission and reflection coefficients by using the retrieval method. It is shown that the frequency range of the negative effective bulk modulus coincides with the stop band of the acoustic metamaterial panel. The underlying physical mechanism for the negative effective bulk modulus is attributed to the out-of-phase motion of vibrating particles in adjacent annular cavities. A calculated transmission coefficient curve of the acoustic metamaterial panel is shown to be in good agreement with the measured one. The findings presented in this work should be useful in the design of a holey soundproof panel.

  20. A Novel Unit Cell for Active Switches in the Millimeter-Wave Frequency Range

    Science.gov (United States)

    Müller, Daniel; Scherer, Gunnar; Lewark, Ulrich J.; Massler, Hermann; Wagner, Sandrine; Tessmann, Axel; Leuther, Arnulf; Zwick, Thomas; Kallfass, Ingmar

    2018-02-01

    This paper presents a novel transistor unit cell which is intended to realize compact active switches in the high millimeter-wave frequency range. The unit cell consists of the combination of shunt and common gate transistor within a four-finger transistor cell, achieving gain in the amplifying state as well as good isolation in the isolating state. Gate width-dependent characteristics of the unit cell as well as the design of actual switch implementations are discussed in detail. To verify the concept, two switches, a single pole double throw (SPDT) switch and single pole quadruple throw (SP4T) switch, intended for the WR3 frequency range (220-325 GHz) were manufactured and characterized. The measured gain at 250 GHz is 4.6 and 2.2 dB for the SPDT and SP4T switch, respectively. An isolation of more than 24 dB for the SPDT switch and 12.8 dB for the SP4T switch was achieved.

  1. Characterization of a Prototype Radio Frequency Space Environment Path Emulator for Evaluating Spacecraft Ranging Hardware

    Science.gov (United States)

    Mitchell, Jason W.; Baldwin, Philip J.; Kurichh, Rishi; Naasz, Bo J.; Luquette, Richard J.

    2007-01-01

    The Formation Flying Testbed (FFTB) at the National Aeronautics and Space Administration (NASA) Goddard Space Flight Center (GSFC) provides a hardware-in-the-loop test environment for formation navigation and control. The facility is evolving as a modular, hybrid, dynamic simulation facility for end-to-end guidance, navigation and control (GN&C) design and analysis of formation flying spacecraft. The core capabilities of the FFTB, as a platform for testing critical hardware and software algorithms in-the-loop, have expanded to include S-band Radio Frequency (RF) modems for interspacecraft communication and ranging. To enable realistic simulations that require RF ranging sensors for relative navigation, a mechanism is needed to buffer the RF signals exchanged between spacecraft that accurately emulates the dynamic environment through which the RF signals travel, including the effects of the medium, moving platforms, and radiated power. The Path Emulator for Radio Frequency Signals (PERFS), currently under development at NASA GSFC, provides this capability. The function and performance of a prototype device are presented.

  2. Frequency-Range Distribution of Boulders Around Cone Crater: Relevance to Landing Site Hazard Avoidance

    Science.gov (United States)

    Clegg-Watkins, R. N.; Jolliff, B. L.; Lawrence, S. J.

    2016-01-01

    Boulders represent a landing hazard that must be addressed in the planning of future landings on the Moon. A boulder under a landing leg can contribute to deck tilt and boulders can damage spacecraft during landing. Using orbital data to characterize boulder populations at locations where landers have safely touched down (Apollo, Luna, Surveyor, and Chang'e-3 sites) is important for determining landing hazard criteria for future missions. Additionally, assessing the distribution of boulders can address broader science issues, e.g., how far craters distribute boulders and how this distribution varies as a function of crater size and age. The availability of new Lunar Reconnaissance Orbiter Camera (LROC) Narrow Angle Camera (NAC) images [1] enables the use of boulder size- and range frequency distributions for a variety of purposes [2-6]. Boulders degrade over time and primarily occur around young or fresh craters that are large enough to excavate bedrock. Here we use NAC images to analyze boulder distributions around Cone crater (340 m diameter) at the Apollo 14 site. Cone crater (CC) was selected because it is the largest crater where astronaut surface photography is available for a radial traverse to the rim. Cone crater is young (approximately 29 Ma [7]) relative to the time required to break down boulders [3,8], giving us a data point for boulder range-frequency distributions (BRFDs) as a function of crater age.

  3. Reflecting and Polarizing Properties of Conductive Fabrics in Ultra-High Frequency Range

    Directory of Open Access Journals (Sweden)

    Oleg Kiprijanovič

    2015-09-01

    Full Text Available The system based on ultra-wide band (UWB signals was employed for qualitative estimation of attenuating, reflecting and polarizing properties of conductive fabrics, capable to prevent local static charge accumulation. Pulsed excitation of triangle monopole antenna of 6.5 cm height by rectangular electric pulses induced radiation of UWB signals with spectral density of power having maximum in ultra-high frequency (UHF range. The same antenna was used for the radiated signal receiving. Filters and amplifiers of different passband were employed to divide UHF range into subranges of 0.3-0.55 GHz, 0.55-1 GHz, 1-2 GHz and 2-4 GHz bands. The free space method, when conductive fabric samples of 50x50 cm2 were placed between transmitting and receiving antennas, was used to imitate a practical application. Received wideband signals corresponding to the defined range were detected by unbiased detectors. The fabrics made of two types of warps, containing different threads with conductive yarns, were investigated. It was estimated attenuation and reflective properties of the fabrics when electric field is collinear or perpendicular to thread direction. In the UHF range it was revealed good reflecting properties of the fabrics containing metallic component in the threads. The system has advantages but not without a certain shortcoming. Adapting it for specific tasks should lead to more effective usage, including yet unused properties of the UWB signals.

  4. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  5. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  6. Historic Frequency and Severity of Fire in Whitebark Pine Forests of the Cascade Mountain Range, USA

    Directory of Open Access Journals (Sweden)

    Michael P. Murray

    2018-02-01

    Full Text Available Whitebark pine (Pinus albicaulis Engelm. is a foundation species of high elevation forest ecosystems in the Cascade Mountain Range of Oregon, Washington, and British Columbia. We examined fire evidence on 55 fire history sites located in the Cascade Range. To estimate dates of historic fires we analyzed 57 partial cross-sections from fire-scarred trees plus 700 increment cores. The resulting 101 fire events indicate fire has been a widespread component of Cascadian whitebark pine stands. Results are site specific and vary considerably. Whitebark pine stands appear to burn in a variety of severities and frequencies. Sites where fire intervals were detected ranged from 9 to 314 years, with a median of 49 years, and averaging 67 years. Fire intervals shortened significantly with higher latitudes. In assessing the most recent fire event at each site, overall, 56 percent burned as stand replacing events. In the 20th century, the number of fires diminished significantly. Due to conservation imperatives, re-introducing fire should be undertaken with extreme care to avoid substantial mortality of this endangered species.

  7. Orbit-averaged quasilinear diffusion operator in the ion-cyclotron range of frequencies

    Science.gov (United States)

    Belmondo, V.; Bilato, R.; Brambilla, M.; Maj, O.

    2010-11-01

    The absorption of radio-frequency waves in the ion-cyclotron range of frequencies (ICRF) in fusion plasmas is adequately described in the frame of the quasilinear theory. A peculiarity of ICRF heating is to increase the fraction of trapped particles, whose the guiding-center trajectories are typically banana orbits with finite width. One possible way to properly account for the effects due to the finite-width orbits is provided by the orbit-averaged quasilinear theory. Here, we propose a routine for the evaluation of the orbit-averaged quasilinear diffusion tensor, given the the wave fields from the full wave code TORIC. Particular care is taken in the evaluation of the contribution of each wave-particle resonance as well as for the transition between the two regimes of correlated and uncorrelated resonances along the orbit. We discuss the quasilinear diffusion coefficient thus obtained and validate the result by comparing the power deposition profile computed from the orbit-averaged quasilinear operator with the one determined by TORIC. For future applications, a novel algorithm for the calculation of the corresponding Monte Carlo operators is also presented.

  8. Numerical Exposure Assessment Method for Low Frequency Range and Application to Wireless Power Transfer.

    Science.gov (United States)

    Park, SangWook; Kim, Minhyuk

    2016-01-01

    In this paper, a numerical exposure assessment method is presented for a quasi-static analysis by the use of finite-difference time-domain (FDTD) algorithm. The proposed method is composed of scattered field FDTD method and quasi-static approximation for analyzing of the low frequency band electromagnetic problems. The proposed method provides an effective tool to compute induced electric fields in an anatomically realistic human voxel model exposed to an arbitrary non-uniform field source in the low frequency ranges. The method is verified, and excellent agreement with theoretical solutions is found for a dielectric sphere model exposed to a magnetic dipole source. The assessment method serves a practical example of the electric fields, current densities, and specific absorption rates induced in a human head and body in close proximity to a 150-kHz wireless power transfer system for cell phone charging. The results are compared to the limits recommended by the International Commission on Non-Ionizing Radiation Protection (ICNIRP) and the IEEE standard guidelines.

  9. Dynamics of r.f. production of Stellarator plasmas in the ion cyclotron range of frequency

    Energy Technology Data Exchange (ETDEWEB)

    Moiseenko, V.E. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Center; Lysoivan, A.I. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Center; Kasilov, S.V. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Center; Plyusnin, V.V. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Center

    1995-01-01

    The present study investigated numerically the process of r.f. production of plasma in the URAGAN-3M torsatron in the frequency range below the ion cyclotron frequency ({omega}<{omega}{sub ci}). The dynamics of r.f. plasma build-up at the stages of neutral gas burnout and plasma heating were studied using a zero-dimensional transport code, in which the plasma confinement law was determined by large helical device scaling. Two models for input r.f. power were used. In the first case, the r.f. power absorbed by the electrons was computed by a one-dimensional r.f. code solving Maxwell`s boundary problem equations. The mechanisms of electron heating through direct excitation of the slow wave (SW) by antennae as well as the conversion of fast wave (FW) into SW in the vicinity of Alfven resonance (scenario of Alfven heating) were taken into account in the computations. In the second case, an `ideal` model of r.f. power deposition onto the electrons as a linear function of plasma density was employed. A noticeable difference in plasma production dynamics computed for these two cases was found. Better agreement with experimental data obtained from the URAGAN-3M torsatron was found for the first case resulting from combination of the one-dimensional r.f. and zero-dimensional transport codes. ((orig.)).

  10. Establishing a link to given radiated emission limits during extending the frequency range above 1 GHz

    Directory of Open Access Journals (Sweden)

    H. Garbe

    2008-05-01

    Full Text Available Up to now most limits for radiated emission are given as values for the electrical field strength. Battermann, 2007 has shown that the frequency range extension for radiated emission measurements above 1 GHz generates a lot of problems while performing the test on a classical test site as depicted in Fig. 1. This paper will give a motivation to use an other measurand namely the total-radiated-power than electrical field strength by using alternative test sites like reverberation chambers, TEM-waveguides, Fully Anechoic Rooms (FAR etc. Nevertheless most of the existing standards still specify electrical field strength limits. This paper will show how to set the parameters in the given algorithm to establish a link between measured total radiated power and equivalent electrical field values.

  11. Relaxations in metallic glasses investigated by a broad frequency and temperature range

    Energy Technology Data Exchange (ETDEWEB)

    Bedorf, Dennis; Koeppe, Thomas; Hachenberg, Joerg; Samwer, Konrad [I. Physikalisches Institut, Universitaet Goettingen, Friedrich-Hund-Platz 1, 37077 Goettingen (Germany); Kahl, Annelen [Keck Laboratories MS 138-78 Caltech, Pasadena CA 91125 (United States); Richert, Ranko [Department of Chemistry and Biochemistry, Arizona State University, Tempe AZ 85287-1604 (United States)

    2007-07-01

    We are interested in glassy dynamics and the atomistic processes leading to different relaxations in amorphous materials. To measure the complex elastic constants, two mechanical spectroscopy techniques were employed. The use of a double-paddle-oscillator (DPO) provides sufficient sensitivity to investigate the loss of even thin films. A DPO is driven in eigenfrequency mode at 5.4 kHz and an amorphous metallic film (PdCuSi) is evaporated onto it and measured under UHV conditions. Cooling and heating enables measurements in a broad temperature range with different heating rates. To survey the elastic constants at higher frequencies, an ultrasonic spectroscopy technique in the MHz regime is used. The pulse-echo method is applied to a bulk metallic glass in order to obtain the shear modulus and attenuation by monitoring shear wave propagation. The results are discussed in the framework of the Cooperative Shear Model.

  12. Acoustic absorption measurement of human hair and skin within the audible frequency range.

    Science.gov (United States)

    Katz, B F

    2000-11-01

    Utilizing the two-microphone impedance tube method, the acoustic absorption of human skin and hair is measured in the frequency range 1-6 kHz. Various locations on a number of human subjects are measured to determine if the presence of bone or an air pocket affects the acoustic absorption of human skin. The absorption coefficient of human hair is also measured. Additional techniques are utilized to minimize errors due to sample mounting methods. Techniques are employed to minimize potential errors in sensor and sample locations. The results of these measurements are compared to relevant historical papers on similar investigations. Results for skin measurements compare well with previous work. Measured hair absorption data do not agree with previous work in the area but do coincide with expected trends, which previous works do not.

  13. Studies for the ion cyclotron range of frequency heating in a tokamak fusion experimental device

    Energy Technology Data Exchange (ETDEWEB)

    Saigusa, Mikio [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1996-02-01

    Ion cyclotron range of frequency heating has been investigated as an efficient additional plasma heating and non-inductive current driving methods in a tokamak type fusion experimental device. At first, an ICRF antenna coupling code was developed for the estimation of the coupling properties of phased antenna array, so that the ICRF antennas were designed for JT-60 and JT-60U ICRF heating systems using the coupling codes. The ICRF heating experiments had been performed in JT-60 and JT-60U. The coupling properties of ICRF antenna, the physics of peripheral plasma and energy confinement by ICRF heating in various heating regimes have been investigated. Next, the Toroidicity induced Alfven Eigen (TAE) mode have been studied using minority ICRF heating for producing energetic ions which can excite TAE mode. The TAE mode could be suppressed by current profile control using current ramp operation and lower hybrid current drive. (author) 74 refs.

  14. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  15. Interaction of a relativistic electron beam with radiation in the THz frequency range

    Science.gov (United States)

    Sung, Chieh

    0.5-3 THz range with a maximum of ˜2 kW of peak power in a 200 ns pulse suitable as a seed for an FEL microbuncher. These sources represent the most powerful and the most energetic narrowband THz sources currently reported using nonlinear optical technique to our knowledge. During the FEL microbunching process, the wiggling electrons in the undulator also emit radiation coherently at the resonant frequency; as a result, the THz FEL microbuncher can double as a single pass THz amplifier tunable in the 0.5-3 THz range. It is shown that when seeded with a ˜1 kW THz pulse and driven by an electron beam with a peak current of 60A, a 2 m-long undulator can amplify the radiation power to ˜20MW. The frequency range can be further expanded to up to 9 THz via the High Gain Harmonic Generation (HGHG) FEL configuration. The results of these simulations are used as a guide in designing a single-pass THz FEL microbuncher/amplifier which is currently under construction. In order to study THz microbunching and amplification, several original techniques and diagnostics were also developed. Guiding a THz pulse through a hollow waveguide, filtering a short THz pulse using a Fabry-Perot interferometer and measuring the frequency components using a diffraction grating spectrometer were demonstrated.

  16. Opto-electronic device for frequency standard generation and terahertz-range optical demodulation based on quantum interference

    Science.gov (United States)

    Georgiades, Nikos P.; Polzik, Eugene S.; Kimble, H. Jeff

    1999-02-02

    An opto-electronic system and technique for comparing laser frequencies with large frequency separations, establishing new frequency standards, and achieving phase-sensitive detection at ultra high frequencies. Light responsive materials with multiple energy levels suitable for multi-photon excitation are preferably used for nonlinear mixing via quantum interference of different excitation paths affecting a common energy level. Demodulation of a carrier with a demodulation frequency up to 100's THZ can be achieved for frequency comparison and phase-sensitive detection. A large number of materials can be used to cover a wide spectral range including the ultra violet, visible and near infrared regions. In particular, absolute frequency measurement in a spectrum from 1.25 .mu.m to 1.66 .mu.m for fiber optics can be accomplished with a nearly continuous frequency coverage.

  17. Speckle Reduction in OCT using Massively-Parallel Detection and Frequency-Domain Ranging.

    Science.gov (United States)

    Desjardins, A E; Vakoc, B J; Tearney, G J; Bouma, B E

    2006-05-29

    Speckle noise significantly limits the information content provided by coherent optical imaging methods such as optical coherence tomography and its recent derivative, optical frequency-domain imaging (OFDI). In this paper, we demonstrate a novel OFDI system that simultaneously acquires hundreds of angularly resolved images, which can be compounded to reduce speckle noise. The system comprises an InGaAs line-scan camera and an interferometer, configured so that the elements of the detector array simultaneously capture light spanning a backscattering angular range of 32 degrees. On successive read-outs of the array, the wavelength of the laser source was stepped through a range of 130 nm centered at 1295 nm to concurrently generate 400 angle-resolved OFDI images. A theory of angle-resolved OFDI and the design equations of the system are presented. Incoherent averaging of the angle-resolved data is shown to yield substantial speckle reduction (as high as an 8 dB SNR improvement) in images of a tissue phantom and esophageal tissue ex vivo.

  18. On the effect of topography on surface wave propagation in the ambient noise frequency range

    Science.gov (United States)

    Köhler, Andreas; Weidle, Christian; Maupin, Valérie

    2012-04-01

    Due to the increasing popularity of analyzing empirical Green's functions obtained from ambient seismic noise, more and more regional tomographical studies based on short-period surface waves are published. Results could potentially be biased in mountainous regions where topography is not small compared to the wavelength and penetration depth of the considered waves. We investigate the effect of topography on the propagation of short-period Rayleigh waves empirically by means of synthetic data using a spectral element code and a 3-D model with real topography. We show that topography along a profile through the studied area can result in an underestimation of phase velocities of up to about 0.7% at the shortest investigated period (3 s). Contrary to the expectation that this bias results from the increased surface distance along topography, we find that this error can be estimated by local topographic contrasts in the vicinity of the receiver alone. We discuss and generalize our results by considering topographic profiles through other mountain ranges and find that southern Norway is a good proxy to assess the topography effect. Nevertheless, topographic bias on phase velocity measurements is in general not large enough to significantly affect recovered velocity variations in the ambient noise frequency range.

  19. Development of a Radio Frequency Space Environment Path Emulator for Evaluating Spacecraft Ranging Hardware

    Science.gov (United States)

    Mitchell, Jason W.; Baldwin, Philip J.; Kurichh, Rishi; Naasz, Bo J.; Luquette, Richard J.

    2007-01-01

    The Formation Flying Testbed (FFTB) at the National Aeronautics and Space Administration (NASA) Goddard Space Flight Center (GSFC) provides a hardware-in-the-loop test environment for formation navigation and control. The facility is evolving as a modular, hybrid, dynamic simulation facility for end-to-end guidance, navigation and. control (GN&C) design and analysis of formation flying spacecraft. The core capabilities of the FFTB, as a platform for testing critical hardware and software algorithms in-the-loop, have expanded to include S-band Radio Frequency (RF) modems for inter-spacecraft communication and ranging. To enable realistic simulations that require RF ranging sensors for relative navigation, a mechanism is needed to buffer the RF signals exchanged between spacecraft that accurately emulates the dynamic environment through which the RF signals travel, including the effects of medium, moving platforms, and radiated power. The Path Emulator for RF Signals (PERFS), currently under development at NASA GSFC, provides this capability. The function and performance of a prototype device are presented.

  20. An acoustical assessment of pitch-matching accuracy in relation to speech frequency, speech frequency range, age and gender in preschool children

    Science.gov (United States)

    Trollinger, Valerie L.

    This study investigated the relationship between acoustical measurement of singing accuracy in relationship to speech fundamental frequency, speech fundamental frequency range, age and gender in preschool-aged children. Seventy subjects from Southeastern Pennsylvania; the San Francisco Bay Area, California; and Terre Haute, Indiana, participated in the study. Speech frequency was measured by having the subjects participate in spontaneous and guided speech activities with the researcher, with 18 diverse samples extracted from each subject's recording for acoustical analysis for fundamental frequency in Hz with the CSpeech computer program. The fundamental frequencies were averaged together to derive a mean speech frequency score for each subject. Speech range was calculated by subtracting the lowest fundamental frequency produced from the highest fundamental frequency produced, resulting in a speech range measured in increments of Hz. Singing accuracy was measured by having the subjects each echo-sing six randomized patterns using the pitches Middle C, D, E, F♯, G and A (440), using the solfege syllables of Do and Re, which were recorded by a 5-year-old female model. For each subject, 18 samples of singing were recorded. All samples were analyzed by the CSpeech for fundamental frequency. For each subject, deviation scores in Hz were derived by calculating the difference between what the model sang in Hz and what the subject sang in response in Hz. Individual scores for each child consisted of an overall mean total deviation frequency, mean frequency deviations for each pattern, and mean frequency deviation for each pitch. Pearson correlations, MANOVA and ANOVA analyses, Multiple Regressions and Discriminant Analysis revealed the following findings: (1) moderate but significant (p pitches E, F♯, G and A in the study; (2) mean speech frequency also emerged as the strongest predictor of subjects' ability to sing the notes E and F♯; (3) mean speech frequency

  1. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  2. Experimental Study of High-Range-Resolution Medical Acoustic Imaging for Multiple Target Detection by Frequency Domain Interferometry

    Science.gov (United States)

    Kimura, Tomoki; Taki, Hirofumi; Sakamoto, Takuya; Sato, Toru

    2009-07-01

    We employed frequency domain interferometry (FDI) for use as a medical acoustic imager to detect multiple targets with high range resolution. The phase of each frequency component of an echo varies with the frequency, and target intervals can be estimated from the phase variance. This processing technique is generally used in radar imaging. When the interference within a range gate is coherent, the cross correlation between the desired signal and the coherent interference signal is nonzero. The Capon method works under the guiding principle that output power minimization cancels the desired signal with a coherent interference signal. Therefore, we utilize frequency averaging to suppress the correlation of the coherent interference. The results of computational simulations using a pseudoecho signal show that the Capon method with adaptive frequency averaging (AFA) provides a higher range resolution than a conventional method. These techniques were experimentally investigated and we confirmed the effectiveness of the proposed method of processing by FDI.

  3. Effective conductivity and permittivity of unsaturated porous materials in the frequency range 1 mHz-1GHz.

    Science.gov (United States)

    Revil, A

    2013-01-01

    A model combining low-frequency complex conductivity and high-frequency permittivity is developed in the frequency range from 1 mHz to 1 GHz. The low-frequency conductivity depends on pore water and surface conductivities. Surface conductivity is controlled by the electrical diffuse layer, the outer component of the electrical double layer coating the surface of the minerals. The frequency dependence of the effective quadrature conductivity shows three domains. Below a critical frequency fp , which depends on the dynamic pore throat size Λ, the quadrature conductivity is frequency dependent. Between fp and a second critical frequency fd , the quadrature conductivity is generally well described by a plateau when clay minerals are present in the material. Clay-free porous materials with a narrow grain size distribution are described by a Cole-Cole model. The characteristic frequency fd controls the transition between double layer polarization and the effect of the high-frequency permittivity of the material. The Maxwell-Wagner polarization is found to be relatively negligible. For a broad range of frequencies below 1 MHz, the effective permittivity exhibits a strong dependence with the cation exchange capacity and the specific surface area. At high frequency, above the critical frequency fd , the effective permittivity reaches a high-frequency asymptotic limit that is controlled by the two Archie's exponents m and n like the low-frequency electrical conductivity. The unified model is compared with various data sets from the literature and is able to explain fairly well a broad number of observations with a very small number of textural and electrochemical parameters. It could be therefore used to interpret induced polarization, induction-based electromagnetic methods, and ground penetrating radar data to characterize the vadose zone.

  4. Effective conductivity and permittivity of unsaturated porous materials in the frequency range 1 mHz–1GHz

    Science.gov (United States)

    Revil, A

    2013-01-01

    A model combining low-frequency complex conductivity and high-frequency permittivity is developed in the frequency range from 1 mHz to 1 GHz. The low-frequency conductivity depends on pore water and surface conductivities. Surface conductivity is controlled by the electrical diffuse layer, the outer component of the electrical double layer coating the surface of the minerals. The frequency dependence of the effective quadrature conductivity shows three domains. Below a critical frequency fp, which depends on the dynamic pore throat size Λ, the quadrature conductivity is frequency dependent. Between fp and a second critical frequency fd, the quadrature conductivity is generally well described by a plateau when clay minerals are present in the material. Clay-free porous materials with a narrow grain size distribution are described by a Cole-Cole model. The characteristic frequency fd controls the transition between double layer polarization and the effect of the high-frequency permittivity of the material. The Maxwell-Wagner polarization is found to be relatively negligible. For a broad range of frequencies below 1 MHz, the effective permittivity exhibits a strong dependence with the cation exchange capacity and the specific surface area. At high frequency, above the critical frequency fd, the effective permittivity reaches a high-frequency asymptotic limit that is controlled by the two Archie's exponents m and n like the low-frequency electrical conductivity. The unified model is compared with various data sets from the literature and is able to explain fairly well a broad number of observations with a very small number of textural and electrochemical parameters. It could be therefore used to interpret induced polarization, induction-based electromagnetic methods, and ground penetrating radar data to characterize the vadose zone. PMID:23576823

  5. Investigation of factors influencing the efficacy of electromagnetic shielding in X band frequency range

    Directory of Open Access Journals (Sweden)

    Vida Zaroushani

    2016-12-01

    Full Text Available Introduction: Due to the importance of engineering controls for prevention of microwave exposure, this study was conducted to design and constract a novel electromagnetic shielding and also to examine the factors influencing shielding efficacy in X band frequency range. Material and Method: This study used Resin Epoxy as matrix and nano-Nickel Oxide as filler to prepare the composite plates with three different thicknesses (2,4, and 6 mm and four different weight percentages (5,7,9 and 11. The fabricated composites characterized using X-ray diffraction and Field Emission Scanning Electron microscopy. Shielding effectiveness, percolation depth, and percolation threshold were measured using Vector Network Analyzers. Thermal Gravimetric Analysis was conducted to study the temperature influence on weight loss for fabricated composites. Result: A maximum shielding effectiveness value of 84.18% was obtained for the 11%-6mm composite at 8.01 GHz and the 7%-4mm composite exhibits a higher average of shielding effectiveness of 66.72% at X- band frequency range. The 4mm thickness was optimum and critical diameter for composite plates; and percolation depth was obtained greater than thickness of composites. However, increasing the nickel oxide content did not show noticeable effect on the shielding effectiveness. Thermal Gravimetric Analysis showed that the study shields were resistant to temperature up to 150 °C without experiencing weight loss. What is more, the results indicated that Nickel oxide Nano particles had desirable distribution and dispersion in epoxy matrix and percolation threshold was appeared in low content of nickel oxide nanoparticles. Conclusion: A novel electromagnetic shield using low thickness and few content of nanoparticle with noticeable efficacy was properly designed and constructed in the field of occupational health. In addition, this shield has low cost, easy to manufacture, resistance to wet/corrosion, and low weight. Epoxy

  6. Blood optical properties at various glucose level values in THz frequency range

    Science.gov (United States)

    Gusev, S. I.; Borovkova, M. A.; Strepitov, M. A.; Khodzitsky, M. K.

    2015-07-01

    the patients. Most biomolecules have characteristic signature frequencies in the terahertz (THz) range, which can reveal their presence and determine the concentration. Therefore, this paper is intended to study the blood optical properties in the THz frequency range in order to determine THz radiation effect on blood. The main aim of this investigation is to determine the effect of blood glucose concentration on the blood optical properties. In the case if blood optical properties vary at different glucose concentrations having a proportional relationship between them, these results will confirm the possibility of development of non-invasive procedures for blood glucose level diagnostics.

  7. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  8. Numerical Investigation and Experimental Demonstration of Chaos from Two-Stage Colpitts Oscillator in the Ultrahigh Frequency Range

    DEFF Research Database (Denmark)

    Bumeliene, S.; Tamasevicius, A.; Mykolaitis, G.

    2006-01-01

    A hardware prototype of the two-stage Colpitts oscillator employing the microwave BFG520 type transistors with the threshold frequency of 9 GHz and designed to operate in the ultrahigh frequency range (300–1000 MHz) is described. The practical circuit in addition to the intrinsic two...

  9. Tuning the Polarization State of Light over a Broad Frequency Range with Metasurfaces

    Science.gov (United States)

    Wang, Mu; Jiang, Shang-Chi; Wang, Zheng-Han; Xiong, Xiang; Peng, Ru-Wen; Nanjing University Team

    Controlling the polarization state, the transmission direction and the phase of light within a confined space is an important issue in optics. By integrating metallic metastructure and dielectric interlayer, it is possible to realize the dispersion-free broadband device on sub-wavelength scale, where the strong response of the metallic structures helps to decrease the device size while the dielectric interlayer helps to eliminate the dispersion simultaneously in both the amplitude and the phase difference of the reflected/transmitted light. As an examples to apply this concept, a broadband quarter-wave plate and a half-wave plate are experimentally demonstrated. By carefully selecting the structural parameters, the polarization state of light can be freely tuned across a broad frequency range, and all of the polarization states on the Poincaré sphere can be realized dispersion free. Some contents of this talk can be found in the following references: [1] S.-C. Jiang, et al., High-efficiency generation of circularly polarized light via symmetry-induced anomalous reflection,Physical Review B 91, 125421 (2015), [2] S.-C. Jiang, et al., Controlling the Polarization State of Light with a Dispersion-Free Metastructure, Physical Review X 4, 021026 (2014), [3] X. Xiong, et al., Metallic stereostructured layer: an approach for broadband polarization state manipulation,Applied Physics Letters 105, 201105 (2014).

  10. Temperature- and frequency-dependent dielectric properties of biological tissues within the temperature and frequency ranges typically used for magnetic resonance imaging-guided focused ultrasound surgery.

    Science.gov (United States)

    Fu, Fanrui; Xin, Sherman Xuegang; Chen, Wufan

    2014-02-01

    This study aimed to obtain the temperature- and frequency-dependent dielectric properties of tissues subjected to magnetic resonance (MR) scanning for MR imaging-guided focused ultrasound surgery (MRgFUS). These variables are necessary to calculate radio frequency electromagnetic fields distribution and specific radio frequency energy absorption rate (SAR) in the healthy tissues surrounding the target tumours, and their variation may affect the efficacy of advanced RF pulses. The dielectric properties of porcine uterus, liver, kidney, urinary bladder, skeletal muscle, and fat were determined using an open-ended coaxial probe method. The temperature range was set from 36 °C to 60 °C; and the frequencies were set at 42.58 (1 T), 64 (1.5 T), 128 (3 T), 170 (4 T), 298 (7 T), 400 (9 T), and 468 MHz (11 T). Within the temperature and frequency ranges, the dielectric constants were listed as follows: uterus 49.6-121.64, liver 44.81-127.68, kidney 37.3-169.26, bladder 42.43-125.95, muscle 58.62-171.7, and fat 9.2327-20.2295. The following conductivities were obtained at the same temperature and frequency ranges: uterus 0.5506-1.4419, liver 0.5174-0.9709, kidney 0.8061-1.3625, bladder 0.6766-1.1817, muscle 0.8983-1.3083, and fat 0.1552-0.2316. The obtained data are consistent with the temperature and frequency ranges typically used in MRgFUS and thus can be used as reference to calculate radio frequency electromagnetic fields and SAR distribution inside the healthy tissues subjected to MR scanning for MRgFUS.

  11. Ion cyclotron range of frequencies heating of plasma with small impurity production

    Science.gov (United States)

    Ohkawa, Tihiro

    1987-01-01

    Plasma including plasma ions is magnetically confined by a magnetic field. The plasma has a defined outer surface and is intersected by resonance surfaces of respective common ion cyclotron frequency of a predetermined species of plasma ions moving in the magnetic field. A radio frequency source provides radio frequency power at a radio frequency corresponding to the ion cyclotron frequency of the predetermined species of plasma ions moving in the field at a respective said resonance surface. RF launchers coupled to the radio frequency source radiate radio frequency energy at the resonance frequency onto the respective resonance surface within the plasma from a plurality of locations located outside the plasma at such respective distances from the intersections of the respective resonance surface and the defined outer surface and at such relative phases that the resulting interference pattern provides substantially null net radio frequency energy over regions near and including substantial portions of the intersections relative to the radio frequency energy provided thereby at other portions of the respective resonance surface within the plasma.

  12. Radio pill antenna range test

    Science.gov (United States)

    Cummins, W. F.; Kane, R. J.

    1992-05-01

    In order to investigate the potential of a proposed 'radio pill' beacon transmitter, a range test experiment was devised and carried out in the VHF frequency range. Calculations and previous work indicated that optimum sensitivity and, thus, distance would be obtained in this frequency range provided body radio-frequency (RF) absorption was not too great. A ferrite-core loop antenna is compatible with a pill geometry and has better radiation efficiency than an air core loop. The ferrite core may be a hollow cylinder with the electronics and batteries placed inside. However, this range test was only concerned with experimentally developing test range data on the ferrite core antenna itself. A one turn strap loop was placed around a 9.5 mm diameter by 18.3 mm long stack of ferrite cores. This was coupled to a 50 Omega transmission line by 76 mm of twisted pair line and a capacitive matching section. This assembly was excited by a signal generator at output levels of -10 to +10 dBm. Signals were received on a VHF receiver and tape recorder coupled to a 14 element, circularly polarized Yagi antenna at a height of 2.5 m. Field strength measurements taken at ranges of 440, 1100, and 1714 m. Maximum field strengths referenced to 0 dBm transmitter level were -107 to -110 dB at 440 m, -124 to -127 dBm at 1100 m, and -116 to -119 dBm at 1714 m when the antenna cylinder was horizontal. Field strengths with a vertical antenna were about 6 dB below these values. The latter transmit site was elevated and had a clear line-of-site path to the receiving site. The performance of this test antenna was better than that expected from method-of-moment field calculations. When this performance data is scaled to a narrow bandwidth receiving system, ground level receiving ranges of a few to 10 km can be expected. Clear line-of-sight ranges where either or both the transmitter and receiver are elevated could vary from several km to 100 km.

  13. GNSS single frequency ionospheric range delay corrections: NeQuick data ingestion technique

    Science.gov (United States)

    Oladipo, O. A.; Schüler, Torben

    2012-11-01

    A study of the performance of the NeQuick model and the Klobuchar model for GNSS single frequency range delay correction on a global scale was done using data for moderate solar activity. In this study NeQuick was used in the way intended for Galileo. This study is to assess the performance of the two models at each ionospheric geographic region during moderate solar activity as previously published studies were concentrated only on high solar activity. The results obtained showed that NeQuick outperformed Klobuchar for the whole year at the three geographical regions of the ionosphere. In terms of monthly root mean square of mismodeling, NeQuick outperformed Klobuchar by 15 TECU or more at low-latitudes, 5 TEC or more at mid-latitudes, and 1 TECU or more at high-latitudes. Also, a study on how the data ingestion technique already developed for NeQuick could be expanded in order to reduce the deviation of NeQuick TEC prediction from observation for a particular day based on the information from the previous day was done. Instead of obtaining a regularly spaced Az grid from monitoring stations spread across the region of interest, we obtained hourly Az coefficients from hourly Az from designated monitoring stations. The obtained hourly Az coefficients were then used to drive NeQuick for the next day at the test stations. The results obtained, in terms of daily RMS of mismodeling, showed a daily maximum improvement of 26.0% at low-latitudes, 54.9% at mid-latitudes, and 41.3% at high-latitudes.

  14. Relationships between range access as monitored by radio frequency identification technology, fearfulness, and plumage damage in free-range laying hens.

    Science.gov (United States)

    Hartcher, K M; Hickey, K A; Hemsworth, P H; Cronin, G M; Wilkinson, S J; Singh, M

    2016-05-01

    Severe feather-pecking (SFP), a particularly injurious behaviour in laying hens (Gallus gallus domesticus), is thought to be negatively correlated with range use in free-range systems. In turn, range use is thought to be inversely associated with fearfulness, where fearful birds may be less likely to venture outside. However, very few experiments have investigated the proposed association between range use and fearfulness. This experiment investigated associations between range use (time spent outside), fearfulness, plumage damage, and BW. Two pens of 50 ISA Brown laying hens (n=100) were fitted with radio frequency identification (RFID) transponders (contained within silicone leg rings) at 26 weeks of age. Data were then collected over 13 days. A total of 95% of birds accessed the outdoor run more than once per day. Birds spent an average duration of 6.1 h outside each day over 11 visits per bird per day (51.5 min per visit). The top 15 and bottom 15 range users (n=30), as determined by the total time spent on the range over 13 days, were selected for study. These birds were tonic immobility (TI) tested at the end of the trial and were feather-scored and weighed after TI testing. Birds with longer TI durations spent less time outside (P=0.01). Plumage damage was not associated with range use (P=0.68). The small group sizes used in this experiment may have been conducive to the high numbers of birds utilising the outdoor range area. The RFID technology collected a large amount of data on range access in the tagged birds, and provides a potential means for quantitatively assessing range access in laying hens. The present findings indicate a negative association between fearfulness and range use. However, the proposed negative association between plumage damage and range use was not supported. The relationships between range use, fearfulness, and SFP warrant further research.

  15. Extending the frequency range of free-field reciprocity calibration of measurement microphones to frequencies up to 150 kHz

    DEFF Research Database (Denmark)

    Barrera Figueroa, Salvador; Torras Rosell, Antoni; Jacobsen, Finn

    2013-01-01

    Measurement microphones are typically calibrated in a free field at frequencies up to 50 kHz. This is a sufficiently high frequency for the most sound measurement applications related with noise assessment. However, other applications such as the measurement of noise emitted by ultrasound cleaning...... machines and failure detection in aeronautic structures require that the sensitivity of the microphone is known at frequencies up to 150 kHz. Another area of particular interest is the investigation of the perception mechanisms of ultrasound. In any of these applications, it is of fundamental importance...... to establish a well-defined traceability chain to support the measurement results. In order to extend the frequency range of free-field calibration the measurement system and measurement methods must undergo a series of changes and adaptations including the type of excitation signal, techniques for eliminating...

  16. Effects of the gaseous and liquid water content of the atmosphere on range delay and Doppler frequency

    Science.gov (United States)

    Flock, W. L.

    1981-01-01

    When high precision is required for range measurement on Earth space paths, it is necessary to correct as accurately as possible for excess range delays due to the dry air, water vapor, and liquid water content of the atmosphere. Calculations based on representative values of atmospheric parameters are useful for illustrating the order of magnitude of the expected delays. Range delay, time delay, and phase delay are simply and directly related. Doppler frequency variations or noise are proportional to the time rate of change of excess range delay. Tropospheric effects were examined as part of an overall consideration of the capability of precision two way ranging and Doppler systems.

  17. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  18. A theoretical study on directivity control of multiple-loudspeaker system with a quadrupole radiation pattern in low frequency range

    Science.gov (United States)

    Irwansyah, Kuse, Naoyuki; Usagawa, Tsuyoshi

    2017-08-01

    Directivity pattern of an ordinary loudspeaker becomes more directive at higher frequencies. However, because a single loudspeaker tends to radiate uniformly in all directions at low frequencies, reverberation from surrounding building walls may affect speech intelligibility when installing a multiple-loudspeaker system at crossroads. As an alternative, a sharply directive sound source is recommended to be used, but in many cases the directivity of an ordinary loudspeaker is less sharp at lower frequencies. Therefore, in order to overcome such a limitation, this paper discusses the possibility of using four loudspeakers under active control to realize a quadrupole radiation pattern in low frequency range. In this study, the radiation pattern of a primary loudspeaker and three secondary loudspeakers has been modelled. By placing the loudspeakers close together in the direction of 0°, 90°, 180°, and 270°, it was theoretically demonstrated that a quadrupole radiation pattern can be shaped in the target frequency range up to 600 Hz by simply controlling the directivity in three of four directions which are 45°, 135°, 225°, and 315°. Although, the radiation pattern model is far from realistic configurations and conditions, it is possible to realize a quadrupole radiation pattern in the low frequency range.

  19. HIGH DYNAMIC RANGE OBSERVATIONS OF SOLAR CORONAL TRANSIENTS AT LOW RADIO FREQUENCIES WITH A SPECTRO-CORRELATOR

    Energy Technology Data Exchange (ETDEWEB)

    Hariharan, K.; Ramesh, R.; Kathiravan, C.; Rajalingam, M. [Indian Institute of Astrophysics, Bangalore-560034 (India); Abhilash, H. N., E-mail: khariharan@iiap.res.in [Poornaprajna College, Udupi-576101 (India)

    2016-02-15

    A new antenna system with a digital spectro-correlator that provides high temporal, spectral, and amplitude resolutions has been commissioned at the Gauribidanur Observatory near Bangalore in India. Presently, it is used for observations of the solar coronal transients in the scarcely explored frequency range ≈30–15 MHz. The details of the antenna system, the associated receiver setup, and the initial observational results are reported. Some of the observed transients exhibited quasi-periodicity in their time profiles at discrete frequencies. Estimates of the associated magnetic field strength (B) indicate that B ≈ 0.06–1 G at a typical frequency such as 19.5 MHz.

  20. Very High Frequency Interleaved Self-Oscillating Resonant SEPIC Converter

    DEFF Research Database (Denmark)

    Kovacevic, Milovan; Knott, Arnold; Andersen, Michael A. E.

    2013-01-01

    This paper describes analysis and design procedure of an interleaved, self-oscillating resonant SEPIC converter, suitable for operation at very high frequencies (VHF) ranging from 30 MHz to 300 MHz. The presented circuit consists of two resonant SEPIC DC-DC converters, and a capacitive...... interconnection network between the switches which provides self-oscillating and interleaved operation. A design approach to ensure zero voltage switching (ZVS) condition of the MOSFET devices is provided. To verify the proposed method, an 11 W, 50 MHz prototype was built using low-cost VDMOS devices...

  1. EMC Investigation of a Very High Frequency Self-oscillating Resonant Power Converter

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Knott, Arnold; Andersen, Michael A. E.

    2016-01-01

    This paper focuses on the electromagnetic compatibility (EMC) performance of a Very High Frequency (VHF) converter and how to lower the emissions. To test the EMC performance a VHF converter is implemented with a Class-E inverter and a Class-DE rectifier. The converter is designed to deliver 3 W...

  2. Wide-frequency range, dynamic matching network and power system for the "Shoelace" radio frequency antenna on the Alcator C-Mod tokamak.

    Science.gov (United States)

    Golfinopoulos, Theodore; LaBombard, Brian; Burke, William; Parker, Ronald R; Parkin, William; Woskov, Paul

    2014-04-01

    A wide-frequency range (50-300 kHz) power system has been implemented for use with a new RF antenna - the "Shoelace" antenna - built to drive coherent plasma fluctuations in the edge of the Alcator C-Mod tokamak. A custom, dynamically tunable matching network allows two commercial 1 kW, 50-Ω RF amplifiers to drive the low-impedance, inductive load presented by the antenna. This is accomplished by a discretely variable L-match network, with 81 independently selected steps available for each of the series and parallel legs of the matching configuration. A compact programmable logic device provides a control system that measures the frequency with better than 1 kHz accuracy and transitions to the correct tuning state in less than 1 ms. At least 85% of source power is dissipated in the antenna across the operational frequency range, with a minimum frequency slew rate of 1 MHz/s; the best performance is achieved in the narrower band from 80 to 150 kHz which is of interest in typical experiments. The RF frequency can be run with open-loop control, following a pre-programmed analog waveform, or phase-locked to track a plasma fluctuation diagnostic signal in real time with programmable phase delay; the amplitude control is always open-loop. The control waveforms and phase delay are programmed remotely. These tools have enabled first-of-a-kind measurements of the tokamak edge plasma system response in the frequency range and at the wave number at which coherent fluctuations regulate heat and particle transport through the plasma boundary.

  3. Human exposure to pulsed fields in the frequency range from 6 to 100 GHz

    Science.gov (United States)

    Laakso, Ilkka; Morimoto, Ryota; Heinonen, Juhani; Jokela, Kari; Hirata, Akimasa

    2017-09-01

    Restrictions on human exposure to electromagnetic waves at frequencies higher than 3-10 GHz are defined in terms of the incident power density to prevent excessive temperature rise in superficial tissue. However, international standards and guidelines differ in their definitions of how the power density is interpreted for brief exposures. This study investigated how the temperature rise was affected by exposure duration at frequencies higher than 6 GHz. Far-field exposure of the human face to pulses shorter than 10 s at frequencies from 6 to 100 GHz was modelled using the finite-difference time-domain method. The bioheat transfer equation was used for thermal modelling. We investigated the effects of frequency, polarization, exposure duration, and depth below the skin surface on the temperature rise. The results indicated limitations in the current human exposure guidelines and showed that radiant exposure, i.e. energy absorption per unit area, can be used to limit temperature rise for pulsed exposure. The data are useful for the development of human exposure guidelines at frequencies higher than 6 GHz.

  4. Intensity statistics of very high frequency sound scattered from wind-driven waves.

    Science.gov (United States)

    Walstead, Sean P; Deane, Grant B

    2016-05-01

    The interaction of vhf 100-1000 kHz underwater sound with the ocean surface is explored. The bistatic forward scatter of 300 kHz sound is measured in a wind driven wave channel. Fluctuations in arrival amplitude are described by the scintillation index (SI) which is a measure of arrival intensity variance. SI initially increases with wind speed but eventually saturates to a value of 0.5 when the root-mean-square (rms) roughness is 0.5 mm. An adjusted scintillation index (SI*) is suggested that accounts for the multiple arrivals and properly saturates to a value of 1. Fluctuations in arrival time do not saturate and increase proportionately to the dominant surface wave component. Forward scattering is modeled at frequencies ranging from 50 to 2000 kHz using the Helmholtz-Kirchhoff integral with surface wave realizations derived from wave gauge data. The amplitude and temporal statistics of the simulated scattering agree well with measured data. Intensity saturation occurs at lower wind speeds for higher frequency sound. Both measured and modeled vhf sound is characterized by many surface arrivals at saturation. Doppler shifts associated with wave motion are expected to vary rapidly for vhf sound however further analysis is required.

  5. The effects of frequency range, vowel, dynamic loudness level, and gender on nasalance in amateur and classically trained singers.

    Science.gov (United States)

    Jennings, Jori Johnson; Kuehn, David P

    2008-01-01

    This study addresses two questions: (1) How much nasality is present in classical Western singing? (2) What are the effects of frequency range, vowel, dynamic level, and gender on nasality in amateur and classically trained singers? The Nasometer II 6400 by KayPENTAX (Lincoln Park, NJ) was used to obtain nasalance values from 21 amateur singers and 25 classically trained singers while singing an ascending five-tone scalar passage in low, mid, and high frequency ranges. Each subject sang the scalar passage at both piano and mezzo-forte dynamic loudness levels on each of the five cardinal vowels (/a/, /e/, /i/, /o/, /u/). A repeated mixed-model analysis indicated a significant main effect for the amateur/classically trained distinction, dynamic loudness level, and vowel, but not for frequency range or gender. The amateur singers had significantly higher nasalance scores than classically trained singers in all ranges and on all vowels except /o/. Dynamic loudness level had a significant effect on nasalance for all subject groups except for female majors in the mid- and high-frequency ranges. The vowel, /i/, received significantly higher nasalance than all of the other vowels. Although results of this study show that dynamic loudness level, vowel, and level of training in classical singing have a significant effect on nasality, nasalance scores for most subjects were relatively low. Only six of the subjects, all of whom were amateur singers, had average nasalance scores that could be considered hypernasal (ie, a nasalance average of 22 or above).

  6. Filter-free photonic frequency sextupler operated over a wide range of modulation index

    Science.gov (United States)

    Zhu, Zihang; Zhao, Shanghong; Li, Xuan; Qu, Kun; Lin, Tao

    2017-05-01

    An integrated dual-polarization modulator is proposed to generate frequency-sextupled microwave signal without an optical filter. The dual-polarization modulator can achieve even-order optical sidebands suppression modulation along the orthogonal polarization directions with different modulation index. By properly adjusting the power relationship of the orthogonal polarization directions, two optical first-order sidebands will cancel each other out. Thus, a pure frequency-sextupled signal with an optical sideband suppression ratio (OSSR) exceeding 38 dB and a radio frequency spurious suppression ratio (RFSSR) higher than 32 dB is generated, which match well with the theoretical analysis. Since there is no requirement to carefully adjust the modulation index to achieve correct operation of the sextupler, it is much easy to implement. Furthermore, it is also proved to be valid that even if the extinction ratios of the MZMs, the polarization angle of the polarizer, and the direct current (DC) bias phase shift deviate from the ideal values to a certain degree, the performance of the generated frequency-sextupled microwave signal is still acceptable.

  7. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  8. Investigation of hopped frequency waveforms for range and velocity measurements of radar targets

    CSIR Research Space (South Africa)

    Kathree, U

    2015-10-01

    Full Text Available In the field of radar, High Range Resolution (HRR) profiles are often used to improve target tracking accuracy in range and to allow the radar system to produce an image of an object using techniques such as inverse synthetic aperture radar (ISAR...

  9. Study on the resolution improvement of a range finder using the chaotic frequency characteristics of a laser diode

    Science.gov (United States)

    Saito, Takahiro; Maehara, Shinya; Doi, Kohei; Sato, Takashi; Ohdaira, Yasuo; Sakamoto, Shuichi; Ohkawa, Masashi

    2017-06-01

    An optical range finder system that relies on laser diodes' frequency noise, instead of intensity or frequency modulations, and its improvement in resolution are reported. The distance to the target is measured by calculating the cross-correlation of two signals reflected from the target and reference mirrors. These two signals are converted from the laser diodes' frequency noise signals by frequency/intensity converters, such as a Fabry-Perot etalon. We obtained the distance to the target by checking time lags between the target and reference beams at the highest correlation coefficient. We also measured the change in the correlation coefficient around the peak sampling point by adjusting the reference-path length, achieving a resolving power of ±3 mm.

  10. A study of the electromagnetic shielding mechanisms in the GHz frequency range of graphene based composite layers

    Energy Technology Data Exchange (ETDEWEB)

    Drakakis, E. [Electrical Engineering Department, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Kymakis, E. [Electrical Engineering Department, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Tzagkarakis, G.; Louloudakis, D.; Katharakis, M. [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Kenanakis, G. [Institute of Electronic Structure & Laser (IESL), Foundation for Research and Technology (FORTH) Hellas, Heraklion (Greece); Suchea, M.; Tudose, V. [Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Chemistry Faculty, “Al.I.Cuza” University of Iasi, Iasi (Romania); Koudoumas, E., E-mail: koudoumas@staff.teicrete.gr [Electrical Engineering Department, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece); Center of Materials Technology and Photonics, School of Engineering, Technological Educational Institute of Crete, Heraklion (Greece)

    2017-03-15

    Highlights: • Optimum paint contents should be chosen so that homogeneous and uniform nanocomposite layers exist exhibiting effective electromagnetic shielding. • The electromagnetic shielding in the frequency range studied comes mainly from absorption and increases with frequency. • Reflection reduces with increasing frequency, the decrease rate being smaller than that of the increase in absorption. • The shielding efficiency depends on both conductivity and thickness, the first dependence being more pronounced. - Abstract: We report on the mechanisms of the electromagnetic interference shielding effect of graphene based paint like composite layers. In particular, we studied the absorption and reflection of electromagnetic radiation in the 4–20 GHz frequency of various dispersions employing different amounts of graphene nanoplatelets, polyaniline, and poly(3,4-ethylenedioxythiophene)-poly(styrenesulfonate), special attention given on the relative contribution of each process in the shielding effect. Moreover, the influence of the composition, the thickness and the conductivity of the composite layers on the electromagnetic shielding was also examined.

  11. Measurement of Ion Motional Heating Rates over a Range of Trap Frequencies and Temperatures

    CERN Document Server

    Bruzewicz, C D; Chiaverini, J

    2014-01-01

    We present measurements of the motional heating rate of a trapped ion at different trap frequencies and temperatures between $\\sim$0.6 and 1.5 MHz and $\\sim$4 and 295 K. Additionally, we examine the possible effect of adsorbed surface contaminants with boiling points below $\\sim$105$^{\\circ}$C by measuring the ion heating rate before and after locally baking our ion trap chip under ultrahigh vacuum conditions. We compare the heating rates presented here to those calculated from available electric-field noise models. We can tightly constrain a subset of these models based on their expected frequency and temperature scaling interdependence. Discrepancies between the measured results and predicted values point to the need for refinement of theoretical noise models in order to more fully understand the mechanisms behind motional trapped-ion heating.

  12. Effects of laser frequency chirp on modal noise in short-range radio over multimode fiber links

    DEFF Research Database (Denmark)

    Visani, Davide; Tartarini, Giovanni; Petersen, Martin Nordal

    2010-01-01

    An important effect of the frequency chirp of the optical transmitter in radio over multimode fiber links is put into evidence experimentally and modeled theoretically for the first time, to our knowledge. This effect can have an important impact in short-range connections, where, although...

  13. Coherent lidar modulated with frequency stepped pulse trains for unambiguous high duty cycle range and velocity sensing in the atmosphere

    DEFF Research Database (Denmark)

    Lindelöw, Per Jonas Petter; Mohr, Johan Jacob

    2007-01-01

    Range unambiguous high duty cycle coherent lidars can be constructed based on frequency stepped pulse train modulation, even continuously emitting systems could be envisioned. Such systems are suitable for velocity sensing of dispersed targets, like the atmosphere, at fast acquisition rates...

  14. Aerial low-frequency hearing in captive and free-ranging harbour seals (Phoca vitulina) measured using auditory brainstem responses

    NARCIS (Netherlands)

    Lucke, K.; Hastie, Gordon D.; Ternes, Kerstin; McConnell, Bernie; Moss, Simon; Russell, Deborah J.F.; Weber, Heike; Janik, Vincent M.

    2016-01-01

    The hearing sensitivity of 18 free-ranging and 10 captive harbour seals (Phoca vitulina) to aerial sounds was measured in the presence of typical environmental noise through auditory brainstem response measurements. A focus was put on the comparative hearing sensitivity at low frequencies. Low-

  15. CMOS radio frequency circuits for short-range direct-conversion receivers

    OpenAIRE

    Kaukovuori, Jouni

    2008-01-01

    The research described in this thesis is focused on the design and implementation of radio frequency (RF) circuits for direct-conversion receivers. The main interest is in RF front-end circuits, which contain low-noise amplifiers, downconversion mixers, and quadrature local oscillator signal generation circuits. Three RF front-end circuits were fabricated in a short-channel CMOS process and experimental results are presented. A low-noise amplifier (LNA) is typically the first amplifying b...

  16. Historic Frequency and Severity of Fire in Whitebark Pine Forests of the Cascade Mountain Range, USA

    OpenAIRE

    Michael P. Murray; Joel Siderius

    2018-01-01

    Whitebark pine (Pinus albicaulis Engelm.) is a foundation species of high elevation forest ecosystems in the Cascade Mountain Range of Oregon, Washington, and British Columbia. We examined fire evidence on 55 fire history sites located in the Cascade Range. To estimate dates of historic fires we analyzed 57 partial cross-sections from fire-scarred trees plus 700 increment cores. The resulting 101 fire events indicate fire has been a widespread component of Cascadian whitebark pine stands. Res...

  17. Full-range swept source optical coherence tomography based on carrier frequency by transmissive dispersive optical delay line.

    Science.gov (United States)

    Wu, Tong; Ding, Zhihua; Wang, Chuan; Chen, Minghui

    2011-12-01

    A high speed swept source optical coherence tomography (SS-OCT) system capable of full-range imaging is presented. Wave-number carrier frequency is introduced into the spectral interference signal by a transmissive dispersive optical delay line (TDODL). High carrier frequency in the spectral interference signal corresponding to an equivalent distance-shift is exploited to obtain full-range OCT imaging. Theoretical development is conducted with the instantaneous coherence function introduced for a complete description of a spectral interference signal. Performance advantage of the TDODL-based method over the conventional approach where only one side (positive or negative path length difference) is used for imaging to avoid overlaying mirror artifacts is confirmed by the measured envelopes of spectral interference signal. Feasibility of the proposed method for full-range imaging is validated in a custom-built SS-OCT system by in vivo imaging of a biological sample.

  18. High resolution kilometric range optical telemetry in air by radio frequency phase measurement

    Energy Technology Data Exchange (ETDEWEB)

    Guillory, Joffray; García-Márquez, Jorge; Truong, Daniel; Wallerand, Jean-Pierre [Laboratoire Commun de Métrologie LNE-Cnam (LCM), LNE, 1 rue Gaston Boissier, 75015 Paris (France); Šmíd, Radek [Laboratoire Commun de Métrologie LNE-Cnam (LCM), LNE, 1 rue Gaston Boissier, 75015 Paris (France); Institute of Scientific Instruments of the CAS, Kralovopolska 147, 612 64 Brno (Czech Republic); Alexandre, Christophe [Centre d’Études et de Recherche en Informatique et Communications (CEDRIC), Cnam, 292 rue St-Martin, 75003 Paris (France)

    2016-07-15

    We have developed an optical Absolute Distance Meter (ADM) based on the measurement of the phase accumulated by a Radio Frequency wave during its propagation in the air by a laser beam. In this article, the ADM principle will be described and the main results will be presented. In particular, we will emphasize how the choice of an appropriate photodetector can significantly improve the telemeter performances by minimizing the amplitude to phase conversion. Our prototype, tested in the field, has proven its efficiency with a resolution better than 15 μm for a measurement time of 10 ms and distances up to 1.2 km.

  19. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  20. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  1. Study of transmission line attenuation in broad band millimeter wave frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Pandya, Hitesh Kumar B. [ITER-India, IPR, Gandhinagar, Gujarat (India); Austin, M. E. [Institute for Fusion Studies, the University of Texas at Austin, Austin, Texas (United States); Ellis, R. F. [Laboratory for Plasma and Fusion Energy Studies, University of Maryland, College Park, Maryland 20742 (United States)

    2013-10-15

    Broad band millimeter wave transmission lines are used in fusion plasma diagnostics such as electron cyclotron emission (ECE), electron cyclotron absorption, reflectometry and interferometry systems. In particular, the ECE diagnostic for ITER will require efficient transmission over an ultra wide band, 100 to 1000 GHz. A circular corrugated waveguide transmission line is a prospective candidate to transmit such wide band with low attenuation. To evaluate this system, experiments of transmission line attenuation were performed and compared with theoretical loss calculations. A millimeter wave Michelson interferometer and a liquid nitrogen black body source are used to perform all the experiments. Atmospheric water vapor lines and continuum absorption within this band are reported. Ohmic attenuation in corrugated waveguide is very low; however, there is Bragg scattering and higher order mode conversion that can cause significant attenuation in this transmission line. The attenuation due to miter bends, gaps, joints, and curvature are estimated. The measured attenuation of 15 m length with seven miter bends and eighteen joints is 1 dB at low frequency (300 GHz) and 10 dB at high frequency (900 GHz), respectively.

  2. Range Detection of the Extremely Low-Frequency Magnetic Field Produced by Laptop's AC Adapter

    Science.gov (United States)

    Brodić, Darko; Amelio, Alessia

    2017-02-01

    Human exposure to extremely low frequency magnetic field represents a risk to their health. This paper takes into consideration the level of an extremely low-frequency magnetic field between 30 and 300 Hz emitted by an AC laptop adapter. The experiment consists of testing 17 different AC adapters for laptops. During the testing, laptops are operated in a normal operating conditions as well as under heavy load. The magnetic field measurement is conducted in the area around the AC adapter. Obtained data is evaluated according to the critical level of the magnetic field proposed by safety standards. Furthermore, data is classified by a K-medians method in order to determine the critical levels of the magnetic field exposure in the nearby area of the AC adapter. Obtained classifications are evaluated according to safety standards, giving a critical analysis of magnetic field areas at risk. Due to emission of a very strong magnetic field in certain areas, a recommendation for safety use of the AC adapter is proposed.

  3. Study of transmission line attenuation in broad band millimeter wave frequency range.

    Science.gov (United States)

    Pandya, Hitesh Kumar B; Austin, M E; Ellis, R F

    2013-10-01

    Broad band millimeter wave transmission lines are used in fusion plasma diagnostics such as electron cyclotron emission (ECE), electron cyclotron absorption, reflectometry and interferometry systems. In particular, the ECE diagnostic for ITER will require efficient transmission over an ultra wide band, 100 to 1000 GHz. A circular corrugated waveguide transmission line is a prospective candidate to transmit such wide band with low attenuation. To evaluate this system, experiments of transmission line attenuation were performed and compared with theoretical loss calculations. A millimeter wave Michelson interferometer and a liquid nitrogen black body source are used to perform all the experiments. Atmospheric water vapor lines and continuum absorption within this band are reported. Ohmic attenuation in corrugated waveguide is very low; however, there is Bragg scattering and higher order mode conversion that can cause significant attenuation in this transmission line. The attenuation due to miter bends, gaps, joints, and curvature are estimated. The measured attenuation of 15 m length with seven miter bends and eighteen joints is 1 dB at low frequency (300 GHz) and 10 dB at high frequency (900 GHz), respectively.

  4. Dynamic stiffness of chemically and physically ageing rubber vibration isolators in the audible frequency range. Part 1: constitutive equations

    Science.gov (United States)

    Kari, Leif

    2017-09-01

    The constitutive equations of chemically and physically ageing rubber in the audible frequency range are modelled as a function of ageing temperature, ageing time, actual temperature, time and frequency. The constitutive equations are derived by assuming nearly incompressible material with elastic spherical response and viscoelastic deviatoric response, using Mittag-Leffler relaxation function of fractional derivative type, the main advantage being the minimum material parameters needed to successfully fit experimental data over a broad frequency range. The material is furthermore assumed essentially entropic and thermo-mechanically simple while using a modified William-Landel-Ferry shift function to take into account temperature dependence and physical ageing, with fractional free volume evolution modelled by a nonlinear, fractional differential equation with relaxation time identical to that of the stress response and related to the fractional free volume by Doolittle equation. Physical ageing is a reversible ageing process, including trapping and freeing of polymer chain ends, polymer chain reorganizations and free volume changes. In contrast, chemical ageing is an irreversible process, mainly attributed to oxygen reaction with polymer network either damaging the network by scission or reformation of new polymer links. The chemical ageing is modelled by inner variables that are determined by inner fractional evolution equations. Finally, the model parameters are fitted to measurements results of natural rubber over a broad audible frequency range, and various parameter studies are performed including comparison with results obtained by ordinary, non-fractional ageing evolution differential equations.

  5. Range imaging results from polar mesosphere summer echoes

    Science.gov (United States)

    Zecha, Marius; Hoffmann, Peter; Rapp, Markus; Chen, Jenn-Shyong

    The range resolution of pulsed radars is usually limited by the transmitting pulse length and the sampling time. The so-called range imaging (RIM) has been developed to reduce these lim-itations. To apply this method the radar operates alternately over a set of distinct frequencies. Then the phase differences of the receiving signals can be used for optimization methods to generate high-resolution maps of reflections as function of range insight the pulse length. The technique has been implemented on the ALWIN VHF radar in Andenes (69) and the OSWIN VHF radar in Kühlungsborn (54N). Here we present results of the RIM method from measurements in polar mesosphere summer echoes -PMSE. These strong radar echoes are linked to ice particle clouds in the mesopause region. The dynamic of the PMSE can be reflected very well by RIM. The movement of PMSE and the edges of the extension can be tracked with a high altitude resolution. Comparisons between simultaneous measurements by RIM and by standard radar techniques demonstrate the advan-tages of RIM. Wave structures can be identified with RIM whereas they are not detectable with the lesser resolution of the standard measurements. Gravity wave parameter associated with these variations are estimated using the simultaneous measured velocity field.

  6. Digital predistortion of 75–110 GHz W-band frequency multiplier for fiber wireless short range access systems

    DEFF Research Database (Denmark)

    Zhao, Ying; Deng, Lei; Pang, Xiaodan

    2011-01-01

    We present a W-band fiber-wireless transmission system based on a nonlinear frequency multiplier for high-speed wireless short range access applications. By implementing a baseband digital signal predistortion scheme, intensive nonlinear distortions induced in a sextuple frequency multiplier can...... be effectively pre-compensated. Without using costly W-band components, a transmission system with 26km fiber and 4m wireless transmission operating at 99.6GHz is experimentally validated. Adjacent-channel power ratio (ACPR) improvements for IQ-modulated vector signals are guaranteed and transmission...

  7. Complex magnetic susceptibility setup for spectroscopy in the extremely low-frequency range

    NARCIS (Netherlands)

    Kuipers, B.W.M.; Bakelaar, I.A.; Klokkenburg, M.; Erne, B.H.

    2008-01-01

    A sensitive balanced differential transformer was built to measure complex initial parallel magnetic susceptibility spectra in the 0.01–1000 Hz range. The alternating magnetic field can be chosen sufficiently weak that the magnetic structure of the samples is only slightly perturbed and the low

  8. Frequency and fitness consequences of bacteriophage φ6 host range mutations.

    Directory of Open Access Journals (Sweden)

    Brian E Ford

    Full Text Available Viruses readily mutate and gain the ability to infect novel hosts, but few data are available regarding the number of possible host range-expanding mutations allowing infection of any given novel host, and the fitness consequences of these mutations on original and novel hosts. To gain insight into the process of host range expansion, we isolated and sequenced 69 independent mutants of the dsRNA bacteriophage Φ6 able to infect the novel host, Pseudomonas pseudoalcaligenes. In total, we found at least 17 unique suites of mutations among these 69 mutants. We assayed fitness for 13 of 17 mutant genotypes on P. pseudoalcaligenes and the standard laboratory host, P. phaseolicola. Mutants exhibited significantly lower fitnesses on P. pseudoalcaligenes compared to P. phaseolicola. Furthermore, 12 of the 13 assayed mutants showed reduced fitness on P. phaseolicola compared to wildtype Φ6, confirming the prevalence of antagonistic pleiotropy during host range expansion. Further experiments revealed that the mechanistic basis of these fitness differences was likely variation in host attachment ability. In addition, using computational protein modeling, we show that host-range expanding mutations occurred in hotspots on the surface of the phage's host attachment protein opposite a putative hydrophobic anchoring domain.

  9. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  10. An Efficient Framework for Analysis of Wire-Grid Shielding Structures over a Broad Frequency Range

    Directory of Open Access Journals (Sweden)

    A. Karwowski

    2016-12-01

    Full Text Available A computationally efficient MoM-based framework for broadband electromagnetic simulation of wire-grid shielding structures is presented in the paper. Broadband capability of the approach is attained through supporting MoM by an adaptive frequency sweep combined with rational interpolation of the observable implemented via Stoer-Bulirsch algorithm. The performance increase is gained by employing CUDA-enabled CPU+GPU co-processing. For large-size problems exceeding the amount of memory available on the GPU device, a hybrid out-of-GPU memory LU decomposition algorithm is employed. The demonstration examples are provided to illustrate the the accuracy and high efficiency of the approach.

  11. Controlled X-ray pumping in a wide range of piezo-electric oscillation frequencies

    CERN Document Server

    Navasardyan, M A; Galoyan, K G

    1986-01-01

    In case of Laue diffraction the transmitted X-ray reflection in shown to be effectively controllable in the perfect quartz single crystal when it generates ultrasonic oscillations at the resonance frequency or in its vicinity. The maximum effective amplitude of applied sinusoidal oscillations is equal to 70 V. The pumping degree depends on the voltage amplitude. In this work monochromatic K subalpha sub 1 and K subalpha sub 2 molybdenum lines satisfying the thin crystal condition, mu t<=1, are used (mu is the linear absorption coefficient of the sample for the given wavelength and t is its thickness). The radiation was reflected from different planes such as (1011), (1011), (2022) etc. The complete pumping strongly restricts the structural factor possibilities in estimating the intensity of diffracted X-rays in case of considerable deformations in the bulk of perfect single crystal.

  12. Range-resolved interferometric signal processing using sinusoidal optical frequency modulation.

    Science.gov (United States)

    Kissinger, Thomas; Charrett, Thomas O H; Tatam, Ralph P

    2015-04-06

    A novel signal processing technique using sinusoidal optical frequency modulation of an inexpensive continuous-wave laser diode source is proposed that allows highly linear interferometric phase measurements in a simple, self-referencing setup. Here, the use of a smooth window function is key to suppress unwanted signal components in the demodulation process. Signals from several interferometers with unequal optical path differences can be multiplexed, and, in contrast to prior work, the optical path differences are continuously variable, greatly increasing the practicality of the scheme. In this paper, the theory of the technique is presented, an experimental implementation using three multiplexed interferometers is demonstrated, and detailed investigations quantifying issues such as linearity and robustness against instrument drift are performed.

  13. Magneto-dielectric properties of doped ferrite based nanosized ceramics over very high frequency range

    Directory of Open Access Journals (Sweden)

    Ashish Saini

    2016-06-01

    Full Text Available In the present study, indium doped nano sized nickel zinc cobalt based ferrite ceramics with composition Ni0.5Zn0.3Co0.2InxFe2-xO4 (x = 0.2 and 0.4 were synthesized by a co-precipitation technique. Powdered sample has been pre-sintered at 800 °C, pressed into toroids and finally sintered at 1000 °C. The single phase formation of the presintered powder has been confirmed by X ray diffraction (XRD. The average particle size of the presintered powder has been estimated by field emission scanning electron microscope (FESEM and found to be about ~60 nm for x = 0.2 and ~80 nm at x = 0.4. The electromagnetic characterization has been made using vector network analyzer. High value of permeability (17.3 and 15.2 for x = 0.2 and 0.4 respectively with low magnetic loss tangent of 10−1 order were obtained. Permittivity of 8.2 and 10, and dielectric loss tangent of the order of 10−2 were also achieved. With the measured electromagnetic parameters, miniaturization factor of 12.32 and normalized characteristic impedance close to unity (1.23 were obtained up to 100 MHz frequency. These fascinating parameters definitely propose Ni0.5Zn0.3Co0.2In0.4Fe1.6O4 ceramics as a substrate material for miniaturized antenna in very high frequency band. Possible reasons and mechanisms of electromagnetic properties for different concentrations of indium are discussed in the paper.

  14. Low-frequency source for very long-range underwater communication.

    Science.gov (United States)

    Mosca, Frédéric; Matte, Guillaume; Shimura, Takuya

    2013-01-01

    Very long-range underwater acoustic communication (UAC) is crucial for long cruising (>1000 km) autonomous underwater vehicles (AUVs). Very long-range UAC source for AUV must exhibit high electro-acoustic efficiency (>60%) and compactness. This paper describes the Janus-Hammer Bell (JHB) transducer that has been designed for this purpose and meets those requirements. The transducer works on the 450-550 Hz bandwidth and reaches source level above 200 dB (ref. 1 μPa at 1 m) with 1 kW excitation and full immersion capability. JHB source has been used for communication experiments by the Japanese institute for marine technology (Japan Agency for Marine-Earth Science and Technology) achieving a baud rate of 100 bits/s at 1000 km.

  15. Properties of frequency distribution of Pc5-range pulsations observed with the Ekaterinburg decameter radar in the nightside ionosphere

    Science.gov (United States)

    Chelpanov, Maksim A.; Mager, Olga V.; Mager, Pavel N.; Klimushkin, Dmitri Yu.; Berngardt, Oleg I.

    2018-01-01

    A statistical study of waves in the magnetosphere registered with the midlatitude coherent decameter radar located near Ekaterinburg (EKB), Russia is presented. The radar monitors ionospheric flow velocities whose small-scale variations are evoked by magnetosphere ultra low frequency (ULF) waves of Pc5-range. Data from 16 events observed during 7 months in 2014 and 2015 underwent wavelet analysis. Frequencies of the oscillating components were compared with Alfvén eigenfrequencies, which were inferred from THEMIS and Van Allen spacecraft data. The comparison showed that only a minor part of the oscillations registered with the radar in the nightside ionosphere could be attributed to the Alfvén mode. A majority of the waves have lower frequencies, which do not show dependence on Alfvén eigenfrequency of a field line.

  16. Complex permeability and permittivity variation of carbonyl iron rubber in the frequency range of 2 to 18 GHz

    Directory of Open Access Journals (Sweden)

    Adriana Medeiros Gama

    2010-04-01

    Full Text Available The complex dielectric permittivity (e and magnetic permeability (m of Radar Absorbing Materials (RAM based on metallic magnetic particles (carbonyl iron particles embedded in a dielectric matrix (silicon rubber have been studied in the frequency range of 2 to 18 GHz. The relative permeability and permittivity of carbonyl iron-silicon composites for various mass fractions are measured by the transmission/reflection method using a vector network analyzer. The concentration dependence of permittivity and permeability on the frequency is analyzed. In a general way, the results show that e´ parameter shows a more significant variation among the evaluated parameters (e”, m”, m’. The comparison of dielectric and magnetic loss tangents (e”/e” and m”/m’, respectively shows more clearly the variation of both parameters (e and m according to the frequency. It is also observed that higher carbonyl iron content fractions favor both dielectric and magnetic loss tangents.

  17. Impact of major and minor mode on EEG frequency range activities of music processing as a function of expertise.

    Science.gov (United States)

    Jenni, Raoul; Oechslin, Mathias S; James, Clara E

    2017-04-24

    Processing western tonal music may yield distinct brain responses depending on the mode of the musical compositions. Although subjective feelings in response to major and minor mode are well described, the underlying brain mechanisms and their development with increasing expertise have not been thoroughly examined. Using high-density electroencephalography, the present study investigated neuronal activities in the frequency domain in response to polyphone musical compositions in major and minor mode in non-musicians, amateurs and experts. During active listening decrease of theta- and gamma-frequency range activities occurred with increasing expertise in right posterior regions, possibly reflecting enhanced processing efficiency. Moreover, minor and major compositions distinctively modulated synchronization of neuronal activities in high frequency ranges (beta and gamma) in frontal regions, with increased activity in response to minor compositions in musicians and in experts in particular. These results suggest that high-frequency electroencephalographic (EEG) activities carry information about musical mode, showing gradual increase of processing efficiency and sensitivity with musical expertise. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Interaction of electromagnetic radiation with magnetically functionalized CNT nanocomposite in the subterahertz frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Atdaev, A.; Danilyuk, A. L.; Labunov, V. A.; Prischepa, S. L., E-mail: prischepa@bsuir.by [Belarusian State University of Informatics and Radioelectronics (Belarus); Pavlov, A. A. [Russian Academy of Sciences, Institute of Microelectronics Nanotechnologies (Russian Federation); Basaev, A. S.; Shaman, Yu. P. [SMC Technological Center (Russian Federation)

    2016-12-15

    The interaction of electromagnetic radiation with a magnetically functionalized nanocomposite based on carbon nanotubes (CNTs) is considered using the model of random distribution of ferromagnetic nanoparticles in the carbon matrix characterized by the presence of resistive–inductive–capacitive coupling (contours). The model is based on the representation of the nanocomposite as a system consisting of the CNT matrix, ferromagnetic nanoparticles, and the interfaces between CNTs and nanoparticles. The wide range of possible resonant phenomena caused both by the presence of contours and the properties of the CNT nanocomposite is shown.

  19. SmEdA vibro-acoustic modelling in the mid-frequency range including the effect of dissipative treatments

    Science.gov (United States)

    Hwang, H. D.; Maxit, L.; Ege, K.; Gerges, Y.; Guyader, J.-L.

    2017-04-01

    Vibro-acoustic simulation in the mid-frequency range is of interest for automotive and truck constructors. The dissipative treatments used for noise and vibration control such as viscoelastic patches and acoustic absorbing materials must be taken into account in the problem. The Statistical modal Energy distribution Analysis (SmEdA) model consists in extending Statistical Energy Analysis (SEA) to the mid-frequency range by establishing power balance equations between the modes of the different subsystems. The modal basis of uncoupled-subsystems that can be estimated by the finite element method in the mid-frequency range is used as input data. SmEdA was originally developed by considering constant modal damping factors for each subsystem. However, this means that it cannot describe the local distribution of dissipative materials. To overcome this issue, a methodology is proposed here to take into account the effect of these materials. This methodology is based on the finite element models of the subsystems that include well-known homogenized material models of dissipative treatments. The Galerkin method with subsystem normal modes is used to estimate the modal damping loss factors. Cross-modal coupling terms which appear in the formulation due to the dissipative materials are assumed to be negligible. An approximation of the energy sharing between the subsystems damped by dissipative materials is then described by SmEdA. The different steps of the method are validated experimentally by applying it to a laboratory test case composed of a plate-cavity system with different configurations of dissipative treatments. The comparison between the experimental and the simulation results shows good agreement in the mid-frequency range.

  20. The asymmetry of the entrainment range induced by the difference in intrinsic frequencies between two subgroups within the suprachiasmatic nucleus

    Science.gov (United States)

    Gu, Changgui; Yang, Huijie

    2017-06-01

    The rhythms of physiological and behavioral activities in mammals, which are regulated by the main clock suprachiasmatic nucleus (SCN) in the brain, can not be only synchronized to the natural 24 h light-dark cycle, but also to cycles with artificial periods. The range of the artificial periods that the animal can be synchronized to is called entrainment range. In the absence of the light-dark cycle, the animal can also maintain the circadian rhythm with an endogenous period close to 24 h. Experiments found that the entrainment range is not symmetrical with respect to the endogenous period. In the present study, an explanation is given for the asymmetry based on a Kuramoto model which describes the neuronal network of the SCN. Our numerical simulations and theoretical analysis show that the asymmetry results from the difference in the intrinsic frequencies between two subgroups of the SCN, as well as the entrainment range is affected by the difference.

  1. Frequency-swept Light Sources for Optical Coherence Tomography in the 1060nm range

    DEFF Research Database (Denmark)

    Marschall, Sebastian

    instrument in the biomedical eld, especially in ophthalmology, where it is used for diagnosing retinal diseases. Using light at 1060nm permits deep penetration into the retina and into the layers beneath, the choroid and the sclera. This wavelength range is also benecial for imaging in eyes affected...... by cataract. For the 1060nm band, rapidly tunable lasers|so-called swept sources|are available which enable ultra-high speed acquisition of large three-dimensional datasets. However, these light sources require further improvements: higher output power for sufficient signal quality and wider tuning bandwidth...... for better depth resolution in combination with high tuning speed. We investigate the performance of novel semiconductor laser gain media in fiber-based high-speed swept source prototypes. We demonstrate high output power using a tapered amplifier, and we achieve improved depth resolution with a broadband...

  2. A crossover trial comparing wide dynamic range compression and frequency compression in hearing aids for tinnitus therapy.

    Science.gov (United States)

    Hodgson, Shirley-Anne; Herdering, Regina; Singh Shekhawat, Giriraj; Searchfield, Grant D

    2017-01-01

    It has been suggested that frequency lowering may be a superior tinnitus reducing digital signal processing (DSP) strategy in hearing aids than conventional amplification. A crossover trial was undertaken to determine if frequency compression (FC) was superior to wide dynamic range compression (WDRC) in reducing tinnitus. A 6-8-week crossover trial of two digital signal-processing techniques (WDRC and 2 WDRC with FC) was undertaken in 16 persons with high-frequency sensorineural hearing loss and chronic tinnitus. WDRC resulted in larger improvements in Tinnitus Functional Index and rating scale scores than WDRC with FC. The tinnitus improvements obtained with both processing types appear to be due to reduced hearing handicap and possibly decreased tinnitus audibility. Hearing aids are useful assistive devices in the rehabilitation of tinnitus. FC was very successful in a few individuals but was not superior to WDRC across the sample. It is recommended that WDRC remain as the default first choice tinnitus hearing aid processing strategy for tinnitus. FC should be considered as one of the many other options for selection based on individual hearing needs. Implications of Rehabilitation Hearing aids can significantly reduce the effects of tinnitus after 6-8 weeks of use. Addition of frequency compression digital signal processing does not appear superior to standard amplitude compression alone. Improvements in tinnitus were correlated with reductions in hearing handicap.

  3. Frequency tripled 1542 nm telecom laser diode stabilized to iodine hyperfine line in the 10-15 range

    CERN Document Server

    Philippe, Charles; Holleville, David; Lours, Michel; Minh-Pham, Tuam; Hrabina, Jan; Burck, Frederic Du; Wolf, Peter; Acef, Ouali

    2016-01-01

    We report on telecom laser frequency stabilization to narrow iodine hyperfine line in the green range of the optical domain, after a frequency tripling process using two nonlinear PPLN crystals. We have generated up to 300 mW optical power in the green (P3w), from 800 mW of infrared power (Pw). This result corresponds to an optical conversion efficiency eta= P3w/Pw ~ 36 %. To our knowledge, this is the best value ever demonstrated for a CW frequency tripling process. We have used a narrow linewidth iodine hyperfine line (component a1 of the 127I2 R 35 (44-0) line) to stabilize the IR laser yielding to frequency stability of 4.8x10-14 t-1/2 with a minimum of 6x10-15 reached after 50 s of integration time. The whole optical setup is very compact and mostly optically fibered. This approach opens the way for efficient and elegant architecture development for space applications as one of several potential uses.

  4. Prominent facilitation at beta and gamma frequency range revealed with physiological calcium concentration in adult mouse piriform cortex in vitro.

    Directory of Open Access Journals (Sweden)

    Marie Gleizes

    Full Text Available Neuronal activity is characterized by a diversity of oscillatory phenomena that are associated with multiple behavioral and cognitive processes, yet the functional consequences of these oscillations are not fully understood. Our aim was to determine whether and how these different oscillatory activities affect short-term synaptic plasticity (STP, using the olfactory system as a model. In response to odorant stimuli, the olfactory bulb displays a slow breathing rhythm as well as beta and gamma oscillations. Since the firing of olfactory bulb projecting neurons is phase-locked with beta and gamma oscillations, structures downstream from the olfactory bulb should be driven preferentially at these frequencies. We examined STP exhibited by olfactory bulb inputs in slices of adult mouse piriform cortex maintained in vitro in an in vivo-like ACSF (calcium concentration: 1.1 mM. We replaced the presynaptic neuronal firing rate by repeated electrical stimulation (frequency between 3.125 and 100 Hz applied to the lateral olfactory tract. Our results revealed a considerable enhancement of postsynaptic response amplitude for stimulation frequencies in the beta and gamma range. A phenomenological model of STP fitted to the data suggests that the experimental results can be explained by the interplay between three mechanisms: a short-term facilitation mechanism (time constant ≈160 msec, and two short-term depression mechanisms (recovery time constants <20 msec and ≈140 msec. Increasing calcium concentration (2.2 mM resulted in an increase in the time constant of facilitation and in a strengthening of the slowest depression mechanism. As a result, response enhancement was reduced and its peak shifted toward the low beta and alpha ranges while depression became predominant in the gamma band. Using environmental conditions corresponding to those that prevail in vivo, our study shows that STP in the lateral olfactory tract to layer Ia synapse allows

  5. Multifunctional photoacoustic signals detected by P(VDF/TrFE) film sensor with a wide range of frequency

    Science.gov (United States)

    Ishihara, M.; Hirasawa, T.; Tsujita, K.; Kitagaki, M.; Bansaku, I.; Fujita, M.; Kikuchi, M.

    2011-03-01

    Photoacoustics has been widely studied as a combined imaging modality of both optical and acoustical methods. The merits of the photoacoustic imaging are realizing the full potentials of pulsed laser-tissue interaction. As the photoacoustic waves can be induced at chromophores by pulsed lased irradiation through a thermoelastic process, it covers a wide range of frequency. In order to take advantages of the wide range frequency characteristics, we employed not PZT, but piezoelectronic copolymer film, P(VDF/TrFE) film, with various thickness ranging from 20 to 100 μm as photoacoustic transducers. Because blood vessels play a key role in homeostasis, we experimentally demonstrated blood vessels phantom using second harmonic generation of Q-switched Nd:YAG laser and Ti:sapphire nanosecond laser pulses through optical fiber transmission. The detected photoacoustic waveforms showed distinctive time-of-flight signals. The photoacoustic signals were sensitive to temperature, absorption coefficients of chromophores, and diameters of the phantom vessels. Hemoglobin oxygen saturation could be easily derived from the multi wavelength photoacoustic signals using differential optical absorption characteristics. These results proved the functional quantitative photoacoustic imaging using the signal characteristics. A multivariate photoacoustic imaging approach must be promising to convenient diagnosis.

  6. Vibroacoustics of the piano soundboard: (Non)linearity and modal properties in the low- and mid-frequency ranges

    Science.gov (United States)

    Ege, Kerem; Boutillon, Xavier; Rébillat, Marc

    2013-03-01

    The piano soundboard transforms the string vibration into sound and therefore, its vibrations are of primary importance for the sound characteristics of the instrument. An original vibro-acoustical method is presented to isolate the soundboard nonlinearity from that of the exciting device (here: a loudspeaker) and to measure it. The nonlinear part of the soundboard response to an external excitation is quantitatively estimated for the first time, at ≈-40 dB below the linear part at the ff nuance. Given this essentially linear response, a modal identification is performed up to 3 kHz by means of a novel high resolution modal analysis technique [K. Ege, X. Boutillon, B. David, High-resolution modal analysis, Journal of Sound and Vibration 325 (4-5) (2009) 852-869]. Modal dampings (which, so far, were unknown for the piano in this frequency range) are determined in the mid-frequency domain where FFT-based methods fail to evaluate them with an acceptable precision. They turn out to be close to those imposed by wood. A finite-element modelling of the soundboard is also presented. The low-order modal shapes and the comparison between the corresponding experimental and numerical modal frequencies suggest that the boundary conditions can be considered as blocked, except at very low frequencies. The frequency-dependency of the estimated modal densities and the observation of modal shapes reveal two well-separated regimes. Below ≈1 kHz, the soundboard vibrates more or less like a homogeneous plate. Above that limit, the structural waves are confined by ribs, as already noticed by several authors, and localised in restricted areas (one or a few inter-rib spaces), presumably due to a slightly irregular spacing of the ribs across the soundboard.

  7. Structural partitioning of complex structures in the medium-frequency range. An application to an automotive vehicle

    Science.gov (United States)

    Kassem, M.; Soize, C.; Gagliardini, L.

    2011-02-01

    In a recent work [ Journal of Sound and Vibration 323 (2009) 849-863] the authors presented an energy-density field approach for the vibroacoustic analysis of complex structures in the low and medium frequency ranges. In this approach, a local vibroacoustic energy model as well as a simplification of this model were constructed. In this paper, firstly an extension of the previous theory is performed in order to include the case of general input forces and secondly, a structural partitioning methodology is presented along with a set of tools used for the construction of a partitioning. Finally, an application is presented for an automotive vehicle.

  8. Range of motion and stroke frequency differences between manual wheelchair propulsion and pushrim-activated power-assisted wheelchair propulsion.

    Science.gov (United States)

    Corfman, Thomas A; Cooper, Rory A; Boninger, Michael L; Koontz, Alicia M; Fitzgerald, Shirley G

    2003-01-01

    The objective of this study was to examine the use and efficacy of a pushrim-activated power-assist wheelchair (PAPAW) in the reduction of upper extremity range of motion (ROM) and stroke frequency in manual wheelchair users. Ten manual wheelchair users were evaluated using a repeated-measures design with and without the use of a PAPAW for maximum ROM of shoulder flexion/extension, abduction/adduction, internal/external rotation, and horizontal flexion/extension; elbow flexion/extension; wrist flexion/extension, supination/pronation, and ulnar/radial deviation; and stroke frequency. Participants propelled a Quickie 2 manual wheelchair configured as a PAPAW and their own wheelchair on a computer-controlled dynamometer at 3 different resistance levels and 2 different speeds. The use of the PAPAW significantly (P wrist flexion/extension and ulnar/radial deviation for many speed and resistance combinations. Univariate analysis revealed that stroke frequency was unaltered in all cases. These findings provide the foundation for studying the utility of the PAPAW in reducing the risk of upper limb injury and neuropathy in the manual wheelchair user population.

  9. The Digital Simulation of Synchronous Motors Fed by Voltage-Source Inverters Over Wide Speed and Frequency Ranges

    Science.gov (United States)

    Rowihal, Said Soliman

    Both voltage-source and current-source inverters are widely used for supplying three-phase power to induction motor drives, each having their advantages and disadvantages. For high power drives and applications requiring accurate speed and tracking coordination, the synchronous motors are the optimum choice. For constant speed applications of synchronous motor drives, current-source inverters tend to be favored as the motor can usually be operated in the overexcited leading power factor region, thus providing the inverter with sufficient electro-motive force to allow natural commutation. Generally speaking low speed operation of synchronous motors is not satisfactory from naturally commutated current-source inverters. To provide a dynamic range of speed and frequency would require expensive control circuitry and complicates the performance of the drive. The advantage of the voltage-source inverter for the wide range of speed and frequency control herein envisaged is that forced commutation is employed throughout the range and the commutating circuits have been well developed and established. On balance, voltage-source inverters represent a viable compromise for variable-speed three -phase synchronous motor drives including start-up. To investigate the transient response of the voltage -source fed-synchronous motor drives, a digital computer program is developed. The program is based on two models --machine model and inverter model. The machine is represented by a detailed two-axis model which includes the effects due to saliency, damper windings, and machine resistances. The inverter model represents a forced-commutated voltage-source inverter assuming ideal switching devices (thyristors and diodes). To cope with the wide variations of power factor during start-up, a thyristor with a reverse connected parallel diode are integrated as a bidirectional switch. The digital program provides the machine variables of interest (phase currents, field current, damper winding

  10. High-sensitivity operation of single-beam optically pumped magnetometer in a kHz frequency range

    Science.gov (United States)

    Savukov, I.; Kim, Y. J.; Shah, V.; Boshier, M. G.

    2017-03-01

    Optically pumped magnetometers (OPM) can be used in various applications, from magnetoencephalography to magnetic resonance imaging and nuclear quadrupole resonance (NQR). OPMs provide high sensitivity and have the significant advantage of non-cryogenic operation. To date, many magnetometers have been demonstrated with sensitivity close to 1 fT, but most devices are not commercialized. Most recently, QuSpin developed a model of OPM that is low cost, high sensitivity, and convenient for users, which operates in a single-beam configuration. Here we developed a theory of single-beam (or parallel two-beam) magnetometers and showed that it is possible to achieve good sensitivity beyond their usual frequency range by tuning the magnetic field. Experimentally we have tested and optimized a QuSpin OPM for operation in the frequency range from DC to 1.7 kHz, and found that the performance was only slightly inferior despite the expected decrease due to deviation from the spin-exchange relaxation-free regime.

  11. Viscoelastic behavior over a wide range of time and frequency in tin alloys: SnCd and SnSb

    Energy Technology Data Exchange (ETDEWEB)

    Quackenbush, J.; Brodt, M.; Lakes, R.S. [Univ. of Iowa, Iowa City, IA (United States)

    1996-08-01

    All materials exhibit some viscoelastic response, which can manifest itself as creep, relaxation, or, if the load is sinusoidal in time, a phase angle {delta} between stress and strain. Recently, a study of pure elements with low melting points, Cd, In, Pb, and Sn disclosed that cadmium exhibited a substantial loss tangent of 0.03 to 0.04 over much of the audio range of frequencies, combined with a moderate stiffness G = 20.7 GPa. Lead, by contrast, exhibited tan {delta} of 0.005 to 0.016 in the audio range. Indium exhibited a high loss tangent exceeding 0.1 at very low frequency. A eutectic alloy of indium and tin was found to exhibit substantial damping exceeding 0.1 below 0.1 Hz, and this alloy was used to make a composite exhibiting high stiffness and high damping. It is the purpose of this communication to present viscoelastic properties of two additional low melting point alloys, SnCd and SnSb. Both InSn and SnSb are used as solders. Although the melting point of Sb is 630.74 C, T{sub H} > 0.55 at ambient temperature for the alloy of SnSb (95 wt% Sn/5 wt% Sb) which melts near 240 C. Eutectic SnCd melts at 177 C so T{sub H} {approx} 0.65 at room temperature.

  12. Parametric nanomechanical amplification at very high frequency.

    Science.gov (United States)

    Karabalin, R B; Feng, X L; Roukes, M L

    2009-09-01

    Parametric resonance and amplification are important in both fundamental physics and technological applications. Here we report very high frequency (VHF) parametric resonators and mechanical-domain amplifiers based on nanoelectromechanical systems (NEMS). Compound mechanical nanostructures patterned by multilayer, top-down nanofabrication are read out by a novel scheme that parametrically modulates longitudinal stress in doubly clamped beam NEMS resonators. Parametric pumping and signal amplification are demonstrated for VHF resonators up to approximately 130 MHz and provide useful enhancement of both resonance signal amplitude and quality factor. We find that Joule heating and reduced thermal conductance in these nanostructures ultimately impose an upper limit to device performance. We develop a theoretical model to account for both the parametric response and nonequilibrium thermal transport in these composite nanostructures. The results closely conform to our experimental observations, elucidate the frequency and threshold-voltage scaling in parametric VHF NEMS resonators and sensors, and establish the ultimate sensitivity limits of this approach.

  13. Wolf, Canis lupus, visits to white-tailed deer, Odocoileus virginianus, summer ranges: Optimal foraging?

    Science.gov (United States)

    Demma, D.J.; Mech, L.D.

    2009-01-01

    We tested whether Wolf (Canis lupus) visits to individual female White-tailed Deer (Odocoileus virginianus) summer ranges during 2003 and 2004 in northeastern Minnesota were in accord with optimal-foraging theory. Using GPS collars with 10- to 30-minute location attempts on four Wolves and five female deer, plus eleven VHF-collared female deer in the Wolves' territory, provided new insights into the frequency of Wolf visits to summer ranges of female deer. Wolves made a mean 0.055 visits/day to summer ranges of deer three years and older, significantly more than their 0.032 mean visits/day to ranges of two-year-old deer, which generally produce fewer fawns, and most Wolf visits to ranges of older deer were much longer than those to ranges of younger deer. Because fawns comprise the major part of the Wolf's summer diet, this Wolf behavior accords with optimal-foraging theory.

  14. Spatial distribution of spectral parameters of high latitude geomagnetic disturbances in the Pc5/Pi3 frequency range

    Directory of Open Access Journals (Sweden)

    N. V. Yagova

    2010-09-01

    Full Text Available We analyze spectral parameters of the geomagnetic disturbances within the 1–4 mHz (Pc5/Pi3 frequency range for 29 observatories from polar to auroral latitudes. The main object of this study is the broadband (noise background under quiet and moderately disturbed conditions. To obtain a quantitative description of background high-latitude long period ULF activity the log-log dependence of the spectral power on frequency is expanded over Legendre polynomials, and the coefficients of this expansion (spectral moments are used to describe the most common features of these spectra. Not only the spectral power, but also the spectral slope and higher spectral moments, averaged over relatively long time intervals, demonstrate a systematic dependence on corrected geomagnetic (CGM latitude, Φ, and magnetic local time, MLT. The 2-D distributions of the spectral moments in Φ-MLT coordinates are characterized by existence of structures, narrow in latitude and extended in MLT, which can be attributed to the projections of different magnetospheric domains. Spatio-temporal distributions of spectral power of elliptically (P-component and randomly (N-component polarized signal are similar, but not identical. The N-component contribution to the total signal becomes non-negligible in regions with a high local activity, such as the auroral oval and dayside polar cusp. The spectral slope indicates a larger relative contribution of higher frequencies upon the latitude decrease, probably, as a result of the resonant effects in the ULF noise. The higher spectral moments are also controlled mostly by CGM latitude and MLT and are fundamentally different for the polarized and non-polarized components. This study is a step towards the construction of an empirical model of the ULF wave power in Earth's magnetosphere.

  15. Printed Circuit Board Integrated Toroidal Radio Frequency Inductors

    DEFF Research Database (Denmark)

    Kamby, Peter; Knott, Arnold; Andersen, Michael A. E.

    2012-01-01

    Modern power semiconductors allow for switching frequencies of power converters in the very high frequency (VHF) band (30 MHz to 300 MHz). The major advantage of this frequency increase is a remarkable reduction of the size of power converters due to smaller passive components. However crucial...

  16. A wide-frequency range AC magnetometer to measure the specific absorption rate in nanoparticles for magnetic hyperthermia

    Energy Technology Data Exchange (ETDEWEB)

    Garaio, E., E-mail: eneko.garayo@ehu.es [Elektrizitatea eta Elektronika Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Collantes, J.M. [Elektrizitatea eta Elektronika Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Garcia, J.A. [Fisika Aplikatua II Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Plazaola, F. [Elektrizitatea eta Elektronika Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Mornet, S. [Institut de Chimie de la Matière Condensée de Bordeaux, UPR 9048 CNRS / Université de Bordeaux, Bordeaux (France); Couillaud, F. [Résonance Magnétique des Systèmes Biologiques, UMR 5536 CNRS / Université de Bordeaux, Bordeaux (France); Sandre, O., E-mail: olivier.sandre@enscbp.fr [Laboratoire de Chimie des Polymères Organiques, UMR 5629 CNRS / Université de Bordeaux, Bordeaux (France)

    2014-11-15

    Measurement of specific absorption rate (SAR) of magnetic nanoparticles is crucial to assert their potential for magnetic hyperthermia. To perform this task, calorimetric methods are widely used. However, those methods are not very accurate and are difficult to standardize. In this paper, we present AC magnetometry results performed with a lab-made magnetometer that is able to obtain dynamic hysteresis-loops in the AC magnetic field frequency range from 50 kHz to 1 MHz and intensities up to 24 kA m{sup −1}. In this work, SAR values of maghemite nanoparticles dispersed in water are measured by AC magnetometry. The so-obtained values are compared with the SAR measured by calorimetric methods. Both measurements, by calorimetry and magnetometry, are in good agreement. Therefore, the presented AC magnetometer is a suitable way to obtain SAR values of magnetic nanoparticles. - Highlights: • We propose AC magnetometry as a method to measure the specific absorption rate (SAR) of magnetic nanoparticles suitable for magnetic hyperthermia therapy. • We have built a lab-made AC magnetometer, which is able to measure magnetic dynamic hysteresis-loops of nanoparticle dispersions. • The device works with AC magnetic field intensities up to 24 kA m{sup −1} in a frequency range from 75 kHz to 1 MHz. • The SAR values of maghemite nanoparticles around 12 nm in magnetic diameter dispersed in water are measured by the lab-made magnetometer and different calorimetric methods. • Although all methods are in good agreement, several factors (probe location, thermal inertia, losses, etc.) make calorimetric method less accurate than AC magnetometry.

  17. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  18. High aspect ratio MEMS capacitor for high frequency impedance matching applications

    DEFF Research Database (Denmark)

    Yalcinkaya, Arda Deniz; Jensen, Søren; Hansen, Ole

    2003-01-01

    We present a microelectromechanical tunable capacitor with a low control voltage, a wide tuning range and adequate electrical quality factor. The device is fabricated in a single-crystalline silicon layer using deep reactive ion etching (DRIE) for obtaining high-aspect ratio (> 20) parallel comb......-drive structures with vertical sidewalls. The process sequence for fabrication of the devices uses only one lithographic masking step and can be completed in a short time. The fabricated device was characterized with respect to electrical quality factor, tuning range, self-resonance frequency and transient...... response and it was found that the device is a suitable passive component to be used in impedance matching applications, band-pass filtering or voltage controlled oscillators in the Very High Frequency (VHF) and Ultra High Frequency (UHF) bands....

  19. Physics of the Brain. Prevention of the Epileptic Seizures by the Multi-photon Pulsed-operated Fiber Lasers in the Ultraviolet Range of Frequencies.

    Science.gov (United States)

    Stefan, V. Alexander; IAPS Team

    The novel study of the epileptogenesis mechanisms is proposed. It is based on the pulsed-operated (amplitude modulation) multi-photon (frequency modulation) fiber-laser interaction with the brain epilepsy-topion (the epilepsy onset area), so as to prevent the excessive electrical discharge (epileptic seizure) in the brain. The repetition frequency, Ω, matches the low frequency (epileptic) phonon waves in the brain. The laser repetition frequency (5-100 pulses per second) enables the resonance-scanning of the wide range of the phonon (possible epileptic-to-be) activity in the brain. The tunable fiber laser frequencies, Δω (multi photon operation), are in the ultraviolet frequency range, thus enabling monitoring of the electrical charge imbalance (within the 10s of milliseconds), and the DNA-corruption in the epilepsy-topion, as the possible cause of the disease. Supported by Nikola Tesla Labs., Stefan University.

  20. Microstrip Antennas with Polarization Diversity across a Wide Frequency Range and Phased Array Antennas for Radar and Satellite Communications

    Science.gov (United States)

    Ho, Kevin Ming-Jiang

    The thesis comprises of 3 projects; an L-band microstrip antenna with frequency agility and polarization diversity, X-band phased array antennas incorporating commercially packaged RFIC phased array chips, and studies for Ku/Ka-band shared aperture antenna array. The first project features the use of commercially packaged RF-MEMS SPDT switches, that boasts of high reliability, high linearity, low losses, hermetically packaged and fully compatible for SMTA processes for mass-assembly and production. Using the switches in a novel manner for the feed network, microstrip antennas with polarization diversity are presented. Frequency agility is achieved with the use of tuning diodes to provide capacitive loading to the antenna element. Additional inductance effects from surface-mounted capacitors, and its impact, is introduced. Theoretical cross-polarization of probe-fed antenna elements is presented for both linear and circular polarized microstrip antennas. Designs and measurements are presented, for microstrip antennas with polarization diversity, wide frequency tuning range, and both features. Replacement of the tuning diodes with commercially-packaged high Q RF MEMS tunable capacitors will allow for significant improvements to the radiation efficiency. In another project, multi-channel CMOS RFIC phased-array receiver chips are assembled in QFN packages and directly integrated on the same multi-layered PCB stack-up with the antenna arrays. Problems of isolation from the PCB-QFN interface, and potential performance degradation on antenna array from the use of commercial-grade laminates for assembly requirements, namely potential scan blindness and radiation efficiency, are presented. Causes for apparent drift of dielectric constant for microstrip circuits, and high conductor losses observed in measurements, are introduced. Finally, studies are performed for the design of a Ku/Ka-Band shared aperture array. Different approaches for developing dual-band shared apertures

  1. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  2. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  3. Main principles of passive devices based on graphene and carbon films in microwave-THz frequency range

    Science.gov (United States)

    Kuzhir, Polina P.; Paddubskaya, Alesia G.; Volynets, Nadezhda I.; Batrakov, Konstantin G.; Kaplas, Tommi; Lamberti, Patrizia; Kotsilkova, Rumiana; Lambin, Philippe

    2017-07-01

    The ability of thin conductive films, including graphene, pyrolytic carbon (PyC), graphitic PyC (GrPyC), graphene with graphitic islands (GrI), glassy carbon (GC), and sandwich structures made of all these materials separated by polymer slabs to absorb electromagnetic radiation in microwave-THz frequency range, is discussed. The main physical principles making a basis for high absorption ability of these heterostructures are explained both in the language of electromagnetic theory and using representation of equivalent electrical circuits. The idea of using carbonaceous thin films as the main working elements of passive radiofrequency (RF) devices, such as shields, filters, polarizers, collimators, is proposed theoretically and proved experimentally. The important advantage of PyC, GrI, GrPyC, and GC is that, in contrast to graphene, they either can be easily deposited onto a dielectric substrate or are strong enough to allow their transfer from the catalytic substrate without a shuttle polymer layer. This opens a new avenue toward the development of a scalable protocol for cost-efficient production of ultralight electromagnetic shields that can be transferred to commercial applications. A robust design via finite-element method and design of experiment for RF devices based on carbon/graphene films and sandwiches is also discussed in the context of virtual prototyping.

  4. Dispersion curves of viscoelastic plane waves and Rayleigh surface wave in high frequency range with fractional derivatives

    Science.gov (United States)

    Usuki, Tsuneo

    2013-09-01

    The moduli of conventional elastic structural materials are extended to one of the viscoelastic materials through a modification whereby the dynamic moduli converge to the static moduli of elasticity as the fractional order approaches zero. By plotting phase velocity curves and group velocity curves of plane waves and Rayleigh surface wave for a viscoelastic material (polyvinyl chloride foam), the influence of the fractional order of viscoelasticity is examined. The phase and group velocity curves in the high frequency range were derived for longitudinal, transverse, and Rayleigh waves inherent to the viscoelastic material. In addition, the equation for the phase velocity was mathematically derived on the complex plane, too, and graphically illustrated. A phenomenon was found that, at the moment when the fractional order of the time derivative reaches an integer value 1, the curve on the complex plane becomes completely different, exhibiting snap-through behavior. We examined the mechanism of the snap-through mathematically. Numerical calculation examples were solved, and good agreement was confirmed between the numerical calculation and the analytical expression mentioned above. From the results of the numerical example, regularities were derived for the absolute value of the complex phase and group velocities on the complex plane.

  5. Updating the geographical distribution and frequency of Aedes albopictus in Brazil with remarks regarding its range in the Americas

    Directory of Open Access Journals (Sweden)

    Roberta Gomes Carvalho/

    2014-09-01

    Full Text Available The geographical distribution of Aedes albopictus in Brazil was updated according to the data recorded across the country over the last eight years. Countrywide house indexes (HI for Ae. albopictus in urban and suburban areas were described for the first time using a sample of Brazilian municipalities. This mosquito is currently present in at least 59% of the Brazilian municipalities and in 24 of the 27 federal units (i.e., 26 states and the Federal District. In 34 Brazilian municipalities, the HI values for Ae. albopictus were higher than those recorded for Ae. aegypti, reaching figures as high as HI = 7.72 in the Southeast Region. Remarks regarding the current range of this mosquito species in the Americas are also presented. Nineteen American countries are currently infested and few mainland American countries have not confirmed the occurrence of Ae. albopictus. The large distribution and high frequency of Ae. albopictus in the Americas may become a critical factor in the spread of arboviruses like chikungunya in the new world.

  6. Updating the geographical distribution and frequency of Aedes albopictus in Brazil with remarks regarding its range in the Americas

    Science.gov (United States)

    Carvalho, Roberta Gomes; Lourenço-de-Oliveira, Ricardo; Braga, Ima Aparecida

    2014-01-01

    The geographical distribution of Aedes albopictus in Brazil was updated according to the data recorded across the country over the last eight years. Countrywide house indexes (HI) for Ae. albopictus in urban and suburban areas were described for the first time using a sample of Brazilian municipalities. This mosquito is currently present in at least 59% of the Brazilian municipalities and in 24 of the 27 federal units (i.e., 26 states and the Federal District). In 34 Brazilian municipalities, the HI values for Ae. albopictus were higher than those recorded for Ae. aegypti, reaching figures as high as HI = 7.72 in the Southeast Region. Remarks regarding the current range of this mosquito species in the Americas are also presented. Nineteen American countries are currently infested and few mainland American countries have not confirmed the occurrence of Ae. albopictus. The large distribution and high frequency of Ae. albopictus in the Americas may become a critical factor in the spread of arboviruses like chikungunya in the new world. PMID:25317707

  7. A study of some FMCW radar algorithms for target location at low frequencies

    Science.gov (United States)

    Sandström, Sven-Erik; Akeab, Imad K.

    2016-10-01

    FMCW (frequency-modulated continuous wave) radar is a simple and inexpensive technique for target location. The resolution is given by the available bandwidth and the directivity of the antenna. Resolution is not a problem at high frequencies, while at low frequencies (the HF and VHF band), and especially for mobile platforms, the required size of the antenna becomes impractical. In order to obtain the bearing of the targets, without relying on directivity, one may use a simple two-dimensional trilateration method that involves several platforms. Since this approach covers an area, rather than a sector, the range is reduced to some tens of kilometers. The VHF band and a bandwidth below 10 MHz is a good choice if the priority is to reduce radio interference. Fast targets, corresponding to a significant Doppler shift, have not been considered. The problem of ghost targets has been studied for both monostatic and multistatic radar. When there is a confluence of echoes, more bandwidth is required to maintain the accuracy of a few meters that is normally obtained in the simulation.

  8. Different Mode of Afferents Determines the Frequency Range of High Frequency Activities in the Human Brain: Direct Electrocorticographic Comparison between Peripheral Nerve and Direct Cortical Stimulation.

    Directory of Open Access Journals (Sweden)

    Katsuya Kobayashi

    Full Text Available Physiological high frequency activities (HFA are related to various brain functions. Factors, however, regulating its frequency have not been well elucidated in humans. To validate the hypothesis that different propagation modes (thalamo-cortical vs. cortico-coritcal projections, or different terminal layers (layer IV vs. layer II/III affect its frequency, we, in the primary somatosensory cortex (SI, compared HFAs induced by median nerve stimulation with those induced by electrical stimulation of the cortex connecting to SI. We employed 6 patients who underwent chronic subdural electrode implantation for presurgical evaluation. We evaluated the HFA power values in reference to the baseline overriding N20 (earliest cortical response and N80 (late response of somatosensory evoked potentials (HFA(SEP(N20 and HFA(SEP(N80 and compared those overriding N1 and N2 (first and second responses of cortico-cortical evoked potentials (HFA(CCEP(N1 and HFA(CCEP(N2. HFA(SEP(N20 showed the power peak in the frequency above 200 Hz, while HFA(CCEP(N1 had its power peak in the frequency below 200 Hz. Different propagation modes and/or different terminal layers seemed to determine HFA frequency. Since HFA(CCEP(N1 and HFA induced during various brain functions share a similar broadband profile of the power spectrum, cortico-coritcal horizontal propagation seems to represent common mode of neural transmission for processing these functions.

  9. Neurone bioelectric activity under magnetic fields of variable frequency in the range of 0.1-80 Hz

    Science.gov (United States)

    Pérez Bruzón, R. N.; Azanza, María. J.; Calvo, Ana C.; del Moral, A.

    2004-05-01

    Intracellular recordings from single unit molluscan neurones under exposure to ELF-MF (1 mT, 0.1-80 Hz), show that neurone frequency activity, f, decreases with the applied magnetic field frequency, fM, a phenomenon which indicates a frequency-window effect for the neurone membrane response. The HMHW of the window amounts between 2-10 Hz. An explanation of this phenomenon is proposed.

  10. Neurone bioelectric activity under magnetic fields of variable frequency in the range of 0.1-80 Hz

    Energy Technology Data Exchange (ETDEWEB)

    Perez Bruzon, R.N.; Azanza, M.J. E-mail: mjazanza@posta.unizar.es; Calvo, Ana C.; Moral, A. del

    2004-05-01

    Intracellular recordings from single unit molluscan neurones under exposure to ELF-MF (1 mT, 0.1-80 Hz), show that neurone frequency activity, f, decreases with the applied magnetic field frequency, f{sub M}, a phenomenon which indicates a frequency-window effect for the neurone membrane response. The HMHW of the window amounts between 2-10 Hz. An explanation of this phenomenon is proposed.

  11. Characterization of the mutual influence of Ion Cyclotron and Lower Hybrid Range of frequencies systems on EAST

    Directory of Open Access Journals (Sweden)

    Urbanczyk Guillaume

    2017-01-01

    Full Text Available Waves in the Ion Cyclotron (ICRF and Lower Hybrid (LH Range of Frequencies are efficient techniques respectively to heat the plasma and drive current. Main difficulties come from a trade-off between good RF coupling and acceptable level of impurities release. The mutual influence of both systems makes such equilibrium often hard to reach [1]. In order to investigate those interactions based on Scrape-Off Layer (SOL plasma parameters, a new reciprocating probe was designed allying a three tips Langmuir probe with an emissive wire. The emissive filament provides a precise measure of plasma potential [2], which can be used to calibrate Langmuir probe's results. This paper reports on experimental results obtained on EAST, where there are two ICRF antennas and two LH launchers. Among others diagnostics, the new reciprocating probe enabled to evidence the deleterious influence of ICRF power on LHWs coupling in L-mode plasmas. In areas connected with an active ICRF antenna, SOL potentials increase while densities tend to decrease, respectively enhancing impurities release and deteriorating LHWs coupling. This phenomenon has mostly been attributed to RF sheath; the one that forms on top of Plasma Facing Components (PFCs and causes ExB density convections [3]. From those experiments it seems ICRF has a strong influence on magnetically connected areas, both in the near field – influencing ICRF waves coupling – and in farther locations such as in front of LH grills. Moreover, influence of ICRF on LH system was observed both in L and H modes. Those results are consistent with RF sheath rectification process. Concerning the influence of LHWs on ICRF coupling, nothing was observed in L-mode. Besides during H-mode experiments, LHWs have been identified as having a mitigating effect on ELMs [4], which on average lowers the pedestal, increasing edge densities to the profit of ICRF waves coupling.

  12. Characterization of the mutual influence of Ion Cyclotron and Lower Hybrid Range of frequencies systems on EAST

    Science.gov (United States)

    Urbanczyk, Guillaume; Zhang, Xinjun; Qin, Chengming; Zhao, Yanping; Zhang, Tao; Zhang, Ling; Li, Jiangang; Yuan, Shuai; Chen, Liang; Zhang, Heng; Zhang, Jiahui; Wang, Jianhua; Yang, Xiuda; Qian, Jinping

    2017-10-01

    Waves in the Ion Cyclotron (ICRF) and Lower Hybrid (LH) Range of Frequencies are efficient techniques respectively to heat the plasma and drive current. Main difficulties come from a trade-off between good RF coupling and acceptable level of impurities release. The mutual influence of both systems makes such equilibrium often hard to reach [1]. In order to investigate those interactions based on Scrape-Off Layer (SOL) plasma parameters, a new reciprocating probe was designed allying a three tips Langmuir probe with an emissive wire. The emissive filament provides a precise measure of plasma potential [2], which can be used to calibrate Langmuir probe's results. This paper reports on experimental results obtained on EAST, where there are two ICRF antennas and two LH launchers. Among others diagnostics, the new reciprocating probe enabled to evidence the deleterious influence of ICRF power on LHWs coupling in L-mode plasmas. In areas connected with an active ICRF antenna, SOL potentials increase while densities tend to decrease, respectively enhancing impurities release and deteriorating LHWs coupling. This phenomenon has mostly been attributed to RF sheath; the one that forms on top of Plasma Facing Components (PFCs) and causes ExB density convections [3]. From those experiments it seems ICRF has a strong influence on magnetically connected areas, both in the near field - influencing ICRF waves coupling - and in farther locations such as in front of LH grills. Moreover, influence of ICRF on LH system was observed both in L and H modes. Those results are consistent with RF sheath rectification process. Concerning the influence of LHWs on ICRF coupling, nothing was observed in L-mode. Besides during H-mode experiments, LHWs have been identified as having a mitigating effect on ELMs [4], which on average lowers the pedestal, increasing edge densities to the profit of ICRF waves coupling.

  13. Morphological Parameters in Relation to the Electromagnetic Properties of Microcellular Thermoplastic Polyurethane Foam in X-Band Frequency Ranges

    Directory of Open Access Journals (Sweden)

    Mohammad Hassan Moeini

    2017-04-01

    Full Text Available Microcellular thermoplastic polyurethane foams are examined as absorbing materials in the X-band (8.2-12.4 GHz frequency range by means of experiment. In this work, we aim to establish relationships between foam morphology including cell size and air volume fraction and electromagnetic properties including absorption, transmission and reflection quality. Nanocomposites based on thermoplastic polyurethane containing carbon black were prepared by coagulation method. In this procedure 15 wt% carbon black-containing nanocomposite was converted to microcellular foams using batch foaming process and supercritical carbon dioxide as physical foaming agent. The morphology of the foams was evaluated by scanning electron microscopy. S-parameters of the samples were measured by a vector network analyzer (VNA and the effect of morphological parameters such as cell size and air volume fraction on the absorbing properties was investigated. We also established structure/properties relationships which were essential for further optimizations of the materials used in the construction of radar absorbing composites. Foaming reduced the percolation threshold of the nanocomposites due to the reduction in the average distance between nanoparticles. Foaming and dielectric constant reduction dropped the reflection percentage significantly. The increase in air volume fraction in the foam increased absorption per its weight, because of multiple scattering in composite media. The sensitivity of electromagnetic wave toward the variation of cell size is strongly weaker than that toward the variation of air volume fraction. Electromagnetic properties of the microcellular foams deviated a little from effective medium theories (EMTs. Air volume fraction of the cells was a function of cell size and smaller cells showed higher absorption.

  14. Very high frequency plasma reactant for atomic layer deposition

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Il-Kwon; Yoo, Gilsang; Yoon, Chang Mo [School of Electrical and Electronic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Kim, Tae Hyung; Yeom, Geun Young [Department of Advanced Materials Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Kim, Kangsik; Lee, Zonghoon [School Materials Science and Engineering, Ulsan National Institute of Science and Technology (UNIST), Ulsan 44919 (Korea, Republic of); Jung, Hanearl; Lee, Chang Wan [School of Electrical and Electronic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Kim, Hyungjun, E-mail: hyungjun@yonsei.ac.kr [School of Electrical and Electronic Engineering, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Han-Bo-Ram, E-mail: hbrlee@inu.ac.kr [Department of Materials Science and Engineering, Incheon National University, 406-840 Incheon (Korea, Republic of)

    2016-11-30

    Highlights: • Fundamental research plasma process for thin film deposition is presented. • VHF plasma source for PE-ALD Al{sub 2}O{sub 3} was employed to reduce plasma damage. • The use of VHF plasma improved all of the film qualities and growth characteristics. - Abstract: Although plasma-enhanced atomic layer deposition (PE-ALD) results in several benefits in the formation of high-k dielectrics, including a low processing temperature and improved film properties compared to conventional thermal ALD, energetic radicals and ions in the plasma cause damage to layer stacks, leading to the deterioration of electrical properties. In this study, the growth characteristics and film properties of PE-ALD Al{sub 2}O{sub 3} were investigated using a very-high-frequency (VHF) plasma reactant. Because VHF plasma features a lower electron temperature and higher plasma density than conventional radio frequency (RF) plasma, it has a larger number of less energetic reaction species, such as radicals and ions. VHF PE-ALD Al{sub 2}O{sub 3} shows superior physical and electrical properties over RF PE-ALD Al{sub 2}O{sub 3}, including high growth per cycle, excellent conformality, low roughness, high dielectric constant, low leakage current, and low interface trap density. In addition, interlayer-free Al{sub 2}O{sub 3} on Si was achieved in VHF PE-ALD via a significant reduction in plasma damage. VHF PE-ALD will be an essential process to realize nanoscale devices that require precise control of interfaces and electrical properties.

  15. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  16. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  17. Cryocooled wideband digital channelizing radio-frequency receiver based on low-pass ADC

    Energy Technology Data Exchange (ETDEWEB)

    Vernik, Igor V; Kirichenko, Dmitri E; Dotsenko, Vladimir V; Miller, Robert; Webber, Robert J; Shevchenko, Pavel; Talalaevskii, Andrei; Gupta, Deepnarayan; Mukhanov, Oleg A [HYPRES, Inc., 175 Clearbrook Road, Elmsford, NY 10523 (United States)

    2007-11-15

    We have demonstrated a digital receiver performing direct digitization of radio-frequency signals over a wide frequency range from kilohertz to gigahertz. The complete system, consisting of a cryopackaged superconductor all-digital receiver (ADR) chip followed by room-temperature interface electronics and a field programmable gate array (FPGA) based post-processing module, has been developed. The ADR chip comprises a low-pass analog-to-digital converter (ADC) delta modulator with phase modulation-demodulation architecture together with digital in-phase and quadrature mixer and a pair of digital decimation filters. The chip is fabricated using a 4.5 kA cm{sup -2} process and is cryopackaged using a commercial-off-the-shelf cryocooler. Experimental results in HF, VHF, UHF and L bands and their analysis, proving consistent operation of the cryopackaged ADR chip up to 24.32 GHz clock frequency, are presented and discussed.

  18. A Microbolometer System for Radiation Detection in the THz Frequency Range with a Resonating Cavity Fabricated in the CMOS Technology.

    Science.gov (United States)

    Sesek, Aleksander; Zemva, Andrej; Trontelj, Janez

    2018-02-14

    The THz sensors using microbolometers as a sensing element are reported as one of the most sensitive room-temperature THz detectors suitable for THz imaging and spectroscopic applications. Microbolometer detectors are usually fabricated using different types of the MEMS technology. The patent for the detection system presented in this paper describes a method for microbolometer fabrication using a standard CMOS technology with advanced micromachining techniques. The measured sensitivity of the sensors fabricated by the patented method is 1000 V/W at an optimal frequency and is determined by the performance of a double-dipole antenna and quarter-wavelength resonant cavity. The paper presents a patented method for fabrication of a microbolometer system for radiation detection in the THz frequency range (16). The method is divided into several stages regarding the current silicon micromachining process. Main stages are fabrication of supporting structures for micro bridge, creation of micro cavities and fabrication of Aluminum antenna and Titanium microbolometer. Additional method for encapsulation in the vacuum is described which additionally improves the performance of bolometer. The CMOS technology is utilized for fabrication as it is cost effective and provides the possibility of larger sensor systems integration with included amplification. At other wavelengths (e.g. IR region) thermistors are usually also the receivers with the sensor resistance change provoked by self-heating. In the THz region the energy is received by an antenna coupled to a thermistor. Depending on the specific application requirement, two types of the antenna were designed and used; a narrow-band dipole antenna and a wideband log-periodic antenna. With method described in the paper, the microbolometer detector reaches sensitivities up to 500 V/W and noise equivalent power (NEP) down to 10 pW/√Hz. Additional encapsulation in the vacuum improves its performance at least by a factor of 2

  19. Passive exposure of adult cats to moderate-level tone pip ensembles differentially decreases AI and AII responsiveness in the exposure frequency range.

    Science.gov (United States)

    Pienkowski, Martin; Eggermont, Jos J

    2010-09-01

    Passive exposure of adult animals to a random ensemble of tone pips band limited between 4 and 20 kHz has been shown to suppress neural activity in primary auditory cortex (AI) to sounds in the exposure frequency range. In the long-term (>3 months), the suppressed neurons can be reactivated by frequencies above and below the exposure range, i.e., tonotopic map reorganization occurs. The suppression can be at least partially reversed after a long period of quiet recovery, as the moderate-level exposure does not impair peripheral hearing. Here we exposed adult cats, for 7-13 weeks without interruption, to two different moderate-level tone pip ensembles, in separate experiments. One exposure stimulus consisted of an octave-wide 2-4 kHz band, which overlaps substantially with the cat vocalization range; the other consisted of a pair of third-octave bands centered at 4 and 16 kHz. We again report a decrease in AI responsiveness in the exposure frequency range, irrespective of the exposure stimulus bandwidth or center frequency, and a slow, partial recovery over a 12-week post-exposure window. In contrast to our previous studies, the suppression in both of the present experiments extended well beyond the exposure frequency range. In particular, following the 4 and 16 kHz experimental acoustic environment, AI activity was strongly suppressed not only in response to frequencies close to the two exposure bands, but also in response to frequencies between the bands, i.e., the results resembled those to a single broadband stimulus spanning the 3-18 kHz range. On the other hand, responses in secondary auditory cortex (AII) were suppressed predominantly around 4 and 16 kHz, with little or no suppression in between. Copyright (c) 2010 Elsevier B.V. All rights reserved.

  20. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  1. VHF/UHF/microwave LOS terrestrial propagation and system design

    Science.gov (United States)

    Fitzsimons, T. K.

    1986-10-01

    The telecommunication frequency range under discussion is from 30 MHz up to tens of GHz. For military communications this means the use of systems such as Combat Net Radio, Single-Channel Radio Access, Tactical and Fixed Radio Relay, Air-Ground-Air Systems, Common User Information Systems and Tactical Satellite. For civil communications the systems are not dissimilar - mobile radio, fixed radio relay systems, Air Traffic Control, etc. Of course there is a considerable amount of broadcasting and there are military and civil radar systems in these frequency bands. The spectrum range from 30 MHz to about 5 GHz is for the military in particular, prime spectrum; wide bandwidths (hence digital transmission) can be achieved, most propagation mechanisms are relatively stable and most of this part of the spectrum can be used by tactical systems either operating on the move or moving frequently to new sites. In addition to considerations of wanted performance and necessary characteristics such as ECM, the military systems are designed to meet requirements for rapid deployment in an environment which is difficult and unpredictable from the electromagnetic environment, topographic, and meteorological aspects.

  2. Efficient frequency downconversion at the single photon level from the red spectral range to the telecommunications C-band.

    Science.gov (United States)

    Zaske, Sebastian; Lenhard, Andreas; Becher, Christoph

    2011-06-20

    We report on single photon frequency downconversion from the red part of the spectrum (738 nm) to the telecommunications C-band. By mixing attenuated laser pulses with an average photon number per pulse telecommunications wavelengths.

  3. Characterization and performance of a field aligned ion cyclotron range of frequency antenna in Alcator C-Moda)

    Science.gov (United States)

    Wukitch, S. J.; Garrett, M. L.; Ochoukov, R.; Terry, J. L.; Hubbard, A.; Labombard, B.; Lau, C.; Lin, Y.; Lipschultz, B.; Miller, D.; Reinke, M. L.; Whyte, D.; Alcator C-Mod Team

    2013-05-01

    Ion cyclotron range of frequency (ICRF) heating is expected to provide auxiliary heating for ITER and future fusion reactors where high Z metallic plasma facing components (PFCs) are being considered. Impurity contamination linked to ICRF antenna operation remains a major challenge particularly for devices with high Z metallic PFCs. Here, we report on an experimental investigation to test whether a field aligned (FA) antenna can reduce impurity contamination and impurity sources. We compare the modification of the scrape of layer (SOL) plasma potential of the FA antenna to a conventional, toroidally aligned (TA) antenna, in order to explore the underlying physics governing impurity contamination linked to ICRF heating. The FA antenna is a 4-strap ICRF antenna where the current straps and antenna enclosure sides are perpendicular to the total magnetic field while the Faraday screen rods are parallel to the total magnetic field. In principle, alignment with respect to the total magnetic field minimizes integrated E|| (electric field along a magnetic field line) via symmetry. A finite element method RF antenna model coupled to a cold plasma model verifies that the integrated E|| should be reduced for all antenna phases. Monopole phasing in particular is expected to have the lowest integrated E||. Consistent with expectations, we observed that the impurity contamination and impurity source at the FA antenna are reduced compared to the TA antenna. In both L and H-mode discharges, the radiated power is 20%-30% lower for a FA-antenna heated discharge than a discharge heated with the TA-antennas. However, inconsistent with expectations, we observe RF induced plasma potentials (via gas-puff imaging and emissive probes to be nearly identical for FA and TA antennas when operated in dipole phasing). Moreover, the highest levels of RF-induced plasma potentials are observed using monopole phasing with the FA antenna. Thus, while impurity contamination and sources are indeed

  4. SEMICONDUCTOR INTEGRATED CIRCUITS: DCM, FSM, dead time and width controllers for a high frequency high efficiency buck DC-DC converter over a wide load range

    Science.gov (United States)

    Changming, Pi; Wei, Yan; Ke, Zhang; Wenhong, Li

    2010-08-01

    This paper presents a width controller, a dead time controller, a discontinuous current mode (DCM) controller and a frequency skipping modulation (FSM) controller for a high frequency high efficiency buck DC-DC converter. To improve the efficiency over a wide load range, especially at high switching frequency, the dead time controller and width controller are applied to enhance the high load efficiency, while the DCM controller and FSM controller are proposed to increase the light load efficiency. The proposed DC-DC converter controllers have been designed and fabricated in the Chartered 0.35 μm CMOS process, and the measured results show that the efficiency of the buck DC-DC converter is above 80% over a wide load current range from 8 to 570 mA, and the peak efficiency is 86% at 10 MHz switching frequency.

  5. DCM, FSM, dead time and width controllers for a high frequency high efficiency buck DC-DC converter over a wide load range

    Energy Technology Data Exchange (ETDEWEB)

    Pi Changming; Yan Wei; Zhang Ke; Li Wenhong, E-mail: wenhongli@fudan.edu.c [State Key Laboratory of ASIC and Systems, Fudan University, Shanghai 201203 (China)

    2010-08-15

    This paper presents a width controller, a dead time controller, a discontinuous current mode (DCM) controller and a frequency skipping modulation (FSM) controller for a high frequency high efficiency buck DC-DC converter. To improve the efficiency over a wide load range, especially at high switching frequency, the dead time controller and width controller are applied to enhance the high load efficiency, while the DCM controller and FSM controller are proposed to increase the light load efficiency. The proposed DC-DC converter controllers have been designed and fabricated in the Chartered 0.35 {mu}m CMOS process, and the measured results show that the efficiency of the buck DC-DC converter is above 80% over a wide load current range from 8 to 570 mA, and the peak efficiency is 86% at 10 MHz switching frequency. (semiconductor integrated circuits)

  6. Laser-Bioplasma Interaction: Excitation and Suppression of the Brain Waves by the Multi-photon Pulsed-operated Fiber Lasers in the Ultraviolet Range of Frequencies

    Science.gov (United States)

    Stefan, V. Alexander; IAPS-team Team

    2017-10-01

    The novel study of the laser excitation-suppression of the brain waves is proposed. It is based on the pulsed-operated multi-photon fiber-laser interaction with the brain parvalbumin (PV) neurons. The repetition frequency matches the low frequency brain waves (5-100 Hz); enabling the resonance-scanning of the wide range of the PV neurons (the generators of the brain wave activity). The tunable fiber laser frequencies are in the ultraviolet frequency range, thus enabling the monitoring of the PV neuron-DNA, within the 10s of milliseconds. In medicine, the method can be used as an ``instantaneous-on-off anesthetic.'' Supported by Nikola Tesla Labs, Stefan University.

  7. The influence of step frequency on the range of perceptually natural visual walking speeds during walking-in-place and treadmill locomotion

    DEFF Research Database (Denmark)

    Nilsson, Niels Christian; Serafin, Stefania; Nordahl, Rolf

    2014-01-01

    and virtual walking speeds. This paper details a study investigating the effects of movement type (treadmill walking and WIP) and step frequency (1.4, 1.8 and 2.2 steps per second) on the range of perceptually natural visual walking speeds. The results suggests statistically significant main effects of both...... movement type and step frequency but no significant interaction between the two variables....

  8. Range-separated time-dependent density-functional theory with a frequency-dependent second-order Bethe-Salpeter correlation kernel

    CERN Document Server

    Rebolini, Elisa

    2015-01-01

    We present a range-separated linear-response time-dependent density-functional theory (TDDFT) which combines a density-functional approximation for the short-range response kernel and a frequency-dependent second-order Bethe-Salpeter approximation for the long-range response kernel. This approach goes beyond the adiabatic approximation usually used in linear-response TDDFT and aims at improving the accuracy of calculations of electronic excitation energies of molecular systems. A detailed derivation of the frequency-dependent second-order Bethe-Salpeter correlation kernel is given using many-body Green-function theory. Preliminary tests of this range-separated TDDFT method are presented for the calculation of excitation energies of four small molecules: N2, CO2, H2CO, and C2H4. The results suggest that the addition of the long-range second-order Bethe-Salpeter correlation kernel overall slightly improves the excitation energies.

  9. Dielectric Properties of Marsh Vegetation in a Frequency Range of 0.1-18 GHz Under Variation of Temperature and Moisture

    Science.gov (United States)

    Romanov, A. N.; Kochetkova, T. D.; Suslyaev, V. I.; Shcheglova, A. S.

    2017-09-01

    Dielectric characteristics of some species of marsh vegetation: lichen Cladonia stellaris (Opiz) Pouzar, moss Sphagnum, and a representative of Bryidae mosses - Dicranum polysetum are studied in the frequency range from 100 MHz to 18 GHz. At a frequency of 1.41 GHz, the influence of temperature in the range from -12 to +20°C on the behavior of dielectric characteristics of mosses, lichens, and peat is studied. The dependences of the dielectric characteristics of vegetation on the volumetric wetness are established.

  10. Review of a Method for Local Damping Identification in the Low- and Mid-Frequency Range Based on a Finite Element Model

    OpenAIRE

    Tang, Martin

    2017-01-01

    Passenger demand for enhanced cabin comfort have made cabin noise to an important factor. The damping behaviour of the cabin must be understood in order to predict noise emission. Due to the high modal density and overlap, state-of-the-art methods are not able to accurately identify damping in the mid- and high-frequency range. However, these frequency ranges are relevant in the field of acoustics. 2016 a method was proposed for local damping identification, which was applied to an aircra...

  11. Simulation of electron transport in GaAs/AlAs superlattices with a small number of periods for the THz frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Pavelyev, D. G., E-mail: pavelev@rf.unn.ru, E-mail: obolensk@rf.unn.ru [Lobachevsky State University of Nizhny Novgorod (Russian Federation); Vasilev, A. P., E-mail: vasiljev@mail.ioffe.ru [Russian Academy of Sciences, Submicron Heterostructures for Microelectronics, Research and Engineering Center (Russian Federation); Kozlov, V. A., E-mail: kozlov@ipm.sci-nnov.ru; Koschurinov, Yu. I.; Obolenskaya, E. S.; Obolensky, S. V. [Lobachevsky State University of Nizhny Novgorod (Russian Federation); Ustinov, V. M., E-mail: vmust@beam.ioffe.ru [Russian Academy of Sciences, Ioffe Physical–Technical Institute (Russian Federation)

    2016-11-15

    The electron transport in superlattices based on GaAs/AlAs heterostructures with a small number of periods (6 periods) is calculated by the Monte Carlo method. These superlattices are used in terahertz diodes for the frequency stabilization of quantum cascade lasers in the range up to 4.7 THz. The band structure of superlattices with different numbers of AlAs monolayers is considered and their current–voltage characteristics are calculated. The calculated current–voltage characteristics are compared with the experimental data. The possibility of the efficient application of these superlattices in the THz frequency range is established both theoretically and experimentally.

  12. Self-oscillating Galvanic Isolated Bidirectional Very High Frequency DC-DC Converter

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Madsen, Mickey Pierre; Knott, Arnold

    2015-01-01

    This paper describes a galvanic isolated bidirectional Very High Frequency (VHF = 30 MHz - 300MHz) ClassE converter. The reason for increasing the switching frequency is to minimize the passive components in the converter. To make the converter topology bidirectional the rectifier has to be synch......This paper describes a galvanic isolated bidirectional Very High Frequency (VHF = 30 MHz - 300MHz) ClassE converter. The reason for increasing the switching frequency is to minimize the passive components in the converter. To make the converter topology bidirectional the rectifier has...

  13. Interaction of electromagnetic radiation in the 20-200 GHz frequency range with arrays of carbon nanotubes with ferromagnetic nanoparticles.

    Science.gov (United States)

    Atdayev, Agylych; Danilyuk, Alexander L; Prischepa, Serghej L

    2015-01-01

    The interaction of electromagnetic radiation with a magnetic nanocomposite based on carbon nanotubes (CNT) is considered within the model of distributed random nanoparticles with a core-shell morphology. The approach is based on a system composed of a CNT conducting resistive matrix, ferromagnetic inductive nanoparticles and the capacitive interface between the CNT matrix and the nanoparticles, which form resonance resistive-inductive-capacitive circuits. It is shown that the influence of the resonant circuits leads to the emergence of specific resonances, namely peaks and valleys in the frequency dependence of the permeability of the nanocomposite, and in the frequency dependence of the reflection and transmission of electromagnetic radiation.

  14. Interaction of electromagnetic radiation in the 20–200 GHz frequency range with arrays of carbon nanotubes with ferromagnetic nanoparticles

    Directory of Open Access Journals (Sweden)

    Agylych Atdayev

    2015-04-01

    Full Text Available The interaction of electromagnetic radiation with a magnetic nanocomposite based on carbon nanotubes (CNT is considered within the model of distributed random nanoparticles with a core–shell morphology. The approach is based on a system composed of a CNT conducting resistive matrix, ferromagnetic inductive nanoparticles and the capacitive interface between the CNT matrix and the nanoparticles, which form resonance resistive–inductive–capacitive circuits. It is shown that the influence of the resonant circuits leads to the emergence of specific resonances, namely peaks and valleys in the frequency dependence of the permeability of the nanocomposite, and in the frequency dependence of the reflection and transmission of electromagnetic radiation.

  15. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  16. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  17. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  18. Effect of continuous irradiation with terahertz electromagnetic waves of the NO frequency range on behavioral reactions of male albino rats under stress conditions.

    Science.gov (United States)

    Kirichuk, V F; Antipova, O N; Krylova, Ya A

    2014-06-01

    We studied the effect of terahertz waves (NO frequency range, 150.176-150.664 GHz) on stress-induced variations in behavioral reactions of male albino rats during hypokinetic stress. THz irradiation was followed by partial or complete normalization of behavioral reactions of male albino rats after hypokinetic stress. The most significant effect was observed after continuous irradiation for 30 min.

  19. Primary Calibration of Hydrophones in the Frequency Range of 250 Hz to 500 kHz Using Three-Transducer Spherical Wave Reciprocity

    Science.gov (United States)

    2016-08-01

    LIST OF MATHEMATICAL SYMBOLS AND UNITS ................................................. iii 1 INTRODUCTION ...HYDROPHONES IN THE FREQUENCY RANGE 250 HZ TO 500 KHZ USING THREE-TRANSDUCER SPHERICAL WAVE RECIPROCITY 1. INTRODUCTION This document describes the...for algae , there is little aquatic vegetation. Calibration measurements were performed on 22 June 2016. Environmental conditions during the

  20. A High-Voltage class-D power amplifier with switching frequency regulation for improved high-efficiency output power range

    NARCIS (Netherlands)

    Ma, H.; van der Zee, Ronan A.R.; Nauta, Bram

    2015-01-01

    This paper describes the power dissipation analysis and the design of an efficiency-improved high-voltage class-D power amplifier. The amplifier adaptively regulates its switching frequency for optimal power efficiency across the full output power range. This is based on detecting the switching

  1. Microstrip Antennas with Polarization Diversity across a Wide Frequency Range and Phased Array Antennas for Radar and Satellite Communications

    OpenAIRE

    Ho, Kevin Ming-Jiang

    2014-01-01

    The thesis comprises of 3 projects; an L-band microstrip antenna with frequency agility and polarization diversity, X-band phased array antennas incorporating commercially packaged RFIC phased array chips, and studies for Ku/Ka- band shared aperture antenna array. The first project features the use of commercially packaged RF-MEMS SPDT switches, that boasts of high reliability, high linearity, low losses, hermetically packaged and fully compatible for SMTA processes for mass-assembly and prod...

  2. On the determination of the dynamic properties of a transformer oil based ferrofluid in the frequency range 0.1–20 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Fannin, P.C. [Department of Electronic and Electrical Engineering, Trinity College, University of Dublin, Dublin 2 (Ireland); Vekas, L. [Center for Fundamental Technical Research, Romanian Academy-Timisoara Branch, Timisoara (Romania); Marin, C.N., E-mail: catalin.marin@e-uvt.ro [West University of Timisoara, Faculty of Physics, V. Parvan Blv., no. 4, 300223 Timisoara (Romania); Malaescu, I. [West University of Timisoara, Faculty of Physics, V. Parvan Blv., no. 4, 300223 Timisoara (Romania)

    2017-02-01

    Complex susceptibility measurements provide a unique and efficient means for the investigation and determination of the dynamic properties of magnetic fluids. In particular, measurement of the frequency, f(Hz), and field, H(kA/m), dependent, complex susceptibility, χ(ω, Η)= χ′(ω, Η)−iχ″(ω, Η), of magnetic fluids has proven to be a valuable and reliable technique for investigating such properties. The experimental data presented here was obtained from measurements of a transformer oil based ferrofluid, with measurements being performed over the frequency range 0.1–20 GHz and polarising fields 0–168 kA/m. In the case of transformer oil magnetic fluids, the normal measurement emphasis has been on the investigation of their dielectric properties, including the effects which lightning may have on these properties. Little has been reported on the measurement of the corresponding magnetic susceptibility, χ(ω), of such fluids and in this paper we address this fact. Thus we consider it worthwhile, in the case of a transformer with magnetic fluid transformer oil, being affected as a result of a lightening occurrence, to have knowledge of the fluids dynamic properties, at the microwave frequencies. In the process of determining the sample susceptibility profiles, it was found that the peak value of the χ″(ω) component, was approximately constant over the frequency range 2.4–6.3 GHz. From this it was determined that the fluid was effectively operating as a wideband absorber over a bandwidth of 3.9 GHz. - Highlights: • Complex magnetic susceptibility measurements in the frequency range 0.1–20 GHz. • Determination of the dynamic properties of a transformer oil based ferrofluid. • Wideband attenuator ( Absorber) in the frequency range 2.4–6.3 GHz.

  3. Influence of temporal noise on the skin blood flow measurements performed by cooled thermal imaging camera: limit possibilities within each physiological frequency range

    Science.gov (United States)

    Sagaidachnyi, A. A.; Volkov, I. U.; Fomin, A. V.

    2016-04-01

    This paper describes limit possibilities of modern cooled thermal imaging cameras as a tool for estimation of blood flow oscillations at the surface of living body. Skin temperature oscillations, as we assumed, are a consequence of the blood flow oscillations. We considered the temperature sensitivity 0.01-0.02 °C as a typical for the most of modern cooled long wave thermal imaging cameras. Fourier filter used to investigate the temperature signal separately within endothelial, neurogenic, myogenic, respiratory and cardiac frequency ranges. The level of temporal noise has been estimated during measurements of no living body with stabilized temperature ~ 24°C. The level of temperature oscillations has been calculated for the group of healthy subjects within each frequency range. Thus, we were able to determine signal-to-noise ratio within frequency band [0.001, 1] Hz. As a result, we determine that skin temperature oscillations measured by thermal imaging camera with sensitivity 0.02°C have the upper frequency limit ~ 0.2 Hz. In other words, within the respiratory and cardiac frequency ranges of blood flow oscillations the noise level exceeds signal one, and temperature measurements at the skin surface are practically useless. The endothelial, neurogenic and myogenic components of the temperature oscillations contain ~98% of the total spectral power of the signal. We have plot the empirical extrapolated curve of sensitivity of thermal imaging camera vs. frequency of the temperature oscillations. The data analysis shows that measurements of skin temperature oscillations within respiratory and cardiac ranges require the temperature sensitivity at least ~ 0.01°C and 0.001°C, respectively.

  4. On the Frequency and Voltage-Dependent Profiles of the Surface States and Series Resistance of Au/ZnO/n-Si Structures in a Wide Range of Frequency and Voltage

    Science.gov (United States)

    Nikravan, Afsoun; Badali, Yosef; Altındal, Şemsettin; Uslu, İbrahim; Orak, İkram

    2017-10-01

    In order to interpret the electrical characteristics of fabricated Au/ZnO/n-Si structures as a function of frequency and voltage well, their capacitance-voltage ( C- V) and conductance-voltage ( G/ ω- V) measurements were carried out in a wide range of frequencies (0.7 kHz-2 MHz) and voltages (± 6 V) by 50 mV steps at room temperature. Both the C- V and G/ ω- V plots have reverse, depletion, and accumulation regions such as a metal-insulator/oxide semiconductor (MIS or MOS) structures. The values of doped-donor atoms ( N D), Fermi energy level ( E F), barrier height (ΦB), and series resistance ( R s) of the structure were obtained as a function of frequency and voltage. While the value of N D decreases with increasing frequency almost as exponentially, the value of depletion width ( W D) increases. The values of C and G/ ω increase with decreasing frequency because the surface states ( N ss) are able to follow the alternating current (AC) signal, resulting in excess capacitance ( C ex) and conductance ( G ex/ ω), which depends on their relaxation time and the frequency of the AC signal. The voltage-dependent profiles of N ss were obtained from both the high-low frequency capacitance and Hill-Colleman methods. The other important parameter R s of the structure was also obtained from the Nicollian and Brews methods as a function of voltage.

  5. Voice training and changing weight--are they reflected in speaking fundamental frequency, voice range, and pitch breaks of 13-year-old girls? A longitudinal study.

    Science.gov (United States)

    Willis, Elizabeth C; Kenny, Dianna T

    2011-09-01

    Assessment of the voice-change progress of 20 girls (12-13 years) over 1 year by observing changes in speaking fundamental frequency (SFo), voice range, and register pitch breaks in the context of weight, height, voice training, and self-perception. One-year longitudinal collective case study. Twenty girls were recorded at the beginning and end of a year; nine girls were recorded another three times. SFo, vocal range, and characteristics were analyzed and interactions between these data assessed against weight and height to indicate pubertal development, and to test the hypothesis that changes in weight, height, SFo, and pitch breaks were related. Effects of training and the girls' self-perception of their voice use were also assessed. Vocal characteristics changed as the girls passed through different weight ranges. During 47.5-52.4 kg (called band 2) and 52.4-57.5 kg (band 3), there was progressive contraction of vocal range and in some girls a slight rise in SFo between recording times 1 and 5. Both high- and low-pitch breaks were present in 45% of girls' voices. Girls in band 4 (pitch breaks in vocal-range areas that indicated the development of adult vocal registers. In this study, voice-trained girls were heavier, had higher SFo, used wider speech-range inflection, had a higher vocal range, and greater voice-use confidence; all girls lost confidence in their voice use over the year. In this longitudinal study of twenty 13-year-old girls, voice changes in SFo, vocal range, and pitch-break frequency were synchronous with certain weight ranges. Girls with training registered higher maximum phonational frequency and were more confident in their voice use than girls without training. Copyright © 2011 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  6. Note: Ultra-high frequency ultra-low dc power consumption HEMT amplifier for quantum measurements in millikelvin temperature range.

    Science.gov (United States)

    Korolev, A M; Shnyrkov, V I; Shulga, V M

    2011-01-01

    We have presented theory and experimentally demonstrated an efficient method for drastically reducing the power consumption of the rf/microwave amplifiers based on HEMT in unsaturated dc regime. Conceptual one-stage 10 dB-gain amplifier showed submicrowatt level of the power consumption (0.95 μW at frequency of 0.5 GHz) when cooled down to 300 mK. Proposed technique has a great potential to design the readout amplifiers for ultra-deep-cooled cryoelectronic quantum devices.

  7. A study of the electromagnetic shielding mechanisms in the GHz frequency range of graphene based composite layers

    Science.gov (United States)

    Drakakis, E.; Kymakis, E.; Tzagkarakis, G.; Louloudakis, D.; Katharakis, M.; Kenanakis, G.; Suchea, M.; Tudose, V.; Koudoumas, E.

    2017-03-01

    We report on the mechanisms of the electromagnetic interference shielding effect of graphene based paint like composite layers. In particular, we studied the absorption and reflection of electromagnetic radiation in the 4-20 GHz frequency of various dispersions employing different amounts of graphene nanoplatelets, polyaniline, and poly(3,4-ethylenedioxythiophene)-poly(styrenesulfonate), special attention given on the relative contribution of each process in the shielding effect. Moreover, the influence of the composition, the thickness and the conductivity of the composite layers on the electromagnetic shielding was also examined.

  8. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  9. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  10. Local complex permittivity measurements of porcine skin tissue in the frequency range from 1 GHz to 15 GHz by evanescent microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Kleismit, Richard A; Kozlowski, Gregory; Foy, Brent D [Department of Physics, Wright State University, 3640 Col. Glenn Hwy, Dayton, OH 45435-0001 (United States); Hull, Barbara E [Department of Biological Sciences, Wright State University, 3640 Col. Glenn Hwy, Dayton, OH 45435-0001 (United States); Kazimierczuk, Marian [Department of Electrical Engineering, Wright State University, 3640 Col. Glenn Hwy, Dayton, OH 45435-0001 (United States)], E-mail: richard.kleismit@wright.edu

    2009-02-07

    The near-field evanescent microwave microscope is based on a coaxial transmission line resonator with a silver plated tungsten tip protruding through an end-wall aperture. The sensor is used to measure the local dielectric properties of porcine skin in the frequency range from 1 GHz to 15 GHz. The dielectric property of the skin within the near field of the tip frustrates the electric field and measurably changes the transmission line's resonant frequency and quality factor (Q). The shift of the resonator's frequency and Q is measured as a function of tip-sample separation, and a quantitative relationship between the real and imaginary parts of the local dielectric constant using the method of images is established. The associated changes in quality factor image scans of subsurface tissue structure and dielectric properties of skin surface lesions are presented.

  11. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  12. DNA Repair Domain Modeling Can Predict Cell Death and Mutation Frequency for Wide Range Spectrum of Radiation

    Science.gov (United States)

    Viger, Louise; Ponomarev, Artem L.; Plante, Ianik; Evain, Trevor; Penninckx, Sebastien; Blattnig, Steve R.; Costes, Sylvain V.

    2017-01-01

    Exploration missions to Mars and other destinations raise many questions about the health of astronauts. The continuous exposure of astronauts to galactic cosmic rays is one of the main concerns for long-term missions. Cosmic ionizing radiations are composed of different ions of various charges and energies notably, highly charged energy (HZE) particles. The HZE particles have been shown to be more carcinogenic than low-LET radiation, suggesting the severity of chromosomal aberrations induced by HZE particles is one possible explanation. However, most mathematical models predicting cell death and mutation frequency are based on directly fitting various HZE dose response and are in essence empirical approaches. In this work, we assume a simple biological mechanism to model DNA repair and use it to simultaneously explain the low- and high-LET response using the exact same fitting parameters. Our work shows that the geometrical position of DNA repair along tracks of heavy ions are sufficient to explain why high-LET particles can induce more death and mutations. Our model is based on assuming DNA double strand breaks (DSBs) are repaired within repair domain, and that any DSBs located within the same repair domain cluster into one repair unit, facilitating chromosomal rearrangements and increasing the probability of cell death. We introduced this model in 2014 using simplified microdosimetry profiles to predict cell death. In this work, we collaborated with NASA Johnson Space Center to generate more accurate microdosimetry profiles derived by Monte Carlo techniques, taking into account track structure of HZE particles and simulating DSBs in realistic cell geometry. We simulated 224 data points (D, A, Z, E) with the BDSTRACKS model, leading to a large coverage of LET from 10 to 2,400 keV/µm. This model was used to generate theoretical RBE for various particles and energies for both cell death and mutation frequencies. The RBE LET dependence is in agreement with

  13. Effect of model-form definition on uncertainty quantification in coupled models of mid-frequency range simulations

    Science.gov (United States)

    Van Buren, Kendra L.; Ouisse, Morvan; Cogan, Scott; Sadoulet-Reboul, Emeline; Maxit, Laurent

    2017-09-01

    In the development of numerical models, uncertainty quantification (UQ) can inform appropriate allocation of computational resources, often resulting in efficient analysis for activities such as model calibration and robust design. UQ can be especially beneficial for numerical models with significant computational expense, such as coupled models, which require several subsystem models to attain the performance of a more complex, inter-connected system. In the coupled model paradigm, UQ can be applied at either the subsystem model level or the coupled model level. When applied at the subsystem level, UQ is applied directly to the physical input parameters, which can be computationally expensive. In contrast, UQ at the coupled level may not be representative of the physical input parameters, but comes at the benefit of being computationally efficient to implement. To be physically meaningful, analysis at the coupled level requires information about how uncertainty is propagated through from the subsystem level. Herein, the proposed strategy is based on simulations performed at the subsystem level to inform a covariance matrix for UQ performed at the coupled level. The approach is applied to a four-subsystem model of mid-frequency vibrations simulated using the Statistical Modal Energy Distribution Analysis, a variant of the Statistical Energy Analysis. The proposed approach is computationally efficient to implement, while simultaneously capturing information from the subsystem level to ensure the analysis is physically meaningful.

  14. Determining the Quality Factor of Dielectric Ceramic Mixtures with Dielectric Constants in the Microwave Frequency Range.

    Science.gov (United States)

    Chen, Hetuo; Fu, Xuewen; An, Qi; Tang, Bin; Zhang, Shuren; Yang, Hao; Long, Yin; Harfouche, Mark; Wang, Huolei; Li, Yingxiang

    2017-10-26

    Microwave dielectric ceramic materials are extensively utilized in microwave applications because of their high dielectric constants and quality factors. These applications also require ceramics of zero temperature coefficients at the resonant frequency (τ f ), which can be realized through mixing a ceramic that one is interested in with another ceramic with -τ f , or by performing the ionic substitution. With the mixing/ionic substitution, it is indispensable to compute the quality factors precisely. Previous study indicates that the quality factor depends on the grain size, porosity, internal strain, structure, phase evolution, and conductivity etc. Here we derive a quality factor formula based on the definition, which works very well for multiphase composites, single phase solid solutions, and equivalent ionic substituted single phase materials. Our formula calculation and fits to the previous experimental results demonstrate that the quality factor of the ceramic mixtures strongly depend on the dielectric constants and the dielectric constant variation index. Our results suggest that the impacts from grain size, porosity, and internal strain etc. can be summarized to the dielectric constant or dielectric constant variation index, which is of great importance for future design of high performance microwave dielectric ceramics.

  15. Linear-array-based photoacoustic imaging of human microcirculation with a range of high frequency transducer probes.

    Science.gov (United States)

    Zafar, Haroon; Breathnach, Aedán; Subhash, Hrebesh M; Leahy, Martin J

    2015-05-01

    Photoacoustic imaging (PAI) with a linear-array-based probe can provide a convenient means of imaging the human microcirculation within its native structural context and adds functional information. PAI using a multielement linear transducer array combined with multichannel collecting system was used for in vivo volumetric imaging of the blood microcirculation, the total concentration of hemoglobin (HbT), and the hemoglobin oxygen saturation (sO₂) within human tissue. Three-dimensional (3-D) PA and ultrasound (US) volumetric scans were acquired from the forearm skin by linearly translating the transducer with a stepper motor over a region of interest, while capturing two-dimensional images using 15, 21, and 40 MHz frequency transducer probes. For the microvasculature imaging, PA images were acquired at 800- and 1064-nm wavelengths. For the HbT and sO₂ estimates, PA images were collected at 750- and 850-nm wavelengths. 3-D microcirculation, HbT, and sO₂ maps of the forearm skin were obtained from normal subjects. The linear-array-based PAI has been found promising in terms of resolution, imaging depth, and imaging speed for in vivo microcirculation imaging within human skin. We believe that a reflection type probe, similar to existing clinical US probes, is most likely to succeed in real clinical applications. Its advantages include ease of use, speed, and familiarity for radiographers and clinicians.

  16. Characterization of Different Cable Ferrite Materials to Reduce the Electromagnetic Noise in the 2-150 kHz Frequency Range.

    Science.gov (United States)

    Suarez, Adrian; Victoria, Jorge; Alcarria, Antonio; Torres, Jose; Martinez, Pedro A; Martos, Julio; Soret, Jesus; Garcia-Olcina, Raimundo; Muetsch, Steffen

    2018-01-23

    The gap of standardization for conducted and field coupled electromagnetic interferences (EMI) in the 2-150 kHz frequency range can lead to Electromagnetic Compatibility (EMC) problems. This is caused by power systems such as Pulse Width Modulation (PWM) controlled rectifiers, photovoltaic inverters or charging battery units in electric vehicles. This is a very important frequency spectral due to interferences generated in a wide range of devices and, specifically, communication problems in the new technologies and devices incorporated to the traditional grid to convert it into a Smart Grid. Consequently, it is necessary to provide new solutions to attenuate this kind of interference, which involves finding new materials that are able to filter the electromagnetic noise. This contribution is focused on characterizing the performance of a novel material based on nanocrystalline and comparing it to most common material compositions such as MnZn and NiZn. This research is carried out from the point of view of the manufacturing process, magnetic properties and EMI suppression ability. This last item is carried out through two analysis procedures: a theoretical method by determining the attenuation ratio by measuring impedance parameter and proposing a new empirical technique based on measuring directly the insertion loss parameter. Therefore, the main aim of this characterization process is to determine the performance of nanocrystalline compared to traditional cable ferrite compositions to reduce the interferences in this controversial frequency range. From the results obtained, it is possible to deduce that nanocrystalline cable ferrite provides the best performance to filter the electromagnetic noise in the 2-150 kHz frequency range.

  17. Study of blood plasma optical properties in mice grafted with Ehrlich carcinoma in the frequency range 0.1–1.0 THz

    Science.gov (United States)

    Smolyanskaya, O. A.; Kravtsenyuk, O. V.; Panchenko, A. V.; Odlyanitskiy, E. L.; Guillet, J. P.; Cherkasova, O. P.; Khodzitsky, M. K.

    2017-12-01

    In the course of in vitro studies of blood of laboratory animals with progressing Ehrlich carcinoma, we have revealed the change of the blood plasma optical properties in the THz range, which can be used for developing the express diagnostics of the presence of oncological diseases. An applied software package is elaborated that allows the phantoms of biological samples having a complex structure to be numerically simulated and the parameters of the electromagnetic wave reflected from these samples in the THz frequency range to be calculated. Presented at the Fundamentals of Laser Micro- and Nanotechnologies (FLAMN-16) International Symposium (Pushkin, Leningrad oblast, 27 June to 1 July 2016).

  18. On the dispersion management of fluorite whispering-gallery mode resonators for Kerr optical frequency comb generation in the telecom and mid-infrared range.

    Science.gov (United States)

    Lin, Guoping; Chembo, Yanne K

    2015-01-26

    Optical whispering gallery mode (WGM) resonators have been very attracting platforms for versatile Kerr frequency comb generations. We report a systematic study on the material dispersion of various optical materials that are capable of supporting quality factors above 109. Using an analytical approximation of WGM resonant frequencies in disk resonators, we investigate the effect of the geometry and transverse mode order on the total group-velocity dispersion (GVD). We demonstrate that the major radii and the radial mode indices play an important role in tailoring the GVD of WGM resonators. In particular, our study shows that in WGM disk-resonators, the polar families of modes have very similar GVD, while the radial families of modes feature dispersion values that can differ by up to several orders of magnitude. The effect of these giant dispersion shifts are experimentally evidenced in Kerr comb generation with magnesium fluoride. From a more general perspective, this critical feature enables to push the zero-dispersion wavelength of fluorite crystals towards the mid-infrared (mid-IR) range, thereby allowing for efficient Kerr comb generation in that spectral range. We show that barium fluoride is the most interesting crystal in this regard, due to its zero dispersion wavelength (ZDW) at 1.93 μm and an optimal dispersion profile in the mid-IR regime. We expect our results to facilitate the design of different platforms for Kerr frequency comb generations in both telecommunication and mid-IR spectral ranges.

  19. Discharge physics and influence of the modulation on helium DBD modes in the medium-frequency range at atmospheric pressure

    Science.gov (United States)

    Boisvert, Jean-Sébastien; Margot, Joëlle; Massines, Françoise

    2017-04-01

    In this paper the recently reported hybrid mode (a dielectric barrier discharge (DBD) excited by an electric field oscillating at about 1 MHz) is investigated using space and time-resolved imaging together with electrical measurements. In contrast with the helium low-frequency DBD, at 1.6 MHz the light emission is desynchronized with the discharge current. It rather depends on the enhanced rate of stepwise excitation resulting from the massive secondary emission occurring 0.15Ƭ after the discharge current maximum (Ƭ is the excitation wave period). The consequence of ion impacts on the dielectric surfaces is a higher gas and dielectric temperatures as compared to typical helium DBDs. The electrical behavior and the gas temperature of a pulsed dielectric-barrier discharge operated at 1.6 MHz are also described in this paper as a function of the repetition rate (varying from 1 Hz to 10 kHz). The gas temperature is reduced when repetition rates higher or equal to 10 Hz is used. This is related to the gas renewal rate of 8.3 Hz, i.e., gas residence time of 120 ms in our conditions. In addition, due to the memory effect in the gas, the gas gap voltage decreases as the repetition rate increases. However, beyond 100 Hz, the power decreases and the gas gap voltage increases again. As a consequence, for a given power density, the optimal repetition rate is 100 Hz which minimizes the gas temperature without reducing the power density. Contribution to the topical issue "The 15th International Symposium on High Pressure Low Temperature Plasma Chemistry (HAKONE XV)", edited by Nicolas Gherardi and Tomáš Hoder

  20. Surface impedance of BaFe2-xNixAs2 in the radio frequency range

    Directory of Open Access Journals (Sweden)

    A. Abbassi

    2012-08-01

    Full Text Available We report measurements of the temperature dependence of the surface impedance in superconducting BaFe1.93Ni0.07As2 crystals using the radiofrequency reflection technique in the 5range. An LC resonant circuit with a phase sensitive detection was used at 92MHz. A measurement assembly with point contacts was used at 30MHz. The recent discovery of iron based arsenide superconductors BaFe2-xNixAs2 has attracted much interest. For a Ni doping level of 7% the superconducting phase transition is found around 20K. The temperature dependence of the superconducting penetration depth was determined.

  1. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  2. Analisis interferensi T-DAB dan TV Analog pada pita Very High Frequency (VHF

    Directory of Open Access Journals (Sweden)

    Kasmad Ariansyah

    2014-09-01

    Full Text Available Kehadiran teknologi digital telah membawa perubahan di dalam berbagai aspek kehidupan, tak terkecuali di dunia penyiaran. Digitalisasi dibidang penyiaran diyakini dapat memberikan manfaat dalam hal efisiensi spektrum frekuensi radio. Berkaitan dengan penyiaran radio, Menteri  Komunikasi  dan  Informatika telah menetapkan DAB family sebagai standard penyiaran radio digital di Indonesia. Kajian dilakukan untuk mendapatkan jarak minimum yang diperlukan  antara sistem T-DAB dan TV analog sebagai solusi terhadap kemungkinan interferensi. Analisis dilakukan dengan bantuan SEAMCAT. Berdasarkan hasil analisis disimpulkan bahwa  kanal  A  T-DAB  merupakan  kanal yang paling rentan terhadap interferensi; Untuk mencapai probabilitas interferensi maksimum 5%, separasi geograpis minimum antara cakupan terluar TV analog kanal n dan transmitter terluar pada jaringan SFN T-DAB untuk kanal (n- 1D, nA, nB, nC berturut-turut adalah 220 Km, 290 Km, 145 Km dan  40  Km.  Sedangkan  untuk  kanal  nD  dan  (n+1A  dapat dioperasikan tanpa separasi geograpis dengan TV analog.

  3. Lightning detection and ranging

    Science.gov (United States)

    Lennon, C. L.; Poehler, H. A.

    1982-01-01

    A lightning detector and ranging (LDAR) system developed at the Kennedy Space Center and recently transferred to Wallops Island is described. The system detects pulsed VHF signals due to electrical discharges occurring in a thunderstorm by means of 56-75 MHz receivers located at the hub and at the tips of 8 km radial lines. Incoming signals are transmitted by wideband links to a central computing facility which processes the times of arrival, using two independent calculations to determine position in order to guard against false data. The results are plotted on a CRT display, and an example of a thunderstorm lightning strike detection near Kennedy Space Center is outlined. The LDAR correctly identified potential ground strike zones and additionally provided a high correlation between updrafts and ground strikes.

  4. Time constants for temperature elevation in human models exposed to dipole antennas and beams in the frequency range from 1 to 30 GHz

    Science.gov (United States)

    Morimoto, Ryota; Hirata, Akimasa; Laakso, Ilkka; Ziskin, Marvin C.; Foster, Kenneth R.

    2017-03-01

    This study computes the time constants of the temperature elevations in human head and body models exposed to simulated radiation from dipole antennas, electromagnetic beams, and plane waves. The frequency range considered is from 1 to 30 GHz. The specific absorption rate distributions in the human models are first computed using the finite-difference time-domain method for the electromagnetics. The temperature elevation is then calculated by solving the bioheat transfer equation. The computational results show that the thermal time constants (defined as the time required to reach 63% of the steady state temperature elevation) decrease with the elevation in radiation frequency. For frequencies higher than 4 GHz, the computed thermal time constants are smaller than the averaging time prescribed in the ICNIRP guidelines, but larger than the averaging time in the IEEE standard. Significant differences between the different head models are observed at frequencies higher than 10 GHz, which is attributable to the heat diffusion from the power absorbed in the pinna. The time constants for beam exposures become large with the increase in beam diameter. The thermal time constant in the brain is larger than that in the superficial tissues at high frequencies, because the brain temperature elevation is caused by the heat conduction of energy absorbed in the superficial tissue. The thermal time constant is minimized with an ideal beam with a minimum investigated diameter of 10 mm this minimal time constant is approximately 30 s and is almost independent of the radiation frequency, which is supported by analytic methods. In addition, the relation between the time constant, as defined in this paper, and ‘averaging time’ as it appears in the exposure limits is discussed, especially for short intense pulses. Similar to the laser guidelines, provisions should be included in the limits to limit the fluence for such pulses.

  5. Modulation of electromagnetic and absorption properties in 18-26.5 GHz frequency range of strontium hexaferrites with doping of cobalt-zirconium

    Energy Technology Data Exchange (ETDEWEB)

    Pubby, Kunal; Narang, Sukhleen Bindra [Guru Nanak Dev University, Department of Electronics Technology, Amritsar (India); Kaur, Prabhjyot; Chawla, S.K. [Guru Nanak Dev University, Department of Chemistry, Centre for Advanced Studies-I, Amritsar (India)

    2017-05-15

    Hexaferrite nano-particles of stoichiometric composition Sr(CoZr){sub x}Fe{sub 12-2x}O{sub 19}, with x = 0.0, 0.2, 0.4, 0.6, 0.8, 1.0 were prepared using sol-gel auto-combustion route owing to its advantages such as low sintering temperature requirement, homogeneity and uniformity of grains. Tartaric acid as a fuel was utilized to complete the chemical reaction. The goal of this study is to analyse the effect of co-substitution of cobalt and zirconium on the electromagnetic and absorption properties of pure SrFe{sub 12}O{sub 19} hexaferrite. The properties were measured on the rectangular pellets of thickness 2.5 mm for K-frequency band using Vector Network Analyzer. The doping of Co-Zr has resulted in increase in real as well as imaginary parts of permittivity. The values of real permittivity lie in the range 3.6-7.0 for all the composition. The real part of permeability remains in range 0.7-1.6 in the studied frequency band for all the samples and shows slightly increasing trend with frequency. The maximum values of dielectric loss tangent peak (3.04) and magnetic loss tangent peak (2.34), among all the prepared compositions, have been observed for composition x = 0.2. Compositions with x = 0.6 and x = 0.0 also have high dielectric and magnetic loss peaks. Dielectric loss peaks are attributed to dielectric resonance and magnetic loss peaks are attributed to natural resonance. Experimentally determined reflection loss results show that all six compositions of prepared series have high values of absorption to propose them as single-layer absorbers in 18-26.5 GHz frequency range. The composition with x = 0.2 has maximum absorption capacity with reflection loss peak of -37.2 dB at 24.3 GHz frequency. The undoped composition also has high absorption peak (-25.46 dB), but -10 dB absorption bandwidth is minimum (2.2 GHz) out of the present series. Maximum absorption bandwidth is obtained for x = 1.0 (4.1 GHz). Other doped compositions also have high absorption bandwidth

  6. Modulation of electromagnetic and absorption properties in 18-26.5 GHz frequency range of strontium hexaferrites with doping of cobalt-zirconium

    Science.gov (United States)

    Pubby, Kunal; Narang, Sukhleen Bindra; Kaur, Prabhjyot; Chawla, S. K.

    2017-05-01

    Hexaferrite nano-particles of stoichiometric composition {{Sr}}{({{CoZr}})_x}{{F}}{{{e}}_{12 - 2x}}{{{O}}_{19}}, with x = 0.0, 0.2, 0.4, 0.6, 0.8, 1.0 were prepared using sol-gel auto-combustion route owing to its advantages such as low sintering temperature requirement, homogeneity and uniformity of grains. Tartaric acid as a fuel was utilized to complete the chemical reaction. The goal of this study is to analyse the effect of co-substitution of cobalt and zirconium on the electromagnetic and absorption properties of pure {{SrF}}{{{e}}_{12}}{{{O}}_{19}} hexaferrite. The properties were measured on the rectangular pellets of thickness 2.5 mm for K-frequency band using Vector Network Analyzer. The doping of Co-Zr has resulted in increase in real as well as imaginary parts of permittivity. The values of real permittivity lie in the range 3.6-7.0 for all the composition. The real part of permeability remains in range 0.7-1.6 in the studied frequency band for all the samples and shows slightly increasing trend with frequency. The maximum values of dielectric loss tangent peak (3.04) and magnetic loss tangent peak (2.34), among all the prepared compositions, have been observed for composition x = 0.2. Compositions with x = 0.6 and x = 0.0 also have high dielectric and magnetic loss peaks. Dielectric loss peaks are attributed to dielectric resonance and magnetic loss peaks are attributed to natural resonance. Experimentally determined reflection loss results show that all six compositions of prepared series have high values of absorption to propose them as single-layer absorbers in 18-26.5 GHz frequency range. The composition with x = 0.2 has maximum absorption capacity with reflection loss peak of -37.2 dB at 24.3 GHz frequency. The undoped composition also has high absorption peak (-25.46 dB), but -10 dB absorption bandwidth is minimum (2.2 GHz) out of the present series. Maximum absorption bandwidth is obtained for x = 1.0 (4.1 GHz). Other doped compositions also

  7. Micromachining and validation of the scanning acoustic microscope spatial resolution and sensitivity calibration block for 20-230 MHz frequency range.

    Science.gov (United States)

    Tamulevičius, Tomas; Šimatonis, Linas; Ulčinas, Orestas; Tamulevičius, Sigitas; Žukauskas, Egidijus; Rekuvienė, Regina; Mažeika, Liudas

    2016-10-01

    Scanning acoustic microscopy (SAM) is used as a routine non-destructive test tool for different diagnostic examinations: detection of defects such as microcracks, delamination, disbonding, inclusions, subsurface features in materials such as pores and cracks. SAM can be operated in a wide frequency range from Megahertz to Gigahertz. SAM measurement spatial resolution is diffraction limited by the wavelength of the acoustic wave in particular medium and also depends on individual transducers geometry. Actual SAM spatial resolution can be determined by measuring calibrated lithographically formed microstructures in high acoustic impedance materials. Numerical acoustic signal simulation method, based on the diffraction approach, was employed for the selection of the calibration block pattern geometry and linear dimensions of the elements. Universal calibration block for SAM operating in a 20-230 MHz frequency range was micromachined in high acoustic impedance ceramic substrates. Differently spaced (from 18 to 185 µm) lines of the same width and different widths (from 17 to 113 µm) but similar spacing lines were imposed in alumina ceramics employing one step lithography process, i.e. femtosecond laser ablation. Proposed SAM calibration pattern linear dimensions were characterized employing optical and scanning electron microscopy. Finally the samples were measured with SAM employing different frequency transducers and results were compared with the numerical simulations. It was obtained that resolution of SAM operating with 230 MHz transducer is not worse than 40 µm. © The Author (2016). Published by Oxford University Press on behalf of Journal of Molecular Cell Biology, IBCB, SIBS, CAS. All rights reserved.

  8. Image-Guided Ultrasound Characterization of Volatile Sub-Micron Phase-Shift Droplets in the 20-40 MHz Frequency Range.

    Science.gov (United States)

    Sheeran, Paul S; Daghighi, Yasaman; Yoo, Kimoon; Williams, Ross; Cherin, Emmanuel; Foster, F Stuart; Burns, Peter N

    2016-03-01

    Phase-shift perfluorocarbon droplets are designed to convert from the liquid to the gas state by the external application of acoustic or optical energy. Although droplet vaporization has been investigated extensively at ultrasonic frequencies between 1 and 10 MHz, few studies have characterized performance at the higher frequencies commonly used in small animal imaging. In this study, we use standard B-mode imaging sequences on a pre-clinical ultrasound platform to both image and activate sub-micron decafluorobutane droplet populations in vitro and in vivo at center frequencies in the range of 20-40 MHz. Results show that droplets remain stable against vaporization at low imaging pressures but are vaporized at peak negative pressures near 3.5 MPa at the three frequencies tested. This study also found that a small number of size outliers present in the distribution can greatly influence droplet performance. Removal of these outliers results in a more accurate assessment of the vaporization threshold and produces free-flowing microbubbles upon vaporization in the mouse kidney. Copyright © 2016 World Federation for Ultrasound in Medicine & Biology. Published by Elsevier Inc. All rights reserved.

  9. US Mains Stacked Very High Frequency Self-oscillating Resonant Power Converter with Unified Rectifier

    DEFF Research Database (Denmark)

    Pedersen, Jeppe Arnsdorf; Madsen, Mickey Pierre; Mønster, Jakob Døllner

    2016-01-01

    This paper describes a Very High Frequency (VHF) converter made with three Class-E inverters and a single ClassDE rectifier. The converter is designed for the US mains (120 V, 60 Hz) and can deliver 9 W to a 60 V LED. The converter has a switching frequency of 37 MHz and achieves an efficiency...... of 89.4%. With VHF converters the power density can be improved and the converter described in this paper has a power density of 2.14 W/cm3. The power factor (PF) requrements of mains connected equepment is fulfilled with a power factor of 0.96....

  10. Ion cyclotron range of frequencies mode conversion electron heating in deuterium-hydrogen plasmas in the Alcator C-Mod tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Y [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Wukitch, S J [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Bonoli, P T [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Marmar, E [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Mossessian, D [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Nelson-Melby, E [Centre de Recherches en Physique des Plasmas, Association EURATOM - Confederation Suisse, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (Switzerland); Phillips, P [Fusion Research Center, University of Texas, Austin, Texas 78712 (United States); Porkolab, M [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Schilling, G [Plasma Physics Laboratory, Princeton, NJ 08543 (United States); Wolfe, S [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Wright, J [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)

    2003-06-01

    Localized direct electron heating (EH) by mode-converted (MC) ion cyclotron range of frequencies (ICRF) waves in D(H) tokamak plasmas has been clearly observed for the first time in Alcator C-Mod. Both on- and off-axis (high field side) mode conversion EH (MCEH) have been observed. The MCEH profile was obtained from a break-in-slope analysis of electron temperature signals in the presence of radio frequency shut-off. The temperature was measured by a 32-channel high spatial resolution ({<=}7 mm) 2nd harmonic heterodyne electron cyclotron emission system. The experimental profiles were compared with the predictions from a toroidal full-wave ICRF code TORIC. Using the hydrogen concentration measured by a high-resolution optical spectrometer, TORIC predictions were shown qualitatively in agreement with the experimental results for both on- and off-axis MC cases. From the simulations, the EH from MC ion cyclotron wave and ion Bernstein wave is examined.

  11. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  12. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  13. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  14. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  15. The acoustic power of a vibrating clamped circular plate revisited in the wide low frequency range using expansion into the radial polynomials.

    Science.gov (United States)

    Rdzanek, Wojciech P

    2016-06-01

    This study deals with the classical problem of sound radiation of an excited clamped circular plate embedded into a flat rigid baffle. The system of the two coupled differential equations is solved, one for the excited and damped vibrations of the plate and the other one-the Helmholtz equation. An approach using the expansion into radial polynomials leads to results for the modal impedance coefficients useful for a comprehensive numerical analysis of sound radiation. The results obtained are accurate and efficient in a wide low frequency range and can easily be adopted for a simply supported circular plate. The fluid loading is included providing accurate results in resonance.

  16. Optimized 3-D electromagnetic models of composite materials in microwave frequency range: application to EMC characterization of complex media by statistical means

    Directory of Open Access Journals (Sweden)

    S. Lalléchère

    2017-05-01

    Full Text Available The aim of this proposal is to demonstrate the ability of tridimensional (3-D electromagnetic modeling tool for the characterization of composite materials in microwave frequency band range. Indeed, an automated procedure is proposed to generate random materials, proceed to 3-D simulations, and compute shielding effectiveness (SE statistics with finite integration technique. In this context, 3-D electromagnetic models rely on random locations of conductive inclusions; results are compared with classical electromagnetic mixing theory (EMT approaches (e.g. Maxwell-Garnett formalism, and dynamic homogenization model (DHM. The article aims to demonstrate the interest of the proposed approach in various domains such as propagation and electromagnetic compatibility (EMC.

  17. Photonic filtering of microwave signals in the frequency range of 0.01-20 GHz using a Fabry-Perot filter

    Energy Technology Data Exchange (ETDEWEB)

    Aguayo-Rodriguez, G; Zaldivar-Huerta, I E [Instituto Nacional de Astrofisica, Optica y Electronica (INAOE). Sta. Maria Tonantzintla, Pue. Mexico (Mexico); GarcIa-Juarez, A [Depto. de Investigacion en Fisica, Universidad de Sonora (UNISON) Hermosillo, Son. Mexico (Mexico); Rodriguez-Asomoza, J [Depto. de Ingenieria Electronica, Universidad de las Americas-Puebla (UDLA). San Andres Cholula, Pue. Mexico (Mexico); Larger, L; Courjal, N [Laboratoire d' Optique P. M. Duffieux, UMR 6603 CNRS, Institut des Microtechiques de Franche-Comte, FRW 0067, UFR Sciences et Techniques, Universite de Franche-Comte (UFC), Besancon cedex (France)

    2011-01-01

    We demonstrate experimentally the efficiency of tuning of a photonic filter in the frequency range of 0.01 to 20 GHz. The presented work combines the use of a multimode optical source associated with a dispersive optical fiber to obtain the filtering effect. Tunability effect is achieved by the use of a Fabry-Perot filter that allows altering the spectral characteristics of the optical source. Experimental results are validated by means of numerical simulations. The scheme here proposed has a potential application in the field of optical telecommunications.

  18. Dielectric spectroscopy of SiO2, ZnO - nanoparticle loaded epoxy resin in the frequency range of 20 Hz to 2 MHz

    Science.gov (United States)

    Thakor, Sanketsinh; Rana, V. A.; Vankar, H. P.

    2017-05-01

    In present work, Bisphenol A-(epichlorhydrin); epoxy resin with hardener N(3-dimethylaminopropyl)-1,3-propylenediamine were used to determine the dielectric properties. Sample of the neat epoxy resin and nanoparticle loaded epoxy resin in the form of disc were prepared of different weight fraction. SiO2 and ZnO nanoparticles were taken as filler in the epoxy resin. Complex permittivity of the prepared samples was measured in the frequency range of 20 Hz to 2 MHz using precision LCR meter at room temperature. The charismatic change in dielectric behavior based on type and concentration of nanoparticle are discussed in detail.

  19. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  20. Development Of VHF (240-270 MHz) Antennas For SoOp (Signal Of Opportunity) Receiver For 6u Cubesat Platforms

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2016-01-01

    The main goal of this research is to design, fabricate, and test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a truly global direct surface soil moisture (SM) and RZSM measurement system (Figure 1) over a variety of land covers with limited density restrictions. In SoOp methodology, signals transmitted by already existing transmitters (known as transmitters of opportunity, in this case the Military Satellite Communication (MilSatCom) System's UHF Follow-On program) are utilized to measure properties of reflecting targets by recording reflected signals using a simple passive microwave receiver.

  1. Upgrade possibilities for continuous wave rf electron guns based on room-temperature very high frequency technology

    Science.gov (United States)

    Sannibale, F.; Filippetto, D.; Johnson, M.; Li, D.; Luo, T.; Mitchell, C.; Staples, J.; Virostek, S.; Wells, R.; Byrd, J. M.

    2017-11-01

    The past decade was characterized by an increasing scientific demand for extending towards higher repetition rates (MHz class and beyond) the performance of already operating lower repetition rate accelerator-based instruments such as x-ray free electron lasers (FELs) and ultrafast electron diffraction (UED) and microscopy (UEM) instruments. Such a need stimulated a worldwide spread of a vibrant R&D activity targeting the development of high-brightness electron sources capable of operating at these challenging rates. Among the different technologies pursued, rf guns based on room-temperature structures resonating in the very high frequency (VHF) range (30-300 MHz) and operating in continuous wave successfully demonstrated in the past few years the targeted brightness and reliability. Nevertheless, recently proposed upgrades for x-ray FELs and the always brightness-frontier applications such as UED and UEM are now requiring a further step forward in terms of beam brightness in electron sources. In this paper, we present a few possible upgrade paths that would allow one to extend, in a relatively simple and cost-effective way, the performance of the present VHF technology to the required new goals.

  2. Upgrade possibilities for continuous wave rf electron guns based on room-temperature very high frequency technology

    Directory of Open Access Journals (Sweden)

    F. Sannibale

    2017-11-01

    Full Text Available The past decade was characterized by an increasing scientific demand for extending towards higher repetition rates (MHz class and beyond the performance of already operating lower repetition rate accelerator-based instruments such as x-ray free electron lasers (FELs and ultrafast electron diffraction (UED and microscopy (UEM instruments. Such a need stimulated a worldwide spread of a vibrant R&D activity targeting the development of high-brightness electron sources capable of operating at these challenging rates. Among the different technologies pursued, rf guns based on room-temperature structures resonating in the very high frequency (VHF range (30–300 MHz and operating in continuous wave successfully demonstrated in the past few years the targeted brightness and reliability. Nevertheless, recently proposed upgrades for x-ray FELs and the always brightness-frontier applications such as UED and UEM are now requiring a further step forward in terms of beam brightness in electron sources. In this paper, we present a few possible upgrade paths that would allow one to extend, in a relatively simple and cost-effective way, the performance of the present VHF technology to the required new goals.

  3. 1.55-μm mode-locked quantum-dot lasers with 300 MHz frequency tuning range

    Energy Technology Data Exchange (ETDEWEB)

    Sadeev, T., E-mail: tagir@mailbox.tu-berlin.de; Arsenijević, D.; Bimberg, D. [Institut für Festkörperphysik, Technische Universität Berlin, 10623 Berlin (Germany); Franke, D.; Kreissl, J.; Künzel, H. [Heinrich-Hertz-Institut, Einsteinufer 37, 10587 Berlin (Germany)

    2015-01-19

    Passive mode-locking of two-section quantum-dot mode-locked lasers grown by metalorganic vapor phase epitaxy on InP is reported. 1250-μm long lasers exhibit a wide tuning range of 300 MHz around the fundamental mode-locking frequency of 33.48 GHz. The frequency tuning is achieved by varying the reverse bias of the saturable absorber from 0 to −2.2 V and the gain section current from 90 to 280 mA. 3 dB optical spectra width of 6–7 nm leads to ex-facet optical pulses with full-width half-maximum down to 3.7 ps. Single-section quantum-dot mode-locked lasers show 0.8 ps broad optical pulses after external fiber-based compression. Injection current tuning from 70 to 300 mA leads to 30 MHz frequency tuning.

  4. Oven controlled N++ [1 0 0] length-extensional mode silicon resonator with frequency stability of 1 ppm over industrial temperature range

    Science.gov (United States)

    You, Weilong; Pei, Binbin; Sun, Ke; Zhang, Lei; Yang, Heng; Li, Xinxin

    2017-10-01

    This paper presents an oven controlled N++ [1 0 0] length-extensional mode silicon resonator, with a lookup-table based control algorithm. The temperature coefficient of resonant frequency (TCF) of the N++ doped resonator is nonlinear, and there is a turnover temperature point at which the TCF is equal to zero. The resonator is maintained at the turnover point by Joule heating; this temperature is a little higher than the upper limit of the industrial temperature range. It is demonstrated that the control algorithm based on the thermoresistor on the substrate and the lookup table for heating voltage versus chip temperature is sufficiently accurate to achieve a frequency stability of  ±0.5 ppm over the industrial temperature range. Because only two leads are required for electrical heating and piezoresistive sensing, the power required for heating of this resonator can be potentially lower than that of the oscillators with closed-loop oven control algorithm. It is also shown that the phase noise can be suppressed at the turnover temperature because of the very low value of the TCF, which justifies the usage of the heating voltage as the excitation voltage of the Wheatstone half-bridge.

  5. Frequency-Dependent Blanking with Digital Linear Chirp Waveform Synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Doerry, Armin Walter [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Andrews, John M. [General Atomics Aeronautical Systems, Inc., San Diego, CA (United States)

    2014-07-01

    Wideband radar systems, especially those that operate at lower frequencies such as VHF and UHF, are often restricted from transmitting within or across specific frequency bands in order to prevent interference to other spectrum users. Herein we describe techniques for notching the transmitted spectrum of a generated and transmitted radar waveform. The notches are fully programmable as to their location, and techniques are given that control the characteristics of the notches.

  6. The dielectric properties of human pineal gland tissue and RF absorption due to wireless communication devices in the frequency range 400-1850 MHz

    Energy Technology Data Exchange (ETDEWEB)

    Schmid, Gernot [Austrian Research Centers GmbH-ARC, ITM, A-2444 Seibersdorf (Austria); Ueberbacher, Richard [Austrian Research Centers GmbH-ARC, ITM, A-2444 Seibersdorf (Austria); Samaras, Theodoros [Department of Physics, Aristotle University of Thessaloniki, GR-54124 Thessaloniki (Greece); Tschabitscher, Manfred [Center of Anatomy and Cell Biology, Medical University of Vienna, A-1090 Vienna (Austria); Mazal, Peter R [Department of Clinical Pathology, Medical University Vienna, A-1090 Vienna (Austria)

    2007-09-07

    In order to enable a detailed analysis of radio frequency (RF) absorption in the human pineal gland, the dielectric properties of a sample of 20 freshly removed pineal glands were measured less than 20 h after death. Furthermore, a corresponding high resolution numerical model of the brain region surrounding the pineal gland was developed, based on a real human tissue sample. After inserting this model into a commercially available numerical head model, FDTD-based computations for exposure scenarios with generic models of handheld devices operated close to the head in the frequency range 400-1850 MHz were carried out. For typical output power values of real handheld mobile communication devices, the obtained results showed only very small amounts of absorbed RF power in the pineal gland when compared to SAR limits according to international safety standards. The highest absorption was found for the 400 MHz irradiation. In this case the RF power absorbed inside the pineal gland (organ mass 96 mg) was as low as 11 {mu}W, when considering a device of 500 mW output power operated close to the ear. For typical mobile phone frequencies (900 MHz and 1850 MHz) and output power values (250 mW and 125 mW) the corresponding values of absorbed RF power in the pineal gland were found to be lower by a factor of 4.2 and 36, respectively. These results indicate that temperature-related biologically relevant effects on the pineal gland induced by the RF emissions of typical handheld mobile communication devices are unlikely.

  7. A study of three-half-turn and frame antennae for ion cyclotron range of frequency plasma heating in the URAGAN-3M torsatron

    Energy Technology Data Exchange (ETDEWEB)

    Lysoivan, A.I. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Moiseenko, V.E. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Plyusnin, V.V. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Kasilov, S.V. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Bondarenko, V.N. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Chechkin, V.V. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Fomin, I.P. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Grigor`eva, L.I. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Konovalov, V.G. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Koval`ov, S.V. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Litvinov, A.P. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Mironov, Yu.K. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Nazarov, N.I. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Pavlichenko, O.S. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Pavlichenko, R.O. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Shapoval, A.N. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Skibenko, A.I. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center; Volkov, E.D. [Kharkov Inst. of Phys. and Tech. (Ukraine). Nat. Sci. Center

    1995-01-01

    Numerical and experimental results of Alfven wave heating of plasmas in the frequency range below the ion cyclotron frequency ({omega}<{omega}{sub ci}) are presented. Two different types of antenna were used for plasma production and heating: a frame type antenna (FTA) conventionally used in the URAGAN-3M device and a three-half-turn antenna (THTA) proposed recently to avoid the deleterious effects of conversion of fast wave to slow wave in the plasma periphery and to perform plasma core heating more effectively. Numerical modeling of electromagnetic field excitation in the URAGAN-3M plasma by the FTA and THTA was performed using a one-dimensional code. The results of calculations showed better performance of the compact THTA compared with the FTA for the case of a high density plasma (approximately 10{sup 13}cm{sup -3}). When using the THTA, the experiments performed showed the possibility of dense plasma production (more than 2x10{sup 13}cm{sup -3}) and heating, which had not been obtained earlier in the URAGAN-3M. Shifting the power deposition profile deeper inside the plasma body with the THTA resulted in modification of the plasma density profile and an improvement in plasma confinement. ((orig.)).

  8. Rotation of Magnetization Derived from Brownian Relaxation in Magnetic Fluids of Different Viscosity Evaluated by Dynamic Hysteresis Measurements over a Wide Frequency Range

    Directory of Open Access Journals (Sweden)

    Satoshi Ota

    2016-09-01

    Full Text Available The dependence of magnetic relaxation on particle parameters, such as the size and anisotropy, has been conventionally discussed. In addition, the influences of external conditions, such as the intensity and frequency of the applied field, the surrounding viscosity, and the temperature on the magnetic relaxation have been researched. According to one of the basic theories regarding magnetic relaxation, the faster type of relaxation dominates the process. However, in this study, we reveal that Brownian and Néel relaxations coexist and that Brownian relaxation can occur after Néel relaxation despite having a longer relaxation time. To understand the mechanisms of Brownian rotation, alternating current (AC hysteresis loops were measured in magnetic fluids of different viscosities. These loops conveyed the amplitude and phase delay of the magnetization. In addition, the intrinsic loss power (ILP was calculated using the area of the AC hysteresis loops. The ILP also showed the magnetization response regarding the magnetic relaxation over a wide frequency range. To develop biomedical applications of magnetic nanoparticles, such as hyperthermia and magnetic particle imaging, it is necessary to understand the mechanisms of magnetic relaxation.

  9. Measurements of ion cyclotron range of frequencies mode converted wave intensity with phase contrast imaging in Alcator C-Mod and comparison with full-wave simulations

    Energy Technology Data Exchange (ETDEWEB)

    Tsujii, N.; Porkolab, M.; Bonoli, P. T.; Lin, Y.; Wright, J. C.; Wukitch, S. J. [MIT Plasma Science and Fusion Center, Cambridge, Massachusetts 02139 (United States); Jaeger, E. F. [XCEL Engineering, Inc., Oak Ridge, Tennessee 37830 (United States); Green, D. L. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Harvey, R. W. [CompX, Del Mar, California 92014 (United States)

    2012-08-15

    Radio frequency waves in the ion cyclotron range of frequencies (ICRF) are widely used to heat tokamak plasmas. In ICRF heating schemes involving multiple ion species, the launched fast waves convert to ion cyclotron waves or ion Bernstein waves at the two-ion hybrid resonances. Mode converted waves are of interest as actuators to optimise plasma performance through current drive and flow drive. In order to describe these processes accurately in a realistic tokamak geometry, numerical simulations are essential, and it is important that these codes be validated against experiment. In this study, the mode converted waves were measured using a phase contrast imaging technique in D-H and D-{sup 3}He plasmas. The measured mode converted wave intensity in the D-{sup 3}He mode conversion regime was found to be a factor of {approx}50 weaker than the full-wave predictions. The discrepancy was reduced in the hydrogen minority heating regime, where mode conversion is weaker.

  10. Validation of full-wave simulations for mode conversion of waves in the ion cyclotron range of frequencies with phase contrast imaging in Alcator C-Mod

    Science.gov (United States)

    Tsujii, N.; Porkolab, M.; Bonoli, P. T.; Edlund, E. M.; Ennever, P. C.; Lin, Y.; Wright, J. C.; Wukitch, S. J.; Jaeger, E. F.; Green, D. L.; Harvey, R. W.

    2015-08-01

    Mode conversion of fast waves in the ion cyclotron range of frequencies (ICRF) is known to result in current drive and flow drive under optimised conditions, which may be utilized to control plasma profiles and improve fusion plasma performance. To describe these processes accurately in a realistic toroidal geometry, numerical simulations are essential. Quantitative comparison of these simulations and the actual experimental measurements is important to validate their predictions and to evaluate their limitations. The phase contrast imaging (PCI) diagnostic has been used to directly detect the ICRF waves in the Alcator C-Mod tokamak. The measurements have been compared with full-wave simulations through a synthetic diagnostic technique. Recently, the frequency response of the PCI detector array on Alcator C-Mod was recalibrated, which greatly improved the comparison between the measurements and the simulations. In this study, mode converted waves for D-3He and D-H plasmas with various ion species compositions were re-analyzed with the new calibration. For the minority heating cases, self-consistent electric fields and a minority ion distribution function were simulated by iterating a full-wave code and a Fokker-Planck code. The simulated mode converted wave intensity was in quite reasonable agreement with the measurements close to the antenna, but discrepancies remain for comparison at larger distances.

  11. Validation of full-wave simulations for mode conversion of waves in the ion cyclotron range of frequencies with phase contrast imaging in Alcator C-Mod

    Energy Technology Data Exchange (ETDEWEB)

    Tsujii, N., E-mail: tsujii@k.u-tokyo.ac.jp [Graduate School of Frontier Sciences, The University of Tokyo, Chiba 277-8561 (Japan); Porkolab, M.; Bonoli, P. T.; Edlund, E. M.; Ennever, P. C.; Lin, Y.; Wright, J. C.; Wukitch, S. J. [MIT Plasma Science and Fusion Center, Cambridge, Massachusetts 02139 (United States); Jaeger, E. F. [XCEL Engineering, Inc., Oak Ridge, Tennessee 37830 (United States); Green, D. L. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Harvey, R. W. [CompX, Del Mar, California 92014 (United States)

    2015-08-15

    Mode conversion of fast waves in the ion cyclotron range of frequencies (ICRF) is known to result in current drive and flow drive under optimised conditions, which may be utilized to control plasma profiles and improve fusion plasma performance. To describe these processes accurately in a realistic toroidal geometry, numerical simulations are essential. Quantitative comparison of these simulations and the actual experimental measurements is important to validate their predictions and to evaluate their limitations. The phase contrast imaging (PCI) diagnostic has been used to directly detect the ICRF waves in the Alcator C-Mod tokamak. The measurements have been compared with full-wave simulations through a synthetic diagnostic technique. Recently, the frequency response of the PCI detector array on Alcator C-Mod was recalibrated, which greatly improved the comparison between the measurements and the simulations. In this study, mode converted waves for D-{sup 3}He and D-H plasmas with various ion species compositions were re-analyzed with the new calibration. For the minority heating cases, self-consistent electric fields and a minority ion distribution function were simulated by iterating a full-wave code and a Fokker-Planck code. The simulated mode converted wave intensity was in quite reasonable agreement with the measurements close to the antenna, but discrepancies remain for comparison at larger distances.

  12. NOTE: Computational dosimetry in embryos exposed to electromagnetic plane waves over the frequency range of 10 MHz-1.5 GHz

    Science.gov (United States)

    Kawai, Hiroki; Nagaoka, Tomoaki; Watanabe, Soichi; Saito, Kazuyuki; Takahashi, Masaharu; Ito, Koichi

    2010-01-01

    This paper presents calculated specific absorption rate (SAR) dosimetry in 4 and 8 week Japanese pregnant-woman models exposed to plane waves over the frequency range of 10 MHz-1.5 GHz. Two types of 2 mm spatial-resolution pregnant-woman models comprised a woman model, which is similar to the average-sized Japanese adult female in height and weight, with a cubic (4 week) embryo or spheroidal (8 week) one. The averaged SAR in the embryos exposed to vertically and horizontally polarized plane waves at four kinds of propagation directions are calculated from 10 MHz to 1.5 GHz. The results indicate that the maximum average SAR in the embryos exposed to plane waves is lower than 0.08 W kg-1 when the incident power density is at the reference level of ICNIRP guideline for general public environment.

  13. Wireless network of stand-alone end effect probes for soil in situ permittivity measurements over the 100MHZ-6GHz frequency range

    Science.gov (United States)

    Demontoux, François; Bircher, Simone; Ruffié, Gilles; Bonnaudiin, Fabrice; Wigneron, Jean-Pierre; Kerr, Yann

    2017-04-01

    Microwave remote sensing and non-destructive analysis are a powerful way to provide properties estimation of materials. Numerous applications using microwave frequency behavior of materials (remote sensing above land surfaces, non-destructive analysis…) are strongly dependent on the material's permittivity (i.e. dielectric properties). This permittivity depends on numerous parameters such as moisture, texture, temperature, frequency or bulk density. Permittivity measurements are generally carried out in the laboratory. Additionally, dielectric mixing models allow, over a restricted range of conditions, the assessment of a material's permittivity. in-situ measurements are more difficult to obtain. Some in situ measurement probes based on permittivity properties of soil exist (e.g. Time Domain Reflectometers and Transmissometers, capacitance and impedance sensors). They are dedicated to the acquisition of soil moisture data based on permittivity (mainly the real part) estimations over a range of frequencies from around 50 MHz to 1 or 2 GHz. Other Dielectric Assessment Kits exist but they are expensive and they are rather dedicated to laboratory measurements. Furthermore, the user can't address specific issues related to particular materials (e.g. organic soils) or specific measurement conditions (in situ long time records). At the IMS Laboratory we develop probes for in situ soil permittivity measurements (real and imaginary parts) in the 0.5 - 6 GHz frequency range. They are based on the end effect phenomenon of a coaxial waveguide and so are called end effect probes in this paper. The probes can be connected to a portable Vector Network Analyzer (VNA, ANRITSU MS2026A) for the S11 coefficient measurements needed to compute permittivity. It is connected to a PC to record data using an USB connection. This measurement set-up is already used for in situ measurement of soil properties in the framework of the European Space Agency's (ESA) SMOS space mission. However

  14. Frequency-resolved optical gating system with a tellurium crystal for characterizing free-electron lasers in the wavelength range of 10-30 microm.

    Science.gov (United States)

    Iijima, Hokuto; Nagai, Ryoji; Nishimori, Nobuyuki; Hajima, Ryoichi; Minehara, Eisuke J

    2009-12-01

    A second-harmonic generation frequency-resolved optical gating (SHG-FROG) system has been developed for the complete characterization of laser pulses in the wavelength range of 10-30 microm. A tellurium crystal is used so that spectrally resolved autocorrelation signals with a good signal-to-noise ratio are obtained. Pulses (wavelength approximately 22 microm) generated from a free-electron laser are measured by the SHG-FROG system. The SHG intensity profile and the spectrum obtained by FROG measurements are well consistent with those of independent measurements of the pulse length and spectrum. The pulse duration and spectral width determined from the FROG trace are 0.6 ps and 5.2 THz at full width half maximum, respectively.

  15. Vibrotactile Presentation of Musical Notes to the Glabrous Skin for Adults with Normal Hearing or a Hearing Impairment: Thresholds, Dynamic Range and High-Frequency Perception.

    Directory of Open Access Journals (Sweden)

    Carl Hopkins

    Full Text Available Presentation of music as vibration to the skin has the potential to facilitate interaction between musicians with hearing impairments and other musicians during group performance. Vibrotactile thresholds have been determined to assess the potential for vibrotactile presentation of music to the glabrous skin of the fingertip, forefoot and heel. No significant differences were found between the thresholds for sinusoids representing notes between C1 and C6 when presented to the fingertip of participants with normal hearing and with a severe or profound hearing loss. For participants with normal hearing, thresholds for notes between C1 and C6 showed the characteristic U-shape curve for the fingertip, but not for the forefoot and heel. Compared to the fingertip, the forefoot had lower thresholds between C1 and C3, and the heel had lower thresholds between C1 and G2; this is attributed to spatial summation from the Pacinian receptors over the larger contactor area used for the forefoot and heel. Participants with normal hearing assessed the perception of high-frequency vibration using 1s sinusoids presented to the fingertip and were found to be more aware of transient vibration at the beginning and/or end of notes between G4 and C6 when stimuli were presented 10dB above threshold, rather than at threshold. An average of 94% of these participants reported feeling continuous vibration between G4 and G5 with stimuli presented 10dB above threshold. Based on the experimental findings and consideration of health effects relating to vibration exposure, a suitable range of notes for vibrotactile presentation of music is identified as being from C1 to G5. This is more limited than for human hearing but the fundamental frequencies of the human voice, and the notes played by many instruments, lie within it. However, the dynamic range might require compression to avoid the negative effects of amplitude on pitch perception.

  16. Vibrotactile Presentation of Musical Notes to the Glabrous Skin for Adults with Normal Hearing or a Hearing Impairment: Thresholds, Dynamic Range and High-Frequency Perception.

    Science.gov (United States)

    Hopkins, Carl; Maté-Cid, Saúl; Fulford, Robert; Seiffert, Gary; Ginsborg, Jane

    2016-01-01

    Presentation of music as vibration to the skin has the potential to facilitate interaction between musicians with hearing impairments and other musicians during group performance. Vibrotactile thresholds have been determined to assess the potential for vibrotactile presentation of music to the glabrous skin of the fingertip, forefoot and heel. No significant differences were found between the thresholds for sinusoids representing notes between C1 and C6 when presented to the fingertip of participants with normal hearing and with a severe or profound hearing loss. For participants with normal hearing, thresholds for notes between C1 and C6 showed the characteristic U-shape curve for the fingertip, but not for the forefoot and heel. Compared to the fingertip, the forefoot had lower thresholds between C1 and C3, and the heel had lower thresholds between C1 and G2; this is attributed to spatial summation from the Pacinian receptors over the larger contactor area used for the forefoot and heel. Participants with normal hearing assessed the perception of high-frequency vibration using 1s sinusoids presented to the fingertip and were found to be more aware of transient vibration at the beginning and/or end of notes between G4 and C6 when stimuli were presented 10dB above threshold, rather than at threshold. An average of 94% of these participants reported feeling continuous vibration between G4 and G5 with stimuli presented 10dB above threshold. Based on the experimental findings and consideration of health effects relating to vibration exposure, a suitable range of notes for vibrotactile presentation of music is identified as being from C1 to G5. This is more limited than for human hearing but the fundamental frequencies of the human voice, and the notes played by many instruments, lie within it. However, the dynamic range might require compression to avoid the negative effects of amplitude on pitch perception.

  17. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  18. VHF NEMS-CMOS piezoresistive resonators for advanced sensing applications.

    Science.gov (United States)

    Arcamone, Julien; Dupré, Cécilia; Arndt, Grégory; Colinet, Eric; Hentz, Sébastien; Ollier, Eric; Duraffourg, Laurent

    2014-10-31

    This work reports on top-down nanoelectromechanical resonators, which are among the smallest resonators listed in the literature. To overcome the fact that their electromechanical transduction is intrinsically very challenging due to their very high frequency (100 MHz) and ultimate size (each resonator is a 1.2 μm long, 100 nm wide, 20 nm thick silicon beam with 100 nm long and 30 nm wide piezoresistive lateral nanowire gauges), they have been monolithically integrated with an advanced fully depleted SOI CMOS technology. By advantageously combining the unique benefits of nanomechanics and nanoelectronics, this hybrid NEMS-CMOS device paves the way for novel breakthrough applications, such as NEMS-based mass spectrometry or hybrid NEMS/CMOS logic, which cannot be fully implemented without this association.

  19. Very High Frequency Monitoring System for Engine Gearbox and Generator Health Management (Postprint)

    Science.gov (United States)

    2007-09-18

    measurement of VHF vibration. This instrumentation includes high bandwidth piezoelectric accelerometers and a laser vibrometer , as seen in Table 1. Table...Bandwidth Piezoelectric Accelerometers Most commonly used, variety of sizes and configurations Optical Laser Vibrometer System 500 kHz Bandwidth, dynamic... piezoelectric , optical, and acoustic frequency measurements for improved, incipient anomaly detection. These gas turbine engine vibration monitoring technologies

  20. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  1. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  2. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  3. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  4. ALIVE-IN-RANGE MEDIUM ACCESS CONTROL PROTOCOL TO MINIMIZE DELAY IN UNDERWATER WIRELESS SENSOR NETWORK COMMUNICATION AT A FREQUENCY OF 2.4 GHz

    Directory of Open Access Journals (Sweden)

    VIKAS RAINA

    2017-11-01

    Full Text Available Time synchronization between the sensor nodes to reduce end to end delay for critical and real time data monitoring can be achieved by cautiously monitoring the mobility of the mobile sink node in underwater wireless sensor networks. The proposed Alive-in-Range (AR-MAC medium access control protocol monitors delay sensitive, critical and real time data. The idea evolves as a reduction in duty cycle, precise time scheduling of active/sleep cycles of the sensors, monitoring the mobility of the sink node along-with the selection of appropriate queues and schedulers can reduce the end to end delay enhancing other performance metrics too. The algorithms effective path determination and optimum throughput path determination are proposed. It is assumed that the sensors are properly anchored to limit their movement due to waves within the permissible limits to follow these algorithms. This paper attempts to utilize electromagnetic waves at resonance frequency of 2.4 GHz for underwater communication. The results verify that the implementation of Alive-in-Range MAC protocol has reduced the average end to end delay significantly making it appropriate for critical and real time data monitoring. This work proves the suitability of electromagnetic waves as an effective alternative for underwater wireless communication. The main objective is to mitigate sink neighbourhood problem, distance constrained mobile sink problem and to reduce the average end to end delay by implementing Alive-in-Range (AR-MAC medium access control protocol in underwater sensor networks and to draw the attention of researchers in this area.

  5. Long-term high frequency measurements of ethane, benzene and methyl chloride at Ragged Point, Barbados: Identification of long-range transport events

    Directory of Open Access Journals (Sweden)

    A.T. Archibald

    2015-09-01

    Full Text Available AbstractHere we present high frequency long-term observations of ethane, benzene and methyl chloride from the AGAGE Ragged Point, Barbados, monitoring station made using a custom built GC-MS system. Our analysis focuses on the first three years of data (2005–2007 and on the interpretation of periodic episodes of high concentrations of these compounds. We focus specifically on an exemplar episode during September 2007 to assess if these measurements are impacted by long-range transport of biomass burning and biogenic emissions. We use the Lagrangian Particle Dispersion model, NAME, run forwards and backwards in time to identify transport of air masses from the North East of Brazil during these events. To assess whether biomass burning was the cause we used hot spots detected using the MODIS instrument to act as point sources for simulating the release of biomass burning plumes. Excellent agreement for the arrival time of the simulated biomass burning plumes and the observations of enhancements in the trace gases indicates that biomass burning strongly influenced these measurements. These modelling data were then used to determine the emissions required to match the observations and compared with bottom up estimates based on burnt area and literature emission factors. Good agreement was found between the two techniques highlight the important role of biomass burning. The modelling constrained by in situ observations suggests that the emission factors were representative of their known upper limits, with the in situ data suggesting slightly greater emissions of ethane than the literature emission factors account for. Further analysis was performed concluding only a small role for biogenic emissions of methyl chloride from South America impacting measurements at Ragged Point. These results highlight the importance of long-term high frequency measurements of NMHC and ODS and highlight how these data can be used to determine sources of emissions

  6. Mutual relationship of oscillations in the frequency range 3.6 mHz to 22 mHz in the solar chromosphere

    Directory of Open Access Journals (Sweden)

    Anđić A.

    2006-01-01

    Full Text Available High frequency acoustic oscillations were suggested as the source of mechanical heating in the chromosphere. In this work the radial component of the oscillations in the frequency interval 3 mHz to 22 mHz are investigated. The observations were performed using "D spectrometry on the Fe I neutral spectral line at 543:45 nm. The high frequency oscillations of different frequencies appear to be associated with different spatial scales. It seems that different sources produce high and low frequency acoustic oscillations.

  7. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  8. Identification of low and high frequency ranges for heart rate variability and blood pressure variability analyses using pharmacological autonomic blockade with atropine and propranolol in swine.

    Science.gov (United States)

    Poletto, Rosangela; Janczak, Andrew M; Marchant-Forde, Ruth M; Marchant-Forde, Jeremy N; Matthews, Donald L; Dowell, Carol A; Hogan, Daniel F; Freeman, Lynetta J; Lay, Donald C

    2011-05-03

    Understanding autonomic nervous system functioning, which mediates behavioral and physiological responses to stress, offers great potential for assessing farm animal stress and welfare. Evaluation of heart rate variability (HRV) and blood pressure variability (BPV), using time and frequency domain analyses may provide a sensitive and reliable measure of affective states and stress-mediated changes in sympathetic and parasympathetic tones. The aim of this research was to define low (LF) and high frequency (HF) power spectral ranges using pharmacological autonomic blockade, and to examine HRV and BPV parameter changes in response to atropine and propranolol in swine. Ten, 13-week old, barrows (n=6) and gilts (n=4) underwent surgery to place an intra-cardiac electrode and a blood pressure catheter attached to a biotelemetric transmitter; pigs had a 3-week recovery period prior to data collection. Each pig was subjected to administration of 4 intravenous (i.v.) drug treatments: a control treatment, 3 mL of saline, and 3 blockade treatments; 0.1 mg/kg of atropine, 1.0 mg/kg of propranolol, and .1 mg/kg of atropine together with 1.0 mg/kg of propranolol. All treatments were delivered by injection in the jugular vein with a minimum of 48 h between individual treatments. Behavior, ECG and blood pressure data were recorded continuously for a total of 1h, from 30 min pre-injection to 30 min post-injection. For data analyses, two 512-beat intervals were selected for each treatment while the pig was lying and inactive. The first interval was selected from the pre-injection period (baseline), and the second was selected between 10 and 30 min post-injection. Time and frequency domain (power spectral density) analyses were performed on each data interval. Subsequent, LF and HF bands from the power spectral densities were defined based on general linear and regression analyses. The HRV and BPV were computed with a covariate (baseline) factorial analysis of treatment by sex

  9. Electromagnetic shielding behavior of polyaniline using Red Mud (industrial waste) as filler in the X – band (8.2–12.4 GHz) frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Pande, Anu; Gairola, Preeti [Uttaranchal University, Prem Nagar, Dehradun (India); Sambyal, Pradeep [National Physical Laboratory (CSIR), K, S. Krishnan Marg, New Delhi (India); Gairola, S.P., E-mail: spgairola10@gmail.com [Uttaranchal University, Prem Nagar, Dehradun (India); Kumar, Vinod [Centre for Energy Studies, Indian Institute of Technology, New Delhi (India); Singh, Kuldeep [Central Electrochemical Research Institute (CSIR), Karaikudi, Tamilnadu (India); Dhawan, S.K. [National Physical Laboratory (CSIR), K, S. Krishnan Marg, New Delhi (India)

    2017-03-01

    In today’s times where pollution of all kinds is at its peak, numerous efforts are being made to find proper waste disposal methods. Moving on the same lines, this paper presents an economical and environmentally safe method of disposal of red mud to control electromagnetic pollution by using it as an electromagnetic shielding material. Composites of PANI/RM have been prepared by in-situ chemical oxidative polymerization and have been tested for structural analysis, thermal stability and magnetization by XRD, TGA and VSM techniques respectively. Further, the composites have shown shielding effectiveness of 33–41 dB (>99.99% attenuation) in 8.2–12.4 GHz frequency range (X-band) at a thickness of 3 mm which is absorption dominated. Thus, the results conclude that the incorporation of red mud into polymer matrix can serve two purposes – firstly, it can provide a good alternative as a shielding material and secondly, it can prove to be a feasible way of waste disposal. - Highlights: • An attempt to find out application of red mud in controlling electromagnetic pollution. • Waste utilization for technology: Red mud is an insoluble industrial waste used for EMI Shielding application. • Using and testing of Red Mud as filler instead of the other widely used fillers. • Characterization of materials (Red Mud/Polyaniline composite) for EMI shielding Application. • EMI Shielding results discussions of new material (Red Mud/Polyaniline).

  10. One-D full-wave description of plasma emission and absorption in the ion cyclotron range of frequency in tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Fraboulet, D.; Becoulet, A.; Nguyen, F

    1998-11-01

    To maintain the ignition state in a tokamak fusion reactor, a control must be performed on the population of alpha-products, and this implies the ability to diagnose those {alpha}-particles. It is studied here whether the detection of emission radiated in the ion cyclotron range of frequency be a reactor plasma can provide useful information concerning fusion products, especially concerning their density profile. It is shown that the detection of the radiation emitted by the fast alpha particles along their cyclotron motion can give access to moments of their distribution function. This requires to compute the phase of the emitted field, using a full-wave approach. Such a technique allows to set in a convenient way the inverse problem of the determination of the emitting {alpha}-particles distribution through the radiation detection. A brief analysis of the expected situation in a reactor-relevant plasma is given. In parallel, the 1-D full-wave code developed in this frame is also useful for studying the physics of Fast Wave plasma heating. It enables to take into account the mode conversion of the Fast Wave into the Ion Bernstein Wave that appears near each ion cyclotron resonance. Results show that higher order terms may significantly alter the energy partitioning, in hot plasma cases involving mode conversion heating and/or ion cyclotron high harmonics heating. (author) 47 refs.

  11. Influence Of Terahertz Range Electromagnetic Radiation At Molecular Spectrum Frequency Of 150+0,75 Ghz Nitric Oxide On Microcirculation Morphofunctional Disturbances In White Rats In Condition Of Acute And Prolonged Stress

    Directory of Open Access Journals (Sweden)

    M.O. Kurtukova

    2009-12-01

    Full Text Available The effect of electromagnetic radiation of terahertz range at frequency of emission and absorption molecular spectrum of 150+0,75GHz nitric oxide on morphofunctional changes of microcirculation and tissue structure in animals in condition of acute and prolonged immobilization stress has been studied. It has shown that the influence of electromagnetic waves at these frequencies causes activity decrease of hypothalamic-pituitary-adrenal and tireoyd axis of stress reaction. It has been determined that terahertz range waves at frequency of nitric oxide are liable to restore disturbances of intravascular, vascular and extravascular components of microcirculation and also have histoprotective effect

  12. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. INVESTIGATION OF RANGES AND FREQUENCY OF MUTATIONS IN THE embB GENE IN MYCOBACTERIUMTUBERCULOSIS ASSOCIATED WITH RESISTANCE TO ETHAMBUTOL USING REAL-TIME POLYMERASE CHAINREACTION

    Directory of Open Access Journals (Sweden)

    Yu. S. Аlyapkinа

    2017-01-01

    Full Text Available Based on real-time allele-specific polymerase chain reaction, the ranges of potential mutations in codons of 306 and 405 of the embBgene in Mycobacterium tuberculosis associated with resistance to ethambutol were investigated. 5 different mutations were detected in codon 306 and 3 mutations were found in codon 406 of the embB gene. The detected mutations were confirmed by sequencing and mass spectrometry. By analyzing the frequency of detected mutations of , the set of reagents was developed for rapid testing of susceptibility tuberculous mycobacteria to ethambutol by multi-competitive allele-specific real-time PCR. Out of 107 tested specimens of clinical isolates, mutations of the embB gene of M. tuberculosis were detected in 49 (45.8% specimens, and no mutations were found in 58 (52.2% specimens. 39 (36.4% specimens had mutations in codon 306 of the embB gene, and 9 (8.4% specimens had a mutation in codon 406, and 1 (0.9% specimen had mutations in both codons 306 and 406. The high level of agreement in the results of molecular genetic and bacteriological tests (84% proved the significance of mutations in codons 306 and 406 of the embB gene in M. tuberculosis and the need for their identification in order to detect ethambutol resistant strains of M. tuberculosis. When using molecular genetic tests, the sensitivity level made 75.8%, while the specificity of standard culture-based methods makes 95.6%.

  14. Effects of Electromagnetic Field Over a Human Body, Sar Simulation with and Without Nanotextile in the Frequency Range 0.9-1.8GHZ

    Science.gov (United States)

    Tomovski, Boyan; Gräbner, Frank; Hungsberg, Axel; Kallmeyer, Christian; Linsel, Mario

    2011-11-01

    Within only the last decade, usage of mobile phones and many other electronic devices with high speed wireless RF connection is rapidly increasing. Modern life requires reliable, quick and high-quality information connections, which explains the widely spreading craze for electronic mobile devices of various types. The vast technological advances we are witnessing in electronics, electro-optics, and computer science have profoundly affected our everyday lives. Meanwhile, safety concerns regarding the biological effects of electromagnetic (EM) radiation have been raised, in particular at a low level of exposure which we everyday experience. A variety of waves and signals have to be considered such as different sine waves, digital signals used in radio, television, mobile phone systems and other information transfer systems. The field around us has become rather complicated and the "air space is getting more and more dense with RF. The establishing of safety recommendations, law norms and rules augmented by adequate measurements is very important and requires quite an expertise. But as many scientific researches suggest, what we are currently witnessing is very likely to generate a great public danger and a bad influence over the human body. There are many health organisations warning the public for possible development of cancer, mental and physical disorders etc [7, 8]. These suggestions are quite serious and should not be neglected by the official bodies and the test laboratories. In the following work, the effects of electromagnetic field over a virtual model of a human head have been simulated in the frequency range from 900 MHz to 1800 MHz (commonly created in the real life by mobile GSM system) with the help of the program MEFiSTo 2D Classic [1]. The created virtual models using the 2D simulation & computation software proved that the use of new high tech nanotextile materials for shielding layers around the human body can reduce the effects of EM fields

  15. Laser-induced breakdown spectroscopy to monitor ion cyclotron range of frequency wall cleaning Li/D co-deposition in EAST tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Liu, P.; Wu, D.; Sun, L.Y.; Zhao, D.Y.; Hai, R.; Li, C. [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Chinese Ministry of Education, School of Physics and Optical Electronic Technology, Dalian University of Technology, Dalian, 116024 (China); Ding, H., E-mail: hding@dlut.edu.cn [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Chinese Ministry of Education, School of Physics and Optical Electronic Technology, Dalian University of Technology, Dalian, 116024 (China); Hu, Z.H.; Wang, L.; Hu, J.S.; Chen, J.L.; Luo, G.N. [Institute of Plasma Physics, Chinese Academy of Sciences, P.O. Box 1126, Hefei, Anhui 230031 (China)

    2017-05-15

    Highlights: • LIBS was applied to EAST for monitoring the cleaning performance of the first wall using He-ICRF cleaning. • The cleaning performance is effective under helium ambient gas and some measurements have been obtained. • The results also indicate that the influence of magnetic field on LIBS signal is much stronger in helium ambient gas. • The effect of delay time and laser fluence on the LIBS signal has been investigated. - Abstract: In this paper, laser-induced breakdown spectroscopy (LIBS) under magnetic field condition has been studied in laboratory and EAST tokamak. The experimental results reveal that in helium ambient gas, the magnetic field significantly enhances the LIBS signal intensity (∼3 times). The effect of time delay and laser fluence on the intensity of LIBS has been investigated for optimizing the signal to background ratio (S/B). The developed LIBS approach has been applied to monitor the cleaning performance of the first wall in the fusion device of EAST using the ion cyclotron range of frequency (ICRF). The experimental results demonstrate that the cleaning performance for Li/D co-deposition layer is effective under helium ambient gas. The removing rate of Li on the surface of W tile is faster than that on Mo tile in He-ICRF cleaning and the D/(D + H) ratio on Mo tile is higher by ∼1.2 times than that on W tile. This work would indicate the feasibility of using LIBS to monitor the wall cleaning processes in EAST tokamak.

  16. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  17. The potential of the gyrotrons for development of the sub-terahertz and the terahertz frequency range - A review of novel and prospective applications

    Energy Technology Data Exchange (ETDEWEB)

    Idehara, T.; Saito, T.; Ogawa, I.; Mitsudo, S.; Tatematsu, Y. [Research Center for Development of Far Infrared Region, University of Fukui, 3-9-1 Bunkyo, 910-8507 Fukui (Japan); Sabchevski, S. [Research Center for Development of Far Infrared Region, University of Fukui, 3-9-1 Bunkyo, 910-8507 Fukui (Japan); Institute of Electronics of the Bulgarian Academy of Sciences, 72 Tzarigradsko Shose Blvd., 1784 Sofia (Bulgaria)], E-mail: sabch@ie.bas.bg

    2008-12-31

    Some recent advancements in the development of powerful high frequency gyrotrons that generate coherent radiation in the sub-terahertz and terahertz regions of the electromagnetic spectrum as well as their typical and novel applications are presented and discussed.

  18. Identification of low and high frequency ranges for heart rate variability and blood pressure variability analyses using pharmacological autonomic blockade with atropine and propranolol in swine.

    Science.gov (United States)

    Understanding autonomic nervous system functioning, which mediates behavioral and physiological responses to stress, offers great potential for evaluation of farm animal stress and welfare. Evaluation of heart rate variability (HRV) and blood pressure variability (BPV), using time and frequency doma...

  19. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  20. An Advanced VHF/UHF Short Range, Groundwave Propagation Model for Paths With Near-Earth Antennas

    Science.gov (United States)

    2006-11-01

    representation, its precise form in terms of algebraic , trigonometric, or transcendental functions remains elusive even to this day. What Sommerfeld did...average scatterer lineal density (objects per meter), η. The Hampton model differs from WP by combining an analytical spacewave model (essentially...Because it perhaps is easier to think of the separation between scatterers, rather than their lineal density, UGSprop inputs this parameter as the

  1. Equivalent threshold sound pressure levels for Sennheiser HDA 200 earphone and Etymotic Research ER-2 insert earphone in the frequency range 125 Hz to 16 kHz

    DEFF Research Database (Denmark)

    Han, Loc A; Poulsen, Torben

    1998-01-01

    Equivalent Threshold Sound Pressure Levels (ETSPLs) have been determined for the Sennheiser HDA 200 earphone and the Etymotic Research ER-2insert earphone. Thirty-one young normal-hearing test subjects participated and the thresholds were determined for all recommended frequencies in thefrequency...

  2. Equivalent threshold sound pressure levels (ETSPL) for Sennheiser HDA 280 supra-aural audiometric earphones in the frequency range 125 Hz to 8000 Hz

    DEFF Research Database (Denmark)

    Poulsen, Torben; Oakley, Sebastian

    2009-01-01

    Hearing threshold sound pressure levels were measured for the Sennheiser HDA 280 audiometric earphone. Hearing thresholds were measured for 25 normal hearing test subjects at the 11 audiometric test frequencies from 125 Hz to 8000 Hz. Sennheiser HDA 280 is a supra-aural earphone that may be seen ...

  3. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  4. Exposure of radio officers to radio frequency radiation on Danish merchant ships.

    Science.gov (United States)

    Skotte, J

    1984-12-01

    Exposure of radio officers to radio frequency radiation from telegraphy and telephony equipment on ships was investigated. Eighty-five measurements were made of 12 radio transmitters operating in the 400 kHz to 25 MHz range (power up to 1200 W) and three VHF telephony transmitters in the 150 MHz band. Field measurements were made at positions normally occupied by radio officers approximately 1 m, 0.5 m and 0.25 m from the antenna feed lines. The distance between the radio operator and the measurement location was at least 0.5 m. The ratio of the electric and magnetic field strength squared (MF and HF transmitters) to ANSI C95.1-1982 radio frequency protection guides ranged from 0.001 to 0.26 (geometric mean 0.02) at the location of the seated radio officer's head. A minimum distance of 0.5 m between antenna feed lines and personnel is recommended. This would normally ensure an exposure below the ANSI safety levels.

  5. Exposure of radio officers to radio frequency radiation on Danish merchant ships

    Energy Technology Data Exchange (ETDEWEB)

    Skotte, J.

    1984-12-01

    Exposure of radio officers to radio frequency radiation from telegraphy and telephony equipment on ships was investigated. Eighty-five measurements were made of 12 radio tranmitters operating in the 400 kHz to 25 MHz range (power up to 1200 W) and three VHF telephony transmitters in the 150 MHz band. Field measurments were made at positions normally occupied by radio officers approximately 1 m, 0.5 m and 0.25 m from the antenna feed lines. The distance between the radio operator and the measurement location was at least 0.5 m. The ratio of the electric and magnetic field strength squared (MF and HF transmitters) to ANSI C95.1-1982 radio frequency protection guides ranged from 0.001 to 0.26 (geometric mean 0.02) at the location of the seated radio officer's head. A minimum distance of 0.5 m between antenna feed lines and personnel is recommended. This would normally ensure an exposure below the ANSI safety levels.

  6. Observations of VHF emissions from 50-mA electron beam injections in the ionosphere that are associated with beam-induced discharges

    Science.gov (United States)

    Goerke, R. T.; Kellogg, P. J.; Monson, S. J.; Franz, R. C.; Nemzek, R. J.; Anderson, H. R.; Potter, D. W.; Denig, W. F.; Szuszczewicz, E. P.; Earle, G. D.

    1992-01-01

    Results are presented of observations of strong VHF plasma waves with amplitudes in excess of 0.1 mV/m (Hz)1/2 associated with 50 mA electron beam injections in the ionosphere. Data from three swept-frequency receivers carried on two daughter payloads are analyzed to determine the emission spectra of the electron beam for various energies and currents. These results were obtained from the rocket-borne experiment SCEX 3, NASA flight 39.002 UE, launched February 1, 1990. The accelerator payload also carried photometers, which measured luminosity at wavelengths of 391.4 and 380.5 nm. Several times during electron gun activity the measured luminosity increased much faster than proportional to the beam current. This nonlinear increase is evidence that a discharge is occurring in the vicinity of the accelerator payload. It is inferred from the uniform distribution of the luminosity around the accelerator payload that the observed discharge extends significantly outside the beam cylinder.

  7. On the dispersion management of fluorite whispering-gallery mode resonators for Kerr optical frequency comb generation in the telecom and mid-infrared range

    CERN Document Server

    Lin, Guoping

    2015-01-01

    Optical whispering gallery mode (WGM) resonators have been very attracting platforms for versatile Kerr frequency comb generations. We report a systematic study on the material dispersion of various optical materials that are capable of supporting quality factors above $10^9$. Using an analytical approximation of WGM resonant frequencies in disk resonators, we investigate the effect of the geometry and transverse mode order on the total group-velocity dispersion ($GVD$). We demonstrate that the major radii and the radial mode indices play an important role in tailoring the $GVD$ of WGM resonators. In particular, our study shows that in WGM disk-resonators, the polar families of modes have very similar $GVD$, while the radial families of modes feature dispersion values that can differ by up to several orders of magnitude. The effect of these giant dispersion shifts are experimentally evidenced in Kerr comb generation with magnesium fluoride. From a more general perspective, this critical feature enables to pus...

  8. Human exposure standards in the frequency range 1 Hz To 100 kHz: the case for adoption of the IEEE standard.

    Science.gov (United States)

    Patrick Reilly, J

    2014-10-01

    Differences between IEEE C95 Standards (C95.6-2002 and C95.1-2005) in the low-frequency (1 Hz-100 kHz) and the ICNIRP-2010 guidelines appear across the frequency spectrum. Factors accounting for lack of convergence include: differences between the IEEE standards and the ICNIRP guidelines with respect to biological induction models, stated objectives, data trail from experimentally derived thresholds through physical and biological principles, selection and justification of safety/reduction factors, use of probability models, compliance standards for the limbs as distinct from the whole body, defined population categories, strategies for central nervous system protection below 20 Hz, and correspondence of environmental electric field limits with contact currents. This paper discusses these factors and makes the case for adoption of the limits in the IEEE standards.

  9. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  10. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  11. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  12. Electromagnetic interference shielding effectiveness of composite carbon nanotube macro-film at a high frequency range of 40 GHz to 60 GHz

    Directory of Open Access Journals (Sweden)

    Zi Ping Wu

    2015-06-01

    Full Text Available The electromagnetic interference (EMI shielding effectiveness (SE of carbon nanotube (CNT macro-film that is adhered to common cloth to maintain the light weight, silk-like quality, and smooth surface of the material for EMI shielding is investigated. The results show that a high and stable EMI SE of 48 dB to 57 dB at 40 GHz to 60 GHz was obtained by the macro-film with a thickness of only ∼4 μm. The composite CNT macro-film is easily manipulated, and its EMI property is significantly different from that of traditional electromagnetic shielding materials that show a lower EMI SE with increasing frequency. For example, the EMI SE of Cu foils decrease from 75 dB to 35 dB as frequency increases from 25 GHz to 60 GHz. Considering their stable and outstanding EMI SE and easy manipulation, the composite CNT macro-films are expected to have potential applications in shielding against millimeter waves.

  13. Effect of the incident power on permittivity, losses and tunability of BaSrTiO3 thin films in the microwave frequency range

    Science.gov (United States)

    Nadaud, Kevin; Borderon, Caroline; Renoud, Raphaël; Ghalem, Areski; Crunteanu, Aurelian; Huitema, Laure; Dumas-Bouchiat, Frédéric; Marchet, Pascal; Champeaux, Corinne; Gundel, Hartmut W.

    2017-05-01

    Domain wall motions in ferroelectrics participate to the material's complex permittivity and are responsible for their sensitivity of the dielectric properties to the driving electric field and thus to the incident power at microwave frequencies. In the present study, the dependence of the permittivity, the dielectric losses, and the tunability of Ba2/3Sr1/3TiO3 (BST) thin films on the incident power and on the bias fields is examined at a frequency of 500 MHz. While the domain wall motion participates only slightly to the permittivity (influences the losses due to its very dissipative behavior. As a consequence, the Figure of Merit (FoM, the ratio between tunability and dielectric losses) of the material depends on the applied microwave power. In the present study, a decrease in the FoM from 29 to 21 is observed for an incident power varying from -20 dBm to 5 dBm. When characterizing ferroelectric materials, the incident power has to be considered; moreover, domain wall motion effects should be limited in order to achieve a high FoM and less power sensitivity.

  14. Millimeter Wave Systems for Airports and Short-Range Aviation Communications: A Survey of the Current Channel Models at mmWave Frequencies

    Science.gov (United States)

    Khatun, Mahfuza; Mehrpouyan, Hani; Matolak, David; Guvenc, Ismail

    2017-01-01

    Millimeter-wave (mmWave) communications will play a key role in enhancing the throughput, reliability, and security of next generation wireless networks. These advancements are achieved through the large bandwidth available in this band and through the use of highly directional links that will be used to overcome the large pathloss at these frequencies. Although the terrestrial application of mmWave systems is advancing at a rapid pace, the use of mmWave communication systems in aviation systems or airports is still in its infancy. This can be attributed to the challenges related to radio technology and lack of development, and characterization of mmWave wireless channels for the aviation field and the airport environment. Consequently, one of our goals is to develop methodologies that support mmWave air to ground links, and various links at airports, by applying new localization schemes that allow for application of highly directional links that can be deployed over longer distances despite the high path loss at mmWave frequencies. However, a very thorough understanding of the mmWave channel models are needed to enable such new applications. To this end, in this paper, we present a survey of the current channel models in the mmWave band. The 3-dimensional statistical channel model is also reviewed and its parameters and typical characteristics for this model are identified and computed through simulation for the Boise metropolitan area.

  15. Antennas for VHF/UHF personal radio: A theoretical and experimental study of characteristics and performance

    DEFF Research Database (Denmark)

    Andersen, Jørgen Bach; Hansen, Flemming

    1977-01-01

    A theoretical analysis of the characteristics of small personal radio antennas for the 68- to 470-MHz frequency range is given. Representing the human body by a simplified lossy dielectric structure, the influence of the body on the performance of the antenna is investigated in detail...... to efficiency and radiation patterns at 80, 160, and 450 MHz, and it is demonstrated how the physical length of the antenna affects the antenna performance. The design of a very short and compact personal radio antenna is described....

  16. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  17. On a simple attack, limiting the range transmission of secret keys in a system of quantum cryptography based on coding in a sub-carrier frequency

    Science.gov (United States)

    Klimov, A. N.; Kulik, S. P.; Molotkov, S. N.; Potapova, T. A.

    2017-03-01

    In the paper by Gleim et al (2016 Opt. Express 24 2619), it was declared that the system of quantum cryptography, exploiting quantum key distribution (QKD) protocol BB84 with the additional reference state and encoding in a sub-carrier, is able to distribute secret keys at a distance of 210 km. The following shows that a simple attack realized with a beam splitter results in a loss of privacy of the keys over substantially smaller distances. It turns out that the actual length of the secret key transmission for the QKD system encoding in the sub-carrier frequency is ten times less than that declared in Gleim et al (2016 Opt. Express 24 2619). Therefore it is impossible to safely use the keys when distributed at a larger length of the communication channel than shown below. The maximum communication distance does not exceed 22 km, even in the most optimistic scenario.

  18. A new ion cyclotron range of frequency scenario for bulk ion heating in deuterium-tritium plasmas: How to utilize intrinsic impurities in our favour

    Energy Technology Data Exchange (ETDEWEB)

    Kazakov, Ye. O.; Ongena, J.; Van Eester, D.; Lerche, E.; Messiaen, A. [Laboratory for Plasma Physics, LPP-ERM/KMS, EUROfusion Consortium Member, Brussels (Belgium); Bilato, R. [Max-Planck-Institut für Plasmaphysik, Garching (Germany); Dumont, R. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Mantsinen, M. [Catalan Institution for Research and Advanced Studies, Barcelona (Spain); Barcelona Supercomputing Center (BSC), Barcelona (Spain)

    2015-08-15

    A fusion reactor requires plasma pre-heating before the rate of deuterium-tritium fusion reactions becomes significant. In ITER, radio frequency (RF) heating of {sup 3}He ions, additionally puffed into the plasma, is one of the main options considered for increasing bulk ion temperature during the ramp-up phase of the pulse. In this paper, we propose an alternative scenario for bulk ion heating with RF waves, which requires no extra {sup 3}He puff and profits from the presence of intrinsic Beryllium impurities in the plasma. The discussed method to heat Be impurities in D-T plasmas is shown to provide an even larger fraction of fuel ion heating.

  19. A high-efficiency low-voltage class-E PA for IoT applications in sub-1 GHz frequency range

    Science.gov (United States)

    Zhou, Chenyi; Lu, Zhenghao; Gu, Jiangmin; Yu, Xiaopeng

    2017-10-01

    We present and propose a complete and iterative integrated-circuit and electro-magnetic (EM) co-design methodology and procedure for a low-voltage sub-1 GHz class-E PA. The presented class-E PA consists of the on-chip power transistor, the on-chip gate driving circuits, the off-chip tunable LC load network and the off-chip LC ladder low pass filter. The design methodology includes an explicit design equation based circuit components values' analysis and numerical derivation, output power targeted transistor size and low pass filter design, and power efficiency oriented design optimization. The proposed design procedure includes the power efficiency oriented LC network tuning, the detailed circuit/EM co-simulation plan on integrated circuit level, package level and PCB level to ensure an accurate simulation to measurement match and first pass design success. The proposed PA is targeted to achieve more than 15 dBm output power delivery and 40% power efficiency at 433 MHz frequency band with 1.5 V low voltage supply. The LC load network is designed to be off-chip for the purpose of easy tuning and optimization. The same circuit can be extended to all sub-1 GHz applications with the same tuning and optimization on the load network at different frequencies. The amplifier is implemented in 0.13 μm CMOS technology with a core area occupation of 400 μm by 300 μm. Measurement results showed that it provided power delivery of 16.42 dBm at antenna with efficiency of 40.6%. A harmonics suppression of 44 dBc is achieved, making it suitable for massive deployment of IoT devices. Project supported by the National Natural Science Foundation of China (No. 61574125) and the Industry Innovation Project of Suzhou City of China (No. SYG201641).

  20. Intrinsic vs. spurious long-range memory in high-frequency records of environmental radioactivity - Critical re-assessment and application to indoor 222Rn concentrations from Coimbra, Portugal

    Science.gov (United States)

    Donner, Reik V.; Potirakis, Stelios M.; Barbosa, Susana M.; Matos, Jose A. O.

    2015-04-01

    The presence or absence of long-range correlations in environmental radioactivity fluctuations has recently attracted considerable interest. Among a multiplicity of practically relevant applications, identifying and disentangling the environmental factors controlling the variable concentrations of the radioactive noble gas Radon is important for estimating its effect on human health and the efficiency of possible measures for reducing the corresponding exposition. In this work, we present a critical re-assessment of a multiplicity of complementary methods that have been previously applied for evaluating the presence of long-range correlations and fractal scaling in environmental Radon variations with a particular focus on the specific properties of the underlying time series. As an illustrative case study, we subsequently re-analyze two high-frequency records of indoor Radon concentrations from Coimbra, Portugal, each of which spans several months of continuous measurements at a high temporal resolution of five minutes. Our results reveal that at the study site, Radon concentrations exhibit complex multi-scale dynamics with qualitatively different properties at different time-scales: (i) essentially white noise in the high-frequency part (up to time-scales of about one hour), (ii) spurious indications of a non-stationary, apparently long-range correlated process (at time scales between hours and one day) arising from marked periodic components probably related to tidal frequencies, and (iii) low-frequency variability indicating a true long-range dependent process, which might be dominated by a response to meteorological drivers. In the presence of such multi-scale variability, common estimators of long-range memory in time series are necessarily prone to fail if applied to the raw data without previous separation of time-scales with qualitatively different dynamics. We emphasize that similar properties can be found in other types of geophysical time series (for

  1. A 400-mV 2.4-GHz frequency-shift keying transmitter using a capacitor switch across a transformer for a wide tuning range voltage-controlled oscillator

    Science.gov (United States)

    Miyahara, Yasunori; Ishikawa, Keisuke; Kuroda, Tadahiro

    2017-04-01

    We use a simple directly modulated closed loop to develop a 2.1-mW, 2.4-GHz frequency-shift keying (FSK) transmitter that operates on 400-mV DC supply. Connecting a capacitor bank switch via a transformer in the voltage control oscillator (VCO) to the frequency-divider circuit expands the frequency tuning range without reducing VCO performance. A prototype was fabricated using the 65-nm standard CMOS process with a chip size of 1.65 × 1.85 mm2. A modulation output signal spectrum of -42 dBc at 1.5 MHz with -6 dBm at the PA buffer output terminal; moreover, a VCO phase noise of -101 dBc/Hz at 1 MHz is achieved. The FSK transmitter can readily use voltages supplied by harvested energy because of the low power consumption of the sensor network.

  2. Fundamental processes of fuel removal by cyclotron frequency range plasmas and integral scenario for fusion application studied with carbon co-deposits

    Energy Technology Data Exchange (ETDEWEB)

    Möller, S., E-mail: s.moeller@fz-juelich.de [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung – Plasmaphysik, Partner of the Trilateral Euregio Cluster (TEC), 52425 Jülich (Germany); Wauters, T. [Laboratory for Plasma Physics, ERM/KMS, TEC Partner, 1000 Brussels (Belgium); Kreter, A. [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung – Plasmaphysik, Partner of the Trilateral Euregio Cluster (TEC), 52425 Jülich (Germany); Petersson, P.; Carrasco, A.G. [Fusion Plasma Physics, KTH Royal Institute of Technology, Teknikringen 31, 10044 Stockholm (Sweden)

    2015-08-15

    Plasma impact removal using radio frequency heated plasmas is a candidate method to control the co-deposit related tritium inventory in fusion devices. Plasma parameters evolve according to the balance of input power to losses (transport, radiation, collisions). Material is sputtered by the ion fluxes with impact energies defined by the plasma sheath. H{sub 2}, D{sub 2} and {sup 18}O{sub 2} plasmas are produced in the carbon limiter tokamak TEXTOR. Pre-characterised a-C:D layers are exposed to study local removal rates. The D{sub 2} plasma exhibits the highest surface release rate of 5.7 ± 0.9 ∗ 10{sup 19} D/m{sup 2}s. Compared to this the rate of the O{sub 2} plasma is 3-fold smaller due to its 11-fold lower ion flux density. Re-deposition of removed carbon is observed, indicating that pumping and ionisation are limiting the removal in TEXTOR. Presented models can explain the observations and allow tailoring removal discharges. An integral application scenario using ICWC and thermo-chemical removal is presented, allowing to remove 700 g T from a-C:DT co-deposits in 20 h with fusion compatible wall conditions using technical specifications similar to ITER.

  3. Reduced-order computational model in nonlinear structural dynamics for structures having numerous local elastic modes in the low-frequency range. Application to fuel assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Batou, A., E-mail: anas.batou@univ-paris-est.fr [Université Paris-Est, Laboratoire Modélisation et Simulation Multi Echelle, MSME UMR 8208 CNRS, 5 bd Descartes, 77454 Marne-la-Vallee (France); Soize, C., E-mail: christian.soize@univ-paris-est.fr [Université Paris-Est, Laboratoire Modélisation et Simulation Multi Echelle, MSME UMR 8208 CNRS, 5 bd Descartes, 77454 Marne-la-Vallee (France); Brie, N., E-mail: nicolas.brie@edf.fr [EDF R and D, Département AMA, 1 avenue du général De Gaulle, 92140 Clamart (France)

    2013-09-15

    Highlights: • A ROM of a nonlinear dynamical structure is built with a global displacements basis. • The reduced order model of fuel assemblies is accurate and of very small size. • The shocks between grids of a row of seven fuel assemblies are computed. -- Abstract: We are interested in the construction of a reduced-order computational model for nonlinear complex dynamical structures which are characterized by the presence of numerous local elastic modes in the low-frequency band. This high modal density makes the use of the classical modal analysis method not suitable. Therefore the reduced-order computational model is constructed using a basis of a space of global displacements, which is constructed a priori and which allows the nonlinear dynamical response of the structure observed on the stiff part to be predicted with a good accuracy. The methodology is applied to a complex industrial structure which is made up of a row of seven fuel assemblies with possibility of collisions between grids and which is submitted to a seismic loading.

  4. Electronic spectrum in the visible frequency range of UF/sub 4/ molecules isolated in solid neon, and its interpretation in the crystal-field approximation

    Energy Technology Data Exchange (ETDEWEB)

    Belyaeva, A.A.; Golubev, Y.M.

    1987-09-01

    The matrix isolation method is used to obtain the spectra of molecules in solid neon in the 1000--400-nm range. All the recorded bands are referred to transitions within the 5f /sup 2/ configuration of U/sup 4 +/ ion in the field of four fluorine ions. The interpretation assumes the case of a weak crystal field in which the terms of U/sup 4 +/ ion with different J are not mixed up. It is concluded that the UF/sub 3/ molecule has the structure of either a tetrahedron or a slightly distorted tetrahedron.

  5. The Kepler Mission: A Mission to Determine the Frequency of Inner Planets Neat the Habitable Zone of a Wide Range of Stars

    Science.gov (United States)

    Borucki, W. J.; Koch, D. G.; Dunham, E. W.; Jenkins, J. M.; Young, Richard E. (Technical Monitor)

    1997-01-01

    The surprising discovery of giant planets in inner orbits around solar-like stars has brought into question our understanding of the development and evolution of planetary systems, including our solar system. To make further progress, it is critical to detect and obtain data on the frequency and characteristics of Earth-class planets. The Kepler Mission is designed to be a quick, low-cost approach to accomplish that objective. Transits by Earth-class planets produce a fractional change in stellar brightness of 5 x 10(exp -5) to 40 x 10(exp -5) lasting for 4 to 16 hours, From the period and depth of the transits, the orbit and size of the planets can be calculated. The proposed instrument is a one-meter aperture photometer with a 12 deg field-of-view (FOV). To obtain the required precision and to avoid interruptions caused by day-night and seasonal cycles, the photometer will be launched into a heliocentric orbit. It will continuously and simultaneously monitor the flux from 80,000 dwarf stars brighter than 14th magnitude in the Cygnus constellation. The mission tests the hypothesis that the formation of most stars produces Earth-class planets in inner orbits. Based on this assumption and the recent observations that 2% of the stars have giant planets in inner orbits, several types of results are expected from the mission: 1. From transits of Earth-class planets, about 480 planet detections and 60 cases where two or more planets are found in the same system. 2. From transits of giant planets, about 160 detections of inner-orbit planets and 24 detections of outer-orbit planets. 3. From the phase modulation of the reflected light from giant planets, about 1400 planet detections with periods less than a week, albedos for 160 of these giant planets, and densities for seven planets.

  6. The Kepler Mission: A Mission to Determine the Frequency of Inner Planets Near the Habitable Zone of a Wide Range of Stars

    Science.gov (United States)

    Borucki, W. J.; Koch, D. G.; Dunham, E. W.; Jenkins, J. M.

    1997-01-01

    The surprising discovery of giant planets in inner orbits around solar-like stars has brought into question our understanding of the development and evolution of planetary systems, including our solar system. To make further progress, it is critical to detect and obtain data on the frequency and characteristics of Earth-class planets. The Kepler Mission is designed to be a quick, low-cost approach to accomplish that objective. Transits by Earth-class planets produce a fractional change. in stellar brightness of 5 x 10(exp -5) to 40 x 10(exp -5) lasting for 4 to 16 hours. From the period and depth of the transits, the orbit and size of the planets can be calculated. The proposed instrument is a one-meter aperture photometer with a 12 deg. field-of-view (FOV). To obtain the required precision and to avoid interruptions caused by day-night and seasonal cycles, the photometer will be launched into a heliocentric orbit. It will continuously and simultaneously monitor the flux from 80,000 dwarf stars brighter than 14th magnitude in the Cygnus constellation. The mission tests the hypothesis that the formation of most stars produces Earth-class planets in inner orbits. Based on this assumption and the recent observations that 2% of the stars have giant planets in inner orbits, several types of results are expected from the mission: 1. From transits of Earth-class planets, about 480 planet detections and 60 cases where two or more planets are found in the same system. 2. From transits of giant planets, about 160 detections of inner-orbit planets and 24 detections of outer-orbit planets. 3. From the phase modulation of the reflected light from giant planets, about 1400 planet detections with periods less than a week, albedos for 160 of these giant planets, and densities for seven planets.

  7. Feature extraction of micro-motion frequency and the maximum wobble angle in a small range of missile warhead based on micro-Doppler effect

    Science.gov (United States)

    Li, M.; Jiang, Y. S.

    2014-11-01

    Micro-Doppler effect is induced by the micro-motion dynamics of the radar target itself or any structure on the target. In this paper, a simplified cone-shaped model for ballistic missile warhead with micro-nutation is established, followed by the theoretical formula of micro-nutation is derived. It is confirmed that the theoretical results are identical to simulation results by using short-time Fourier transform. Then we propose a new method for nutation period extraction via signature maximum energy fitting based on empirical mode decomposition and short-time Fourier transform. The maximum wobble angle is also extracted by distance approximate approach in a small range of wobble angle, which is combined with the maximum likelihood estimation. By the simulation studies, it is shown that these two feature extraction methods are both valid even with low signal-to-noise ratio.

  8. Development and numerical characterization of a new standing wave ultrasonic motor operating in the 30-40kHz frequency range.

    Science.gov (United States)

    Hou, Xiaoyan; Lee, Heow Pueh; Ong, Chong Jin; Lim, Siak Piang

    2013-07-01

    The purpose of this research is to present a new design of standing-wave ultrasonic motor. This motor uses three piezoelectric actuating blocks which deform appropriately when powered up. The deformations of the blocks in ultrasonic range are internally amplified via the design of the motor by about 80 times and collectively yield an elliptical trajectory for the driving head of the motor. Finite Element Analysis using ANSYS was performed for both dynamic analysis and optimization of a prototype motor. The numerical results verified that at steady state, the motor can achieve vibrations in micro-meter level and the velocity can reach decimeter scale, satisfying the fast speed requirement as a positioning actuator. Copyright © 2012 Elsevier B.V. All rights reserved.

  9. Alpine lakes preserve mineral dust signatures: Implications for long-range mineral dust transport and Last Glacial Maximum (LGM) tornado frequency in the United States

    Science.gov (United States)

    Bhattacharya, A.; Lora, J. M.; Pollen, A.; Vollmer, T.; Thomas, M.; Leithold, E. L.; Mitchell, J.; Tripati, A.

    2016-12-01

    contribution. Most importantly, we find that during the Last Glacial Maximum (LGM) the Great Plains may not have witnessed an increase in the incidence of tornado frequency. Acknowledgements: James Sigman, Jacob Ashford, Jason Neff and Amato Evan

  10. Intrinsic vs. spurious long-range memory in high-frequency records of environmental radioactivity. Critical re-assessment and application to indoor 222Rn concentrations from Coimbra, Portugal

    Science.gov (United States)

    Donner, R. V.; Potirakis, S. M.; Barbosa, S. M.; Matos, J. A. O.; Pereira, A. J. S. C.; Neves, L. J. P. F.

    2015-05-01

    The presence or absence of long-range correlations in the environmental radioactivity fluctuations has recently attracted considerable interest. Among a multiplicity of practically relevant applications, identifying and disentangling the environmental factors controlling the variable concentrations of the radioactive noble gas radon is important for estimating its effect on human health and the efficiency of possible measures for reducing the corresponding exposition. In this work, we present a critical re-assessment of a multiplicity of complementary methods that have been previously applied for evaluating the presence of long-range correlations and fractal scaling in environmental radon variations with a particular focus on the specific properties of the underlying time series. As an illustrative case study, we subsequently re-analyze two high-frequency records of indoor radon concentrations from Coimbra, Portugal, each of which spans several weeks of continuous measurements at a high temporal resolution of five minutes.Our results reveal that at the study site, radon concentrations exhibit complex multi-scale dynamics with qualitatively different properties at different time-scales: (i) essentially white noise in the high-frequency part (up to time-scales of about one hour), (ii) spurious indications of a non-stationary, apparently long-range correlated process (at time scales between some hours and one day) arising from marked periodic components, and (iii) low-frequency variability indicating a true long-range dependent process. In the presence of such multi-scale variability, common estimators of long-range memory in time series are prone to fail if applied to the raw data without previous separation of time-scales with qualitatively different dynamics.

  11. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  12. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  13. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  14. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  15. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  16. Delivering Microwave Spectroscopy to the Masses: a Design of a Low-Cost Microwave Spectrometer Operating in the 18-26 GHZ Frequency Range

    Science.gov (United States)

    Steber, Amanda; Pate, Brooks

    2014-06-01

    Advances in chip-level microwave technology in the communications field have led to the possibilities of low cost alternatives for current Fourier transform microwave (FTMW) spectrometers. Many of the large, expensive microwave components in a traditional design can now be replaced by robust, mass market monolithic microwave integrated circuits (MMICs). "Spectrometer on a board" designs are now feasible that offer dramatic cost reduction for microwave spectroscopy. These chip-level components can be paired with miniature computers to produce compact instruments that are operable through USB. A FTMW spectrometer design using the key MMIC components that drive cost reduction will be presented. Two dual channel synthesizers (Valon Technology Model 5008), a digital pattern generator (Byte Paradigm Wav Gen Xpress), and a high-speed digitizer/arbitrary waveform generator combination unit (Tie Pie HS-5 530 XM) form the key components of the spectrometer for operation in the 18-26.5 GHz range. The design performance is illustrated using a spectrometer that is being incorporated into a museum display for astrochemistry. For this instrument a user interface, developed in Python, has been developed and will be shown.

  17. A comparison of overshoot modelling with observations of polar mesospheric summer echoes at radar frequencies of 56 and 224 MHz

    Science.gov (United States)

    Havnes, O.; Pinedo, H.; La Hoz, C.; Senior, A.; Hartquist, T. W.; Rietveld, M. T.; Kosch, M. J.

    2015-06-01

    We have compared radar observations of polar mesospheric summer echoes (PMSEs) modulated by artificial electron heating, at frequencies of 224 MHz (EISCAT VHF) and 56 MHz (MORRO). We have concentrated on 1 day of observation, lasting ~ 3.8 h. The MORRO radar, with its much wider beam, observes one or more PMSE layers all the time while the VHF radar observes PMSEs in 69% of the time. Statistically there is a clear difference between how the MORRO and the VHF radar backscatter reacts to the heater cycling (48 s heater on and 168 s heater off). While MORRO often reacts by having its backscatter level increased when the heater is switched on, as predicted by Scales and Chen (2008), the VHF radar nearly always sees the "normal" VHF overshoot behaviour with an initial rapid reduction of backscatter. However, in some heater cycles we do see a substantial recovery of the VHF backscatter after its initial reduction to levels several times above that just before the heater was switched on. For the MORRO radar a recovery during the heater-on phase is much more common. The reaction when the heater was switched off was a clear overshoot for nearly all VHF cases but less so for MORRO. A comparison of individual curves for the backscatter values as a function of time shows, at least for this particular day, that in high layers above ~ 85 km height, both radars see a reduction of the backscatter as the heater is switched on, with little recovery during the heater-on time. These variations are well described by present models. On the other hand, the backscatter in low layers at 81-82 km can be quite different, with modest or no reduction in backscatter as the heater is switched on, followed by a strong recovery for both radars to levels several times above that of the undisturbed PMSEs. This simultaneous, nearly identical behaviour at the two very different radar frequencies is not well described by present modelling.

  18. A comparison of overshoot modelling with observations of polar mesospheric summer echoes at radar frequencies of 56 and 224 MHz

    Directory of Open Access Journals (Sweden)

    O. Havnes

    2015-06-01

    Full Text Available We have compared radar observations of polar mesospheric summer echoes (PMSEs modulated by artificial electron heating, at frequencies of 224 MHz (EISCAT VHF and 56 MHz (MORRO. We have concentrated on 1 day of observation, lasting ~ 3.8 h. The MORRO radar, with its much wider beam, observes one or more PMSE layers all the time while the VHF radar observes PMSEs in 69% of the time. Statistically there is a clear difference between how the MORRO and the VHF radar backscatter reacts to the heater cycling (48 s heater on and 168 s heater off. While MORRO often reacts by having its backscatter level increased when the heater is switched on, as predicted by Scales and Chen (2008, the VHF radar nearly always sees the "normal" VHF overshoot behaviour with an initial rapid reduction of backscatter. However, in some heater cycles we do see a substantial recovery of the VHF backscatter after its initial reduction to levels several times above that just before the heater was switched on. For the MORRO radar a recovery during the heater-on phase is much more common. The reaction when the heater was switched off was a clear overshoot for nearly all VHF cases but less so for MORRO. A comparison of individual curves for the backscatter values as a function of time shows, at least for this particular day, that in high layers above ~ 85 km height, both radars see a reduction of the backscatter as the heater is switched on, with little recovery during the heater-on time. These variations are well described by present models. On the other hand, the backscatter in low layers at 81–82 km can be quite different, with modest or no reduction in backscatter as the heater is switched on, followed by a strong recovery for both radars to levels several times above that of the undisturbed PMSEs. This simultaneous, nearly identical behaviour at the two very different radar frequencies is not well described by present modelling.

  19. c-Axis zig-zag ZnO film ultrasonic transducers for designing longitudinal and shear wave resonant frequencies and modes.

    Science.gov (United States)

    Yanagitani, Takahiko; Morisato, Naoki; Takayanagi, Shinji; Matsukawa, Mami; Watanabe, Yoshiaki

    2011-05-01

    A method for designing frequencies and modes in ultrasonic transducers above the very-high-frequency (VHF) range is required for ultrasonic non-destructive evaluation and acoustic mass sensors. To obtain the desired longitudinal and shear wave conversion loss characteristics in the transducer, we propose the use of a c-axis zig-zag structure consisting of multilayered c-axis 23° tilted ZnO piezoelectric films. In this structure, every layer has the same thickness, and the c-axis tilt directions in odd and even layers are symmetric with respect to the film surface normal. c-axis zig-zag crystal growth was achieved by using a SiO(2) low-temperature buffer layer. The frequency characteristics of the multilayered transducer were predicted using a transmission line model based on Mason's equivalent circuit. We experimentally demonstrated two types of transducers: those exciting longitudinal and shear waves simultaneously at the same frequency, and those exciting shear waves with suppressed longitudinal waves.

  20. Heat flux and thermal conduction in O+ and H+ ion flows deduced from EISCAT-VHF radar observations in the high-latitude topside ionosphere

    Science.gov (United States)

    Wu, Jian; Taieb, Charley

    1994-06-01

    With two periods of EISCAT-VHF radar observations, magnetically quiet and moderately disturbed, we have calculated the H+ and O+ heat fluxes in using formulae of Wu and Taieb (1993), accounting not only for temperature gradients but also for pressure gradients, velocity gradients, and diffusion-thermal effects. They correspond to different physical processes that are calculated and compared between them. Then, the general features of the H+ and O+ ion thermal conductions are studied during the two periods of observation in the high-latitude topside ionosphere. The analysis of the two periods of measurements revealed the following trends, to be confirmed by further observations: (1) During the two periods the H+ heat flux Q2 is always upward in the altitude range from 600 km up to about 1000 km. It is larger during the quiet period than during the disturbed period. (2) The most important dominant mechanism for H+ heat flux is the diffusion-thermal effect due to the H+-O+ collision, with a correcting term due to the H+ temperature gradient. (3) The O+ heat flux is always downward in the same altitude range during the two periods of observations. The absolute value during the disturbed period is slightly larger than that during the quiet period. (4) The dominant mechanism for O+ heat flux is its temperature gradient, corrected by the coupling with the H+ ion. (5) The O+ thermal conduction is less important during the quiet period than during the disturbed period, while for the H+ thermal conduction it is the contrary. (6) The H+ thermal conduction increases with altitude below about 1000 km.

  1. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  2. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  3. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  4. Radio Frequency Ranging for Swarm Relative Localization

    Science.gov (United States)

    2017-10-01

    Path Loss GPS Global Positioning System ID identification IDE integrated development environment IO input/output ISM industrial, scientific, and...information. This is particularly important in GPS-denied environments where there are limited positioning options. Many applications exist for relative...4 Fig. 3 Atmel sampling rate tests results .......................................................... 6 Fig. 4 Zoomed medium and slow

  5. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  6. A Low Power RC-Coupled VHF Amplifier Designed for Fabrication by Hybrid Microcircuit Techniques.

    Science.gov (United States)

    RADIOFREQUENCY AMPLIFIERS, HYBRID CIRCUITS, MICROMINIATURIZATION , VERY HIGH FREQUENCY, MODULES(ELECTRONICS), TRANSISTOR AMPLIFIERS, RADIO RECEIVERS, COMMUNICATION EQUIPMENT, SATELLITE COMMUNICATIONS.

  7. Equivalent magnetic noise reduction at high frequency range due to polarized direction optimization in Terfenol-D/Pb(Mg1/3Nb2/3)O3-PbTiO3 magnetoelectric laminate sensors

    Science.gov (United States)

    Fang, Cong; Ma, Jiashuai; Yao, Meng; Di, Wenning; Lin, Di; Xu, Haiqing; Wang, Wei; Luo, Haosu

    2017-02-01

    In this paper, we investigate the responsivities and output voltage noise power spectral densities of magnetoelectric (ME) laminate sensors, consisting of length magnetized Terfenol-D alloys and transverse/width poled Pb(Mg1/3Nb2/3)O3-PbTiO3 (PMNT) crystals (i.e. L-T mode and L-W mode respectively), which are directly integrated with custom-build low noise charge amplifier circuits. Both the theoretical analyses and experimental results prove that the L-W mode sensor with the optimized polarized direction of the PMNT plate possesses lower magnetic detection limit at the interested high frequency range of 10 kHz≤f≤50 kHz. The equivalent magnetic noise (EMN) of the L-W mode sensor is 0.78 pT/Hz1/2 at 30 kHz, which is about 1.7 times lower than the 1.35 pT/Hz1/2 for conventional L-T mode sensor. Furthermore, an effective method of using operational amplifiers with low equivalent input noise voltage and employing ME laminate composites with high voltage coefficient to reduce the EMNs of the ME laminate sensors at high frequency range has been established.

  8. High-frequency ultrasonographic imaging of the endothelium-dependent flow-mediated dilatation (FMD) in a brachial artery: normative ranges in a group of low CV risk subjects of different ages.

    Science.gov (United States)

    Ryliskyte, Ligita; Ghiadoni, Lorenzo; Plantinga, Yvonne; Janaviciene, Silvija; Petrulioniene, Zaneta; Laucevicius, Aleksandras; Gintautas, Jonas

    2004-01-01

    High-frequency ultrasonographic imaging of flow-mediated dilatation (FMD) in a brachial artery, as non-invasive technique, was used for the clinical evaluation of endothelial function (EF) in 115 subjects (ages 44.19+/-12.23 (26 to 83) free of coronary heart disease or its equivalents. Our aim was to study the normative ranges for FMD in subjects of different age groups with low cardiovascular risk factors. The mean FMD was 8.23+/-4.51% (0 to 20.9). Multivariate analysis revealed that there were only two independent predictors of FMD: resting vessel diameter (r = -0.45, pFMD = 25.5-0.17 x age-2.6 x resting vessel diameter. Our study demonstrates that FMD in low cardiovascular risk patients inversely correlates with age as well as brachial artery diameter. Normative ranges of FMD could be predicted for different age groups. In addition to conventional methods for the assessment of cardiovascular risk by using a population-based approach (score indexes such as SCORE, FRAMINGH, PROCAM), high-frequency ultrasonographic imaging of flow-mediated dilatation (FMD) in the brachial artery is now becoming an accepted method for the assessment of an individual patient's cardiovascular risk. Although preliminary guidelines have been published, this technique has interpretive limitations. In a study that was published earlier, the authors estimated diameter-related normal ranges of FMD. Several articles reported cut points between control and diseased groups. Data about the impact of age on FMD are also available in the literature. However, this is the first attempt to classify normal values into groups according to age and diameter.

  9. A discussion on the variations of MST/ST radar echo power with an atmospheric layer resolved by frequency domain interferometry technique

    Science.gov (United States)

    Chen, J. S.; Chu, Y. H.

    2000-11-01

    The relationship between an atmospheric layer and its VHF backscatter resolved by the frequency domain interferometry (FDI) technique is investigated in this article. A theoretical expression connecting the radar echo power with the thickness and position of an atmospheric layer and the range weighting function of a matched filter is derived. It shows that the farther the layer locates from the central height of the radar volume, the weaker the echo power will be. This feature is attributed to the range weighting effect of the radar system. FDI observations also show that the echo power from the atmospheric layer located close to the central height of the radar volume is usually greater than that from the layer located at the edge of the volume, which is in good agreement with the theoretical prediction. Moreover, the correlation between the echo power and layer position is negative (positive) if the layer locates in the upper (lower) part of the radar volume. This behavior is consistent with the theoretical prediction and can also be interpreted by the range weighting effect. It is also suggested that the power-position relation is capable of indicating the system bias causing the systematic error of FDI-estimated layer position. In addition, numerical simulation is performed in this article to examine the difference between the range weighting functions resulting from rectangular and nonrectangular radar pulses for a given receiver impulse response.

  10. Multi-frequency excitation

    KAUST Repository

    Younis, Mohammad I.

    2016-03-10

    Embodiments of multi-frequency excitation are described. In various embodiments, a natural frequency of a device may be determined. In turn, a first voltage amplitude and first fixed frequency of a first source of excitation can be selected for the device based on the natural frequency. Additionally, a second voltage amplitude of a second source of excitation can be selected for the device, and the first and second sources of excitation can be applied to the device. After applying the first and second sources of excitation, a frequency of the second source of excitation can be swept. Using the methods of multi- frequency excitation described herein, new operating frequencies, operating frequency ranges, resonance frequencies, resonance frequency ranges, and/or resonance responses can be achieved for devices and systems.

  11. The specific absorption rate of tissues in rats exposed to electromagnetic plane waves in the frequency range of 0.05-5 GHz and SARwb in free-moving rats.

    Science.gov (United States)

    Chen, Bingxin; Wang, Jiamin; Qi, Hongxin; Zhang, Jie; Chen, Shude; Wang, Xianghui

    2017-03-01

    As electromagnetic exposure experiments can only be performed on small animals, usually rats, research on the characteristics of specific absorption rate (SAR) distribution in the rat has received increasing interest. A series of calculations, which simulated the SAR in a male rat anatomical model exposed to electromagnetic plane waves ranging from 0.05 to 5 GHz with different incidence and polarization, were conducted. The whole-body-averaged SAR (SARwb) and the tissue-averaged SAR (SARavg) in 20 major tissues were determined. Results revealed that incidence has great impact on SAR in the rat at higher frequencies owing to the skin effect and the effect on SARavg in tissues is much more apparent than that on SARwb; while polarization plays an important role under lower frequencies. Not only the incidence, but also the polarization in the rat keeps changing when the rat is in free movement. Thus, this article discussed a convenient way to obtain relatively accurate SARwb in a free-moving rat.

  12. Proposal and verification numerical simulation for a microwave forward scattering technique at upper hybrid resonance for the measurement of electron gyroscale density fluctuations in the electron cyclotron frequency range in magnetized plasmas

    Science.gov (United States)

    Kawamori, E.; Igami, H.

    2017-11-01

    A diagnostic technique for detecting the wave numbers of electron density fluctuations at electron gyro-scales in an electron cyclotron frequency range is proposed, and the validity of the idea is checked by means of a particle-in-cell (PIC) numerical simulation. The technique is a modified version of the scattering technique invented by Novik et al. [Plasma Phys. Controlled Fusion 36, 357-381 (1994)] and Gusakov et al., [Plasma Phys. Controlled Fusion 41, 899-912 (1999)]. The novel method adopts forward scattering of injected extraordinary probe waves at the upper hybrid resonance layer instead of the backward-scattering adopted by the original method, enabling the measurement of the wave-numbers of the fine scale density fluctuations in the electron-cyclotron frequency band by means of phase measurement of the scattered waves. The verification numerical simulation with the PIC method shows that the technique has a potential to be applicable to the detection of electron gyro-scale fluctuations in laboratory plasmas if the upper-hybrid resonance layer is accessible to the probe wave. The technique is a suitable means to detect electron Bernstein waves excited via linear mode conversion from electromagnetic waves in torus plasma experiments. Through the numerical simulations, some problems that remain to be resolved are revealed, which include the influence of nonlinear processes such as the parametric decay instability of the probe wave in the scattering process, and so on.

  13. Wrist range of motion and motion frequency during toy and game play with a joint-specific controller specially designed to provide neuromuscular therapy: A proof of concept study in typically developing children.

    Science.gov (United States)

    Crisco, Joseph J; Schwartz, Joel B; Wilcox, Bethany; Brideau, Holly; Basseches, Benjamin; Kerman, Karen

    2015-08-20

    Upper extremities affected by hemiplegic cerebral palsy (CP) and other neuromuscular disorders have been demonstrated to benefit from therapy, and the greater the duration of the therapy, the greater the benefit. A great motivator for participating in and extending the duration of therapy with children is play. Our focus is on active motion therapy of the wrist and forearm. In this study we examine the wrist motions associated with playing with two toys and three computer games controlled by a specially-designed play controller. Twenty children (ages 5-11) with no diagnosis of a muscular disorder were recruited. The play controller was fitted to the wrist and forearm of each child and used to measure and log wrist flexion and extension. Play activity and enjoyment were quantified by average wrist range of motion (ROM), motion frequency measures, and a discrete visual scale. We found significant differences in the average wrist ROM and motion frequency among the toys and games, yet there were no differences in the level of enjoyment across all toys and games, which was high. These findings indicate which toys and games may elicit the greater number of goal-directed movements, and lay the foundation for our long-term goal to develop and evaluate innovative motion-specific play controllers that are engaging rehabilitative devices for enhancing therapy and promoting neural plasticity and functional recovery in children with CP. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  15. Final report of key comparison AFRIMETS.AUV.A-K5: primary pressure calibration of LS1P microphones according to IEC 61094-2, over the frequency range 2 Hz to 10 kHz.

    Science.gov (United States)

    Nel, R.; Avison, J.; Harris, P.; Blabla, M.; Hämäläinen, J.

    2017-01-01

    The degrees of equivalence of the AFRIMETS.AUV.A-K5 regional key comparison are reported here as the final report. The scope of the comparison covered the complex pressure sensitivities of two LS1P microphones over the frequency range 2 Hz to 10 kHz in accordance with IEC 61094-2: 2009. Four national metrology institutes from two different regional metrology organisations participated in the comparison. Two LS1P microphones were circulated simultaneously to all the participants in a circular configuration. One of the microphones sensitivity shifted and all results associated with this microphone were subsequently excluded from further analysis and linking. The AFRIMETS.AUV.A-K5 comparison results were linked to the CCAUV.A-K5 comparison results via dual participation in the CCAUV.A-K5 and AFRIMETS.AUV.A-K5 comparisons. The degrees of equivalence, linked to the CCAUV.A-K5 comparison, were calculated for all participants of this comparison. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCAUV, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  16. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  17. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  18. LOW FREQUENCY DAMPER

    Directory of Open Access Journals (Sweden)

    Radu BOGATEANU

    2009-09-01

    Full Text Available The low frequency damper is an autonomous equipment for damping vibrations with the 1-20Hz range.Its autonomy enables the equipment to be located in various mechanical systems, without requiring special hydraulic installations.The low frequency damper was designed for damping the low frequency oscillations occurring in the circuit controls of the upgraded IAR-99 Aircraft.The low frequency damper is a novelty in the aerospace field ,with applicability in several areas as it can be built up in an appropriate range of dimensions meeting the requirements of different beneficiaries. On this line an equipment able to damp an extended frequency range was performed for damping oscillations in the pipes of the nuclear power plants.This damper, tested in INCAS laboratories matched the requirements of the beneficiary.The low frequency damper is patented – the patent no. 114583C1/2000 is held by INCAS.

  19. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  20. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  1. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  2. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  3. Experimental Determination of the Static Properties of a Towable VHF-UHF Horizontal Electrode Antenna

    Science.gov (United States)

    1979-05-04

    The analytical procedure is documented in detail by Flath and Norgorden r3l and, in somewhat Its& detail, by Fessenden and Cheng f44 , and ’envick and...the formulation of Flath and I Horgorden to compute the frequency dependence of the impedance for the horizontal electrode antenna. The results are...Lincoln Laboratories Technical Note 1976-5, January 1976. 3. E. H. Flath , Jr. and 0. Norgorden, "Expressions for the Input Impedance and Power

  4. Electrical properties of the electroceramic composite in the microwave frequency range: Pb(Fe0.5Nb0.5)O3 (PFN)-Cr0.75Fe1.25O3 (CRFO)

    Science.gov (United States)

    Santos, M. R. P.; Freire, F. N. A.; Sohn, R. S. T. M.; Almeida, J. S.; Sancho, E. O.; Costa, A. D. S. B.; Medeiros, A. M. L.; Sombra, A. S. B.

    2008-12-01

    In this paper, a new electroceramic composite [Pb(Fe0.5Nb0.5) O3 (PFN)]Z [Cr0.75Fe1.25O3 (CRFO)]100-Z (Z = 0, 10) is investigated in the microwave (MW) frequency range. The dielectric permittivity and loss in the region of 4-8 GHz (G and H MW bands) were studied. The performance of cylindrical resonator antennas based on CRFO100 and on PFN10 was examined. The experimental and theoretical results of the dielectric resonator antenna (DRA) such as return loss, bandwidth, input impedance and radiation patterns are in good agreement for both composites: PFN10 (10% PFN + 90% CRFO) and CRFO100 (100% CRFO). A numerical validation was made considering an air gap between the dielectric resonator and the metallic conductors. The PFN10 matrix composite PFN10 (10% PFN + 90% CRFO) presents the highest dielectric permittivity (9.9 at 4.44 GHz) and the lowest bandwidth (9.9%). The CRFO100 phase (100% CRFO) presents a dielectric permittivity of 8.35 at 4.67 GHz and a bandwidth of 11.8%. The Hakki-Coleman procedure was also used in this study. The dielectric permittivity of 8.35 (tan δ = 1 × 10-3) at 7.94 GHz was obtained for CRFO100. The PFN10 presents a dielectric permittivity of 10.17 (tan δ = 4.9 × 10-3) at 7.05 GHz. These measurements confirm the possible use of such material for small DRAs.

  5. A meteor head echo analysis algorithm for the lower VHF band

    Directory of Open Access Journals (Sweden)

    J. Kero

    2012-04-01

    Full Text Available We have developed an automated analysis scheme for meteor head echo observations by the 46.5 MHz Middle and Upper atmosphere (MU radar near Shigaraki, Japan (34.85° N, 136.10° E. The analysis procedure computes meteoroid range, velocity and deceleration as functions of time with unprecedented accuracy and precision. This is crucial for estimations of meteoroid mass and orbital parameters as well as investigations of the meteoroid-atmosphere interaction processes. In this paper we present this analysis procedure in detail. The algorithms use a combination of single-pulse-Doppler, time-of-flight and pulse-to-pulse phase correlation measurements to determine the radial velocity to within a few tens of metres per second with 3.12 ms time resolution. Equivalently, the precision improvement is at least a factor of 20 compared to previous single-pulse measurements. Such a precision reveals that the deceleration increases significantly during the intense part of a meteoroid's ablation process in the atmosphere. From each received pulse, the target range is determined to within a few tens of meters, or the order of a few hundredths of the 900 m long range gates. This is achieved by transmitting a 13-bit Barker code oversampled by a factor of two at reception and using a novel range interpolation technique. The meteoroid velocity vector is determined from the estimated radial velocity by carefully taking the location of the meteor target and the angle from its trajectory to the radar beam into account. The latter is determined from target range and bore axis offset. We have identified and solved the signal processing issue giving rise to the peculiar signature in signal to noise ratio plots reported by Galindo et al. (2011, and show how to use the range interpolation technique to differentiate the effect of signal processing from physical processes.

  6. Frequency comb swept lasers.

    Science.gov (United States)

    Tsai, Tsung-Han; Zhou, Chao; Adler, Desmond C; Fujimoto, James G

    2009-11-09

    We demonstrate a frequency comb (FC) swept laser and a frequency comb Fourier domain mode locked (FC-FDML) laser for applications in optical coherence tomography (OCT). The fiber-based FC swept lasers operate at a sweep rate of 1kHz and 120kHz, respectively over a 135nm tuning range centered at 1310nm with average output powers of 50mW. A 25GHz free spectral range frequency comb filter in the swept lasers causes the lasers to generate a series of well defined frequency steps. The narrow bandwidth (0.015nm) of the frequency comb filter enables a approximately -1.2dB sensitivity roll off over approximately 3mm range, compared to conventional swept source and FDML lasers which have -10dB and -5dB roll offs, respectively. Measurements at very long ranges are possible with minimal sensitivity loss, however reflections from outside the principal measurement range of 0-3mm appear aliased back into the principal range. In addition, the frequency comb output from the lasers are equally spaced in frequency (linear in k-space). The filtered laser output can be used to self-clock the OCT interference signal sampling, enabling direct fast Fourier transformation of the fringe signals, without the need for fringe recalibration procedures. The design and operation principles of FC swept lasers are discussed and designs for short cavity lasers for OCT and interferometric measurement applications are proposed.

  7. Low-cost detection of RC-IED activation signals in VHF band

    Science.gov (United States)

    Camargo Suarez, Victor Hugo; Marulanda B., Jose Ignacio

    2014-05-01

    The proliferation of Radio Controlled Improvised Explosive Devices (RC-IED) is a growing threat around the world. The ease of construction and low cost of these devices are transforming common things in lethal tramps. The fight against this threats normally involves the use of sophisticated and expensive equipment of Electronic Warfare based on high speed DSP systems, just to detect the presence of detonation signals. In this work is showed how to find activation signals based on the characteristic of the power in a specific band and the previous knowledge about the detonation signals. As proof of concept we have taken the information about the RC-IEDs used in the Colombian conflict and develop an algorithm to find detonation signals based on the measured power in frequencies between 136 MHz and 174 MHz (2 meter civil band)

  8. Spectral characteristics of ionospheric scintillations of VHF radiosignal near magnetic zenith

    Science.gov (United States)

    Vasilyev, Roman; Globa, Mariia; Kushnarev, Dmitry; Medvedev, Andrey; Ratovsky, Konstantin

    2017-07-01

    We present the results of observing the Cygnus-A radio source scintillation in the Earth's ionosphere under quiet and disturbed geomagnetic conditions by using the Irkutsk incoherent scattering radar (IISR). The scintillation method applied for ionosphere testing at IISR confidently determines the Fresnel frequency and power cutoff, the spectral characteristics usually related to the velocities and spatial spectra of ionospheric plasma irregularities. We also use the IGRF magnetic field model to show the relation between the shape of discrete radio source scintillation spectra and the direction to the radio source with respect to the geomagnetic field. The S4 index increase within the magnetic zenith is observed to be conditioned by the scintillation spectrum widening. We also evaluate the zonal velocity of observed ionospheric irregularities as ∼10 m/sec assuming the irregularity height to be equal to the F2-layer maximum height in the ionosphere.

  9. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  10. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  11. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  12. Frequency selectivity at very low centre frequencies

    DEFF Research Database (Denmark)

    Orellana, Carlos Andrés Jurado; Pedersen, Christian Sejer; Marquardt, Torsten

    2010-01-01

    measurements based on OAE suppression techniques and notched-noise masking data psychophysically measured for centre frequencies in the range 50-125 Hz, this study examines how individual differences in frequency selectivity, as well as in masking, may occur at very low CFs due to individual differences...... in the shape of the METFs, thought to be affected by the helicotrema impedance. Preliminary analysis indicates that individual differences in the METFs might underlay the observed individual differences in frequency selectivity. Main effects predicted by the calculations are a pronounced flattening off...

  13. Parametric effects of word frequency effect in memory for mixed frequency lists

    OpenAIRE

    Lohnas, Lynn J.; Kahana, Michael J.

    2013-01-01

    The word frequency paradox refers to the finding that low frequency words are better recognized than high frequency words yet high frequency words are better recalled than low frequency words. Rather than comparing separate groups of low and high frequency words, we sought to quantify the functional relation between word frequency and memory performance across the broad range of frequencies typically used in episodic memory experiments. Here we report that both low frequency and high frequenc...

  14. Broadband frequency conversion

    DEFF Research Database (Denmark)

    Sanders, Nicolai; Jensen, Ole Bjarlin; Tidemand-Lichtenberg, Peter

    We present a simple, passive and static setup for broadband frequency conversion. By using simple optical components like lenses, mirrors and gratings, we obtain the spectral angular dispersion to match the second harmonic generation phasematching angles in a nonlinear BiBO crystal. We are able...... to frequency double a single-frequency diode laser, tunable in the 1020-1090 nm range, with almost equal efficiency for all wavelengths. In the experimental setup, the width of the phasematch was increased with a factor of 50. The method can easily be extended to other wavelength ranges and nonlinear crystals...

  15. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  16. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  17. Theoretical and experimental study of two-frequency solid-state lasers in the GHz to THz ranges. Opto-microwave applications waves; Etude theorique et experimentale des lasers solides bi-frequences dans les domaines GHz a THz, en regime continu ou impulsionnel. Applications opto-microondes

    Energy Technology Data Exchange (ETDEWEB)

    Lai, N.D.

    2003-07-15

    We explored some new features of single- and dual-frequency solid-state lasers oscillating in continuous-wave or pulsed regimes. First, we have developed some techniques to optimise the characteristics of pulsed lasers. A weak modulation of the pump power made it possible to obtain a stable repetition rate with a relative stability of 10{sup -6}. The pulse duration was continuously controlled from ten nanoseconds to a few hundreds nanoseconds by three different methods: adjustment of the laser beam diameter in the absorber, adjustment of the pump beam diameter in the active medium, and, in particular, the use of forked eigenstates in a two-axis laser. Moreover, the forked eigenstates allows to increase the pulse energy by coherent addition of the pulses. A compact two-frequency Nd:YAG-Cr:YAG laser with a beat note frequency continuously adjustable up to 2,7 GHz was demonstrated. The two-frequency pulses are ideal sources to meet various needs of applications such as the Doppler lidar-radar. Moreover, we show that two-frequency pulses at 1,55 {mu}m can be obtained by using a new c-cut Co:ASL saturable absorber in an Er-Yb:glass laser. These pulses are perfectly adapted to free-space detection systems requiring eye safety. The coherence time of the beat note in these lasers was also studied: it is limited by the pulse duration. A new technique of modulating the pump power of a solid-state laser at frequencies close to its relaxation oscillation frequency was studied and made it possible to generate a beat note coherence from pulse to pulse. Frequency conversion techniques using the nonlinear optical effects make it possible to obtain tunable two-frequency sources in the visible spectrum. Green and red two-frequency pulses were obtained by using different conversion techniques, intra-cavity or extra-cavity. A two-frequency THz source in the red spectrum was also obtained by doubling the frequencies of a two-frequency THz Er-Yb:glass laser using a mixed fan-out PPLN

  18. Dark current studies on a normal-conducting high-brightness very-high-frequency electron gun operating in continuous wave mode

    Directory of Open Access Journals (Sweden)

    R. Huang

    2015-01-01

    Full Text Available We report on measurements and analysis of a field-emitted electron current in the very-high-frequency (VHF gun, a room temperature rf gun operating at high field and continuous wave (CW mode at the Lawrence Berkeley National Laboratory (LBNL. The VHF gun is the core of the Advanced Photo-injector Experiment (APEX at LBNL, geared toward the development of an injector for driving the next generation of high average power x-ray free electron lasers. High accelerating fields at the cathode are necessary for the high-brightness performance of an electron gun. When coupled with CW operation, such fields can generate a significant amount of field-emitted electrons that can be transported downstream the accelerator forming the so-called “dark current.” Elevated levels of a dark current can cause radiation damage, increase the heat load in the downstream cryogenic systems, and ultimately limit the overall performance and reliability of the facility. We performed systematic measurements that allowed us to characterize the field emission from the VHF gun, determine the location of the main emitters, and define an effective strategy to reduce and control the level of dark current at APEX. Furthermore, the energy spectra of isolated sources have been measured. A simple model for energy data analysis was developed that allows one to extract information on the emitter from a single energy distribution measurement.

  19. Frequency standards

    CERN Document Server

    Riehle, Fritz

    2006-01-01

    Of all measurement units, frequency is the one that may be determined with the highest degree of accuracy. It equally allows precise measurements of other physical and technical quantities, whenever they can be measured in terms of frequency.This volume covers the central methods and techniques relevant for frequency standards developed in physics, electronics, quantum electronics, and statistics. After a review of the basic principles, the book looks at the realisation of commonly used components. It then continues with the description and characterisation of important frequency standards

  20. Frequency synthesiser

    NARCIS (Netherlands)

    Drago, S.; Sebastiano, Fabio; Leenaerts, Dominicus Martinus Wilhelmus; Breems, Lucien Johannes; Nauta, Bram

    2010-01-01

    A low power frequency synthesiser circuit (30) for a radio transceiver, the synthesiser circuit comprising: a digital controlled oscillator configured to generate an output signal having a frequency controlled by an input digital control word (DCW); a feedback loop connected between an output and an

  1. Nonlinear Frequency Compression

    Science.gov (United States)

    Scollie, Susan; Glista, Danielle; Seelisch, Andreas

    2013-01-01

    Frequency lowering technologies offer an alternative amplification solution for severe to profound high frequency hearing losses. While frequency lowering technologies may improve audibility of high frequency sounds, the very nature of this processing can affect the perceived sound quality. This article reports the results from two studies that investigated the impact of a nonlinear frequency compression (NFC) algorithm on perceived sound quality. In the first study, the cutoff frequency and compression ratio parameters of the NFC algorithm were varied, and their effect on the speech quality was measured subjectively with 12 normal hearing adults, 12 normal hearing children, 13 hearing impaired adults, and 9 hearing impaired children. In the second study, 12 normal hearing and 8 hearing impaired adult listeners rated the quality of speech in quiet, speech in noise, and music after processing with a different set of NFC parameters. Results showed that the cutoff frequency parameter had more impact on sound quality ratings than the compression ratio, and that the hearing impaired adults were more tolerant to increased frequency compression than normal hearing adults. No statistically significant differences were found in the sound quality ratings of speech-in-noise and music stimuli processed through various NFC settings by hearing impaired listeners. These findings suggest that there may be an acceptable range of NFC settings for hearing impaired individuals where sound quality is not adversely affected. These results may assist an Audiologist in clinical NFC hearing aid fittings for achieving a balance between high frequency audibility and sound quality. PMID:23539261

  2. Frequency selective terahertz retroreflectors

    Science.gov (United States)

    Williams, Richard James

    The use of novel optical structures operating at terahertz frequencies in industrial and military applications continues to grow. Some of these novel structures include gratings, frequency selective surfaces, metamaterials and metasurfaces, and retroreflectors. A retroreflector is a device that exhibits enhanced backscatter by concentrating the reflected wave in the direction of the source. Retroreflectors have applications in a variety of diverse fields such as aviation, radar systems, antenna technology, communications, navigation, passive identification, and metrology due to their large acceptance angles and frequency bandwidth. This thesis describes the design, fabrication, and characterization of a retroreflector designed for terahertz frequencies and the incorporation of a frequency selective surface in order to endow the retroreflector with narrow-band frequency performance. The radar cross section of several spherical lens reflectors operating at terahertz frequencies was investigated. Spherical lens reflectors with diameters ranging from 2 mm to 8 mm were fabricated from fused silica ball lenses and their radar cross section was measured at 100 GHz, 160 GHz, and 350 GHz. Crossed-dipole frequency selective surfaces exhibiting band-pass characteristics at 350 GHz fabricated from 12 um-thick Nickel screens were applied to the apertures of the spherical lens reflectors. The radar cross section of the frequency selective retroreflectors was measured at 160 GHz and 350 GHz to demonstrate proof-of-concept of narrow-band terahertz performance.

  3. Observation of strong VHF-radar echoes from the E-region at 69°N and 54°N: Echo properties, relation to sporadic layers, and physical mechanisms

    Science.gov (United States)

    Rapp, Markus; Leitert, Lasse; Latteck, Ralph; Zecha, Marius; Hoffmann, Peter; Höffner, Josef; Hoppe, Ulf-Peter; La Hoz, Cesar

    For more than ten years the Leibniz-Institute of Atmospheric Physics at Rostock University in Kühlungsborn has been operating two VHF-radars (53.5 MHz) at the Arctic location Andenes (69N, 16E) as well as the mid-latitude site Kühlungsborn (54.1N 11.8E). Both radars have primarily been used for the study of strong radar echoes from the summer mesopause region known as (polar) mesosphere summer echoes or (P)MSE. PMSE occur from mid May until mid August in an altitude range from 80 -90 km, i.e., at the time of year and in the altitude range where the atmosphere is supersaturated with respect to ice such that ice particles may form, modify the D-region plasma, and lead to spectacular radar echoes. The existence of echoes from above this altitude range has generally been deemed impossible since refractive index fluctuations arising from neutral dynamics such as turbulence are effectively destroyed at these altitudes owing to the exponential increase of viscosity with height. Also, plasma instabilities which occur between 90 -110 km height produce field aligned irregularities and should not lead to detectable echoes for vertically sounding radars at polar latitudes where the magnetic field lines are essentially perpendicular to the surface. It hence comes as a surprise that our recent observations in the altitude range from 90 -115 km reveals the presence of strong radar echoes both at 69N as well as 54N. These echoes have a typical duration of less than 1 hour and extend over less than 1 km in height. They occur in the entire altitude range from 90 to 115 km with a pronounced maximum at 100 km. The seasonal variation is marked by a pronounced maximum during the summer months. This paper describes the morphology and statistics of these echoes, discusses its relation to sporadic E-layers and sporadic metal layers, and closes with an initial attempt to identify a physical mechanism responsible for these structures.

  4. Home range and density of three sympatric felids in the Southern Atlantic Forest, Brazil.

    Science.gov (United States)

    Kasper, C B; Schneider, A; Oliveira, T G

    2016-02-01

    Home range and minimal population densities of Southern tiger cat (Leopardus guttulus), margay (Lepardus wiedii) and jaguarundi (Puma yagouaroundi) were estimated between 2005 and 2006 in Taquari Valley, near the southern edge of the Atlantic Rainforest in Brazil. Home range data were collected by conventional radio telemetry (VHF) locations in a highly fragmented landscape. The average home range size, calculated using 95% kernel density estimates, was 16.01 km2 for Southern tiger cat, 21.85 km2 for margay and 51.45 km2 for jaguarundi. Telemetry data were used to obtain minimal density estimates of 0.08 Southern tiger cats / km2, and 0.04 jaguarundi / km2. The density estimates arise from areas where ocelot (Leopardus pardalis) and other larger-bodied carnivores were locally extinct, and they suggest a specific type of mesopredator release known as the ocelot effect, which is likely enabling the increase in smaller felid populations in this area.

  5. A High-Speed High-Frequency Broadband Acoustic Modem for Short-to-Medium Range Data Transmission in Ports, Very Shallow Waters and Deep Waters Using Spread-Spectrum Modulation and Decision Feedback Equalizing

    Science.gov (United States)

    2006-02-06

    and a reverberation time of approximately 5 ms. 3. In the marina facing FAU SeaTech, keeping source and receiver static at 20 to 50 m range [9...Both source and receiver can move. In each case, the ambient noise level, bathymetry, channel impulse response, reverberation time , Doppler shift and...in the marina and the turning basin confirmed this statement. Overall, the reverberation time tends to remain within 1 ms, and very occasionally

  6. Examination of the layer model of the frequency-domain interferometry theory applied in mesosphere-stratosphere-troposphere radars

    Science.gov (United States)

    Chen, J.-S.; Chu, Y.-H.

    2001-01-01

    The thickness and position of an atmospheric layer embedded in the radar volume can be resolved by using the frequency-domain interferometry (FDI) technique in accordance with an analytical expression, in which a single layer with Gaussian shape is assumed. However, the FDI experimental results obtained from the Chung-Li VHF radar show that the layer thickness is usually dependent on the layer position. In view of this, an attempt is made in this paper to interpret the observations. With the help of numerical simulation, we examine three FDI models: (1) a non-Gaussian layer, (2) single layer in company with background scatterers, and (3) multiple layers. The analytical FDI expression derived from the Gaussian-layer model is employed in the numerical study to calculate the layer position and layer thickness on the basis of the coherence and phase estimated from the examined layer model. It shows that the resultant thickness and position of the FDI layer are dependent on each other, which is in agreement with the observed thickness-position relations shown in this paper. Moreover, the numerical results can also provide a reasonable interpretation of the observations reported by earlier scientific workers, such as the discrepancy between the vertical displacement velocity of the layer and the vertical Doppler velocity, the difference in thickness between the FDI-derived layer and in situ observed temperature//humidity sheets, etc. We finally illustrate that the range weighting effect of the radar system plays a crucial role in the FDI-derived thickness-position relations.

  7. PMSE observations at three different frequencies in northern Europe during summer 1994

    Directory of Open Access Journals (Sweden)

    J. Bremer

    Full Text Available Simultaneous observations of polar mesosphere summer echoes (PMSE have been carried out during summer 1994 in northern Norway using three radars on different frequencies: the ALOMAR SOUSY radar at Andenes on 53.5 MHz, the EISCAT VHF radar at Tromsø on 224 MHz and the MF radar at Tromsø on 2.78 MHz. During the common measuring period in July/August 1994, PMSE could be detected at 224 and 53.5 MHz, and there are strong hints that PMSE also occur at 2.78 MHz. Reliable correlations between hourly backscattered power values indicate that the PMSE structures have zonal extensions of more than 130 km and can be detected at very different scales (half wavelength between 0.67 (EISCAT VHF radar and 54 m (MF radar. Using the wind values derived by the MF radar it can be shown that the mesospheric wind field influences the structure of PMSE. The diurnal variation of PMSE is strongly connected with tidal-wind components, whereas spatial differences of PMSE can partly be explained by the mean wind field.

  8. PMSE observations at three different frequencies in northern Europe during summer 1994

    Directory of Open Access Journals (Sweden)

    J. Bremer

    1996-12-01

    Full Text Available Simultaneous observations of polar mesosphere summer echoes (PMSE have been carried out during summer 1994 in northern Norway using three radars on different frequencies: the ALOMAR SOUSY radar at Andenes on 53.5 MHz, the EISCAT VHF radar at Tromsø on 224 MHz and the MF radar at Tromsø on 2.78 MHz. During the common measuring period in July/August 1994, PMSE could be detected at 224 and 53.5 MHz, and there are strong hints that PMSE also occur at 2.78 MHz. Reliable correlations between hourly backscattered power values indicate that the PMSE structures have zonal extensions of more than 130 km and can be detected at very different scales (half wavelength between 0.67 (EISCAT VHF radar and 54 m (MF radar. Using the wind values derived by the MF radar it can be shown that the mesospheric wind field influences the structure of PMSE. The diurnal variation of PMSE is strongly connected with tidal-wind components, whereas spatial differences of PMSE can partly be explained by the mean wind field.

  9. Arbitrary optical frequency synthesis traced to an optical frequency comb

    Science.gov (United States)

    Cai, Zihang; Zhang, Weipeng; Yang, Honglei; Li, Yan; Wei, Haoyun

    2016-11-01

    An arbitrary optical frequency synthesizer with a broad tuning range and high frequency accuracy is presented. The system includes an external cavity diode laser (ECDL) as the output laser, an Erbium-doped optical frequency comb being a frequency reference, and a control module. The optical frequency from the synthesizer can be continuously tuned by the large-scale trans-tooth switch and the fine intra-tooth adjustment. Robust feedback control by regulating the current and PZT voltage enables the ECDL to phase-lock to the Erbium-doped optical frequency comb, therefore to keep stable frequency output. In the meanwhile, the absolute frequency of the synthesizer is determined by the repetition rate, the offset frequency and the beat frequency. All the phase lock loops in the system are traced back to a Rubidium clock. A powerful and friendly software is developed to make the operation convenient by integrating the functions of frequency setting, tuning, tracing, locking and measuring into a LabVIEW interface. The output frequency tuning span and the uncertainty of the system are evaluated as >6 THz and <3 kHz, respectively. The arbitrary optical frequency synthesizer will be a versatile tool in diverse applications, such as synthetic wavelength based absolute distance measurement and frequency-stabilized Cavity Ring-Down Spectroscopy.

  10. A comparison between electric field strengths similarly generated and measured in the open air, in a shielded enclosure and in a large aircraft hangar, over frequency range 10 to 110 MHz

    Science.gov (United States)

    Dew, M.; Harrison, F.

    1980-02-01

    Field strength measurements over 10 to 110 MHz were made using a tracking generator counter, a spectrum analyzer, and a biconal antenna. The dimensions of the shielded enclosure were 6.1 x 3.66 x 3.0 m, and the concrete floored, metal hangar 80 x 40 x 10 m. It was found that in each polarization the hangar performance deviated much less from that in the open air than did the shielded enclosure performance. The latter shows deviations with modulus as great as 38 dB (certical pol) and 26 dB (horizontal pol). For any electric field strength measured in the shielded enclosure (in 10 kHz bandwidth in the range 10 to 110 MHz) the probability that the result would be at least 6 dB different from that similary obtained in the open air was 38% or 43.5% according to polarization and that when similarly measured in the hangar the corresponding probabilities were 0% and 1%. Hangar results were shown to lie much closer to the open air results than do the shielded enclosure results. This is further demonstrated by the rms deviations of the shielded enclosure and hangar readings from those of the open air.

  11. Catalytic Carbon Submicron Fabrication Using Home-Built Very-High Frequency Plasma Enhanced Chemical Vapour Deposition

    Directory of Open Access Journals (Sweden)

    Sukirno

    2008-09-01

    Full Text Available In this research, carbon nanotubes (CNT fabrication is attempted by using existing home-made Plasma Enhanced Chemical Vapour Deposition (PECVD system. The fabrication is a catalytic growth process, which Fe catalyst thin film is grown on the Silicon substrate by using dc-Unbalanced Magnetron Sputtering method. By using methane (CH4 as the source of carbon and diluted silane (SiH4 in hydrogen as the source of hydrogen with 10:1 ratio, CNT fabrications have been attempted by using Very High Frequency PECVD (VHF-PECVD method. The fabrication processes are done at relatively low temperature, 250oC, but with higher operated plasma frequency, 70 MHz. Recently, it is also been attempted a fabrication process with only single gas source, but using one of the modification of the VHF-PECVD system, which is by adding hot-wire component. The attempt was done in higher growth temperature, 400oC. Morphological characterizations, by using Scanning Electron Micrograph (SEM and Scanning Probe Microscopy (SPM, as well as the composition characterization, by using Energy Dispersion Analysis by X-Ray (EDAX, show convincing results that there are some signatures of CNT present.

  12. Ultra-sensitive NEMS-based cantilevers for sensing, scanned probe and very high-frequency applications.

    Science.gov (United States)

    Li, Mo; Tang, H X; Roukes, M L

    2007-02-01

    Scanning probe microscopies (SPM) and cantilever-based sensors generally use low-frequency mechanical devices of microscale dimensions or larger. Almost universally, off-chip methods are used to sense displacement in these devices, but this approach is not suitable for nanoscale devices. Nanoscale mechanical sensors offer a greatly enhanced performance that is unattainable with microscale devices. Here we describe the fabrication and operation of self-sensing nanocantilevers with fundamental mechanical resonances up to very high frequencies (VHF). These devices use integrated electronic displacement transducers based on piezoresistive thin metal films, permitting straightforward and optimal nanodevice readout. This non-optical transduction enables applications requiring previously inaccessible sensitivity and bandwidth, such as fast SPM and VHF force sensing. Detection of 127 MHz cantilever vibrations is demonstrated with a thermomechanical-noise-limited displacement sensitivity of 39 fm Hz(-1/2). Our smallest devices, with dimensions approaching the mean free path at atmospheric pressure, maintain high resonance quality factors in ambient conditions. This enables chemisorption measurements in air at room temperature, with unprecedented mass resolution less than 1 attogram (10(-18) g).

  13. Asynchronous BCI control using high-frequency SSVEP

    National Research Council Canada - National Science Library

    Diez, Pablo F; Mut, Vicente A; Avila Perona, Enrique M; Laciar Leber, Eric

    2011-01-01

    ...) and high frequency (> 30 Hz). SSVEP-based Brain-Computer Interfaces (BCI) are principally focused on the low and medium range of frequencies whereas there are only a few projects in the high-frequency range...

  14. Term frequency inverse document frequency (TF-IDF) technique and ...

    African Journals Online (AJOL)

    Term frequency inverse document frequency (TF-IDF) technique and artificial neural network in email classification system. ... This has inspired attention for urgent need to manage and maintain e-mail. Email messages are expected to be sent and gathered in a warehouse for recurring use as it ranges from inert institutional ...

  15. Variable frequency iteration MPPT for resonant power converters

    Science.gov (United States)

    Zhang, Qian; Bataresh, Issa; Chen, Lin

    2015-06-30

    A method of maximum power point tracking (MPPT) uses an MPPT algorithm to determine a switching frequency for a resonant power converter, including initializing by setting an initial boundary frequency range that is divided into initial frequency sub-ranges bounded by initial frequencies including an initial center frequency and first and second initial bounding frequencies. A first iteration includes measuring initial powers at the initial frequencies to determine a maximum power initial frequency that is used to set a first reduced frequency search range centered or bounded by the maximum power initial frequency including at least a first additional bounding frequency. A second iteration includes calculating first and second center frequencies by averaging adjacent frequent values in the first reduced frequency search range and measuring second power values at the first and second center frequencies. The switching frequency is determined from measured power values including the second power values.

  16. Simple Models of EMI Filters for Low Frequency Range

    Directory of Open Access Journals (Sweden)

    Z. Raida

    2008-09-01

    Full Text Available This paper deals with mathematical simulations of EMI filters’ performance. These filters are commonly used for the suppressing of electromagnetic interference which penetrates through the power supply networks. The performance of these filters depends on terminating impedances which are plugged to the inputs and outputs clamps of the EMI filters. This paper describes the method by which it is possible to calculate the insertion loss of the filters. The method is based on the modified nodal voltage method. The circuitry of the EMI filters is used for their description. The effect of spurious components is not taken into account. The filter itself is described by set of admittance parameters, which makes the presented method more universal. The calculated results were compared with measured data of several filters for several impedance combinations. Different test setups, like asymmetrical, symmetrical, etc. were taken into account. The simplicity and accuracy of the presented method is discussed in the conclusion. The achieved accuracy is on high level. The described method is universal, but for filters with more than one current compensated inductor, the mentioned method is complicated. The size of the final equation for calculating the insertion loss rapidly increases with the number of current compensated inductors.

  17. High force vibration testing with wide frequency range

    Science.gov (United States)

    Romero, Edward F.; Jepsen, Richard A.; Gregory, Danny Lynn

    2013-04-02

    A shaker assembly for vibration testing includes first and second shakers, where the first shaker includes a piezo-electric material for generating vibration. A support structure permits a test object to be supported for vibration of the test object by both shakers. An input permits an external vibration controller to control vibration of the shakers.

  18. Vibration of railway bridges in the audible frequency range

    OpenAIRE

    Herron, David

    2009-01-01

    The noise level associated with a train travelling on a bridge is normally greater than that for a train travelling on plain track. It is sometimes the bridge noise that causes the highest levels of disturbance to people in the vicinity or triggers action underregulations such as the Environmental Noise Directive. Consequently, there is a need to study means of predicting noise levels from proposed bridges, noise controlmeasures for existing structures and principles of low-noise bridge desig...

  19. Conducted noise suppression up to GHz range by spin-sprayed Ni{sub 0.2}Zn{sub x}Fe{sub 2.8-x}O{sub 4} (x=0.3, 0.6) films having different natural resonance frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Kondo, Koichi [NEC Tokin Corporation, 6-7-1 Koriyama, Taihaku-ku, Sendai, Miyagi 982-8510 (Japan)]. E-mail: kondok@nec-tokin.com; Chiba, Tatsuya [NEC Tokin Corporation, 6-7-1 Koriyama, Taihaku-ku, Sendai, Miyagi 982-8510 (Japan); Ono, Hiroshi [NEC Tokin Corporation, 6-7-1 Koriyama, Taihaku-ku, Sendai, Miyagi 982-8510 (Japan); Yoshida, Shigeyoshi [NEC Tokin Corporation, 6-7-1 Koriyama, Taihaku-ku, Sendai, Miyagi 982-8510 (Japan); Shimada, Yutaka [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Sendai, Miyagi 980-8577 (Japan); Matsushita, Nobuhiro [Department of Physical Electronics, Tokyo Institute of technology, 2-12-1 O-okayama, Meguro-ku, Tokyo 152-8552 (Japan); Abe, Masanori [Department of Physical Electronics, Tokyo Institute of technology, 2-12-1 O-okayama, Meguro-ku, Tokyo 152-8552 (Japan)

    2006-06-15

    In order to apply to a novel, flexible type of GHz noise suppressors, we prepared Ni{sub 0.2}Zn{sub x}Fe{sub 2.8-x}O{sub 4} films with x=0.3 and 0.6 and thicknesses of 2 and 5{mu}m, by spin spray ferrite plating from an aqueous solution on polyimide sheets at 90 deg. C. Placing the films onto a microstrip line, we measured transmission loss {delta}P{sub loss} and reflection parameter S{sub 11} at 10MHz-10GHz. As x increased from 0.3 to 0.6, f{sub r} (natural resonance frequency) decreased from 350 to 50MHz, which resulted in decreasing f{sub c} (a frequency from which {delta}P{sub loss} begins rising) from 400 to 100MHz. This means we can tune f{sub c} of the films by changing the Zn concentration x. At 8GHz, {delta}P{sub loss} obtained by the ferrite films increased from 40% to 70% when their thickness increased from 2 to 5{mu}m. We obtained S{sub 11}<10%, irrespective of Zn concentration, in the whole measurement frequency range. By the films with x=0.3 and 2{mu}m thickness we obtained {delta}P{sub loss}=40%, which was as strong as that obtained by a commercially available composite sheet type noise suppressor of 25{mu}m thickness that are made of ferromagnetic metal flakes embedded in a flexible polymer matrix. Moreover, {delta}P{sub loss} by the ferrite film increased to 70% when the thickness was increased to 5{mu}m. Therefore, our NiZn ferrite films are promising to be actually used as GHz noise suppressors with tunable working frequencies that exhibit stronger noise suppression than the commercialized composite type of noise suppressors.

  20. The variability of the occurrence of the Field Aligned Irregularities in the middle-latitude F region using the VHF radar observation at Daejon, South Korea.

    Science.gov (United States)

    Oh, S. J.; Kil, H.; Tae-yong, Y.; Kwak, Y. S.; Lee, W. K.

    2016-12-01

    The VHF radar observations at Daejeon in South Korea reveal the highly variable nature of the field-aligned irregularities (FAIs) in the middle-latitude F-region. Medium-scale travelling ionospheric disturbances (MSTIDs) are suggested as the source of FAIs, however, the occurrence climatology of the FAIs cannot be fully explained by the existence of the MSTIDs. Moreover, the occurrence climatology of the FAIs with respect to local time (pre-midnight and post-midnight) likely to have separate onset mechanisms. We investigate the role of the ionospheric disturbances(MSTIDs, Equatorial Plasma Bubbles(EPBs)) in the creation of the FAIs using the radar data at Daejon , the total electron content maps over Japan acquired during 2010-2015. and the measurements of the ion density by Swarm (2014,2015). We assess the causal linkage of the occurrence of the FAIs by examining the correlative occurrence of MSTIDs in middle latitude F-region and EPB in low latitude F-region.