AB052. The Human Variome Project (HVP) and the HVP ASEAN Node
Alwi, Zilfalil Bin
2015-01-01
The Human Variome Project (HVP) is an international NGO that is working to build capacity in responsible clinical genomics around the world. Founded in 2006, and lead in its early years by Professor Richard Cotton, the Project has grown to become a global movement with over 1,300 individual members from 81 countries and close to 200 data provider members. The project works to ensure that the lack of access to information on genetic variants and their effects on human health is not an impediment to diagnosis and treatment. Together with partner organisations including national and regional human genetics societies, national governments and intergovernmental organisations such as UNESCO—of which the HVP is an NGO official partner—the project establishes standards, guidelines and best practices for the responsible development and operation of genetic variation data sharing infrastructure, facilitates training and education of the public and the clinical genomics field and assists in embedding data sharing into routine clinical practice. The HVP believes that the free and open sharing of genetic variation is fundamental to providing quality clinical care. To ensure that this data can be collected, curated, interpreted and shared in a responsible manner that is respectful of the diverse ethical, legal and social differences of its member countries, the HVP works with local stakeholders in each country to establish HVP Country Nodes. An HVP Country Node is defined as having three components: (I) a repository, or linked network of databases, that collect and store information on variation in the human genome that has been generated within each country and that enables the sharing of that information both nationally and internationally; (II) a governance structure that ensures that the work of the Node is both sustainable in the long term and is consistent with all relevant national and international ethical, legal and social requirements; and (III) a set of policies
The Human Variome Project (HVP) 2009 Forum "Towards Establishing Standards".
Howard, Heather J; Horaitis, Ourania; Cotton, Richard G H; Vihinen, Mauno; Dalgleish, Raymond; Robinson, Peter; Brookes, Anthony J; Axton, Myles; Hoffmann, Robert; Tuffery-Giraud, Sylvie
2010-03-01
The May 2009 Human Variome Project (HVP) Forum "Towards Establishing Standards" was a round table discussion attended by delegates from groups representing international efforts aimed at standardizing several aspects of the HVP: mutation nomenclature, description and annotation, clinical ontology, means to better characterize unclassified variants (UVs), and methods to capture mutations from diagnostic laboratories for broader distribution to the medical genetics research community. Methods for researchers to receive credit for their effort at mutation detection were also discussed. (c) 2010 Wiley-Liss, Inc.
Burn, John; Watson, Michael
2016-06-01
The practical realization of genomics has meant a growing realization that variant interpretation is a major barrier to practical use of DNA sequence data. The late Professor Dick Cotton devoted his life to innovation in molecular genetics and was a prime mover in the international response to the need to understand the "variome." His leadership resulted in the launch first of the Human Genetic Variation Society and then, in 2006, an international agreement to launch the Human Variome Project (HVP), aimed at data integration enabled by standards and infrastructure of the databases of variants being identified in families with a range of inherited disorders. The project attracted a network of affiliates across 81 countries and earned formal recognition by UNESCO, which now hosts its biennial meetings. It has also signed a Memorandum of Understanding with the World Health Organization. Future progress will depend on longer term secure funding and integration with the efforts of the genomics community where the rapid advances in sequencing technology have enabled variant capture on a previously unimaginable scale. Efforts are underway to integrate the efforts of HVP with those of the Global Alliance for Genomics and Health to provide a lasting legacy of Dick Cotton's vision. © 2016 WILEY PERIODICALS, INC.
Standard development at the Human Variome Project.
Smith, Timothy D; Vihinen, Mauno
2015-01-01
The Human Variome Project (HVP) is a world organization working towards facilitating the collection, curation, interpretation and free and open sharing of genetic variation information. A key component of HVP activities is the development of standards and guidelines. HVP Standards are systems, procedures and technologies that the HVP Consortium has determined must be used by HVP-affiliated data sharing infrastructure and should be used by the broader community. HVP guidelines are considered to be beneficial for HVP affiliated data sharing infrastructure and the broader community to adopt. The HVP also maintains a process for assessing systems, processes and tools that implement HVP Standards and Guidelines. Recommended System Status is an accreditation process designed to encourage the adoption of HVP Standards and Guidelines. Here, we describe the HVP standards development process and discuss the accepted standards, guidelines and recommended systems as well as those under acceptance. Certain HVP Standards and Guidelines are already widely adopted by the community and there are committed users for the others. © The Author(s) 2015. Published by Oxford University Press.
Kohonen-Corish, Maija R. J.; Macrae, Finlay; Genuardi, Maurizio; Aretz, Stefan; Bapat, Bharati; Bernstein, Inge T.; Burn, John; Cotton, Richard G. H.; den Dunnen, Johan T.; Frebourg, Thierry; Greenblatt, Marc S.; Hofstra, Robert; Holinski-Feder, Elke; Lappalainen, Ilkka; Lindblom, Annika; Maglott, Donna; Moller, Pal; Morreau, Hans; Moeslein, Gabriela; Sijmons, Rolf; Spurdle, Amanda B.; Tavtigian, Sean; Tops, Carli M. J.; Weber, Thomas K.; de Wind, Niels; Woods, Michael O.
The Human Variome Project (HVP) has established a pilot program with the International Society for Gastrointestinal Hereditary Tumours (InSiGHT) to compile all inherited variation affecting colon cancer susceptibility genes. An HVP-InSiGHT Workshop was held on May 10, 2010, prior to the HVP
[The human variome project and its progress].
Gao, Shan; Zhang, Ning; Zhang, Lei; Duan, Guang-You; Zhang, Tao
2010-11-01
The main goal of post genomics is to explain how the genome, the map of which has been constructed in the Human Genome Project, affacts activities of life. This leads to generate multiple "omics": structural genomics, functional genomics, proteomics, metabonomics, et al. In Jun. 2006, Melbourne, Australia, Human Genome Variation Society (HGVS) initiated the Human Variome Project (HVP) to collect all the sequence variation and polymorphism data worldwidely. HVP is to search and determine those mutations related with human diseases by association study between genetype and phenotype on the scale of genome level and other methods. Those results will be translated into clinical application. Considering the potential effects of this project on human health, this paper introduced its origin and main content in detail and discussed its meaning and prospect.
Kohonen-Corish, Maija R.J.; Al-Aama, Jumana Y.; Auerbach, Arleen D.; Axton, Myles; Barash, Carol Isaacson; Bernstein, Inge; Béroud, Christophe; Burn, John; Cunningham, Fiona; Cutting, Garry R.; den Dunnen, Johan T.; Greenblatt, Marc S.; Kaput, Jim; Katz, Michael; Lindblom, Annika; Macrae, Finlay; Maglott, Donna; Möslein, Gabriela; Povey, Sue; Ramesar, Raj; Richards, Sue; Seminara, Daniela; Sobrido, María-Jesús; Tavtigian, Sean; Taylor, Graham; Vihinen, Mauno; Winship, Ingrid; Cotton, Richard G.H.
2011-01-01
The third Human Variome Project (HVP) Meeting “Integration and Implementation” was held under UNESCO Patronage in Paris, France, at the UNESCO Headquarters May 10–14, 2010. The major aims of the HVP are the collection, curation, and distribution of all human genetic variation affecting health. The HVP has drawn together disparate groups, by country, gene of interest, and expertise, who are working for the common good with the shared goal of pushing the boundaries of the human variome and collaborating to avoid unnecessary duplication. The meeting addressed the 12 key areas that form the current framework of HVP activities: Ethics; Nomenclature and Standards; Publication, Credit and Incentives; Data Collection from Clinics; Overall Data Integration and Access—Peripheral Systems/Software; Data Collection from Laboratories; Assessment of Pathogenicity; Country Specific Collection; Translation to Healthcare and Personalized Medicine; Data Transfer, Databasing, and Curation; Overall Data Integration and Access—Central Systems; and Funding Mechanisms and Sustainability. In addition, three societies that support the goals and the mission of HVP also held their own Workshops with the view to advance disease-specific variation data collection and utilization: the International Society for Gastrointestinal Hereditary Tumours, the Micronutrient Genomics Project, and the Neurogenetics Consortium. PMID:20960468
Kohonen-Corish, Maija R J; Al-Aama, Jumana Y; Auerbach, Arleen D; Axton, Myles; Barash, Carol Isaacson; Bernstein, Inge; Béroud, Christophe; Burn, John; Cunningham, Fiona; Cutting, Garry R; den Dunnen, Johan T; Greenblatt, Marc S; Kaput, Jim; Katz, Michael; Lindblom, Annika; Macrae, Finlay; Maglott, Donna; Möslein, Gabriela; Povey, Sue; Ramesar, Raj; Richards, Sue; Seminara, Daniela; Sobrido, María-Jesús; Tavtigian, Sean; Taylor, Graham; Vihinen, Mauno; Winship, Ingrid; Cotton, Richard G H
2010-12-01
The third Human Variome Project (HVP) Meeting "Integration and Implementation" was held under UNESCO Patronage in Paris, France, at the UNESCO Headquarters May 10-14, 2010. The major aims of the HVP are the collection, curation, and distribution of all human genetic variation affecting health. The HVP has drawn together disparate groups, by country, gene of interest, and expertise, who are working for the common good with the shared goal of pushing the boundaries of the human variome and collaborating to avoid unnecessary duplication. The meeting addressed the 12 key areas that form the current framework of HVP activities: Ethics; Nomenclature and Standards; Publication, Credit and Incentives; Data Collection from Clinics; Overall Data Integration and Access-Peripheral Systems/Software; Data Collection from Laboratories; Assessment of Pathogenicity; Country Specific Collection; Translation to Healthcare and Personalized Medicine; Data Transfer, Databasing, and Curation; Overall Data Integration and Access-Central Systems; and Funding Mechanisms and Sustainability. In addition, three societies that support the goals and the mission of HVP also held their own Workshops with the view to advance disease-specific variation data collection and utilization: the International Society for Gastrointestinal Hereditary Tumours, the Micronutrient Genomics Project, and the Neurogenetics Consortium. © 2010 Wiley-Liss, Inc.
Planning the Human Variome Project: The Spain Report†
Kaput, Jim; Cotton, Richard G. H.; Hardman, Lauren; Al Aqeel, Aida I.; Al-Aama, Jumana Y.; Al-Mulla, Fahd; Aretz, Stefan; Auerbach, Arleen D.; Axton, Myles; Bapat, Bharati; Bernstein, Inge T.; Bhak, Jong; Bleoo, Stacey L.; Blöcker, Helmut; Brenner, Steven E.; Burn, John; Bustamante, Mariona; Calzone, Rita; Cambon-Thomsen, Anne; Cargill, Michele; Carrera, Paola; Cavedon, Lawrence; Cho, Yoon Shin; Chung, Yeun-Jun; Claustres, Mireille; Cutting, Garry; Dalgleish, Raymond; den Dunnen, Johan T.; Díaz, Carlos; Dobrowolski, Steven; dos Santos, M. Rosário N.; Ekong, Rosemary; Flanagan, Simon B.; Flicek, Paul; Furukawa, Yoichi; Genuardi, Maurizio; Ghang, Ho; Golubenko, Maria V.; Greenblatt, Marc S.; Hamosh, Ada; Hancock, John M.; Hardison, Ross; Harrison, Terence M.; Hoffmann, Robert; Horaitis, Rania; Howard, Heather J.; Barash, Carol Isaacson; Izagirre, Neskuts; Jung, Jongsun; Kojima, Toshio; Laradi, Sandrine; Lee, Yeon-Su; Lee, Jong-Young; Gil-da-Silva-Lopes, Vera L.; Macrae, Finlay A.; Maglott, Donna; Marafie, Makia J.; Marsh, Steven G.E.; Matsubara, Yoichi; Messiaen, Ludwine M.; Möslein, Gabriela; Netea, Mihai G.; Norton, Melissa L.; Oefner, Peter J.; Oetting, William S.; O’Leary, James C.; de Ramirez, Ana Maria Oller; Paalman, Mark H.; Parboosingh, Jillian; Patrinos, George P.; Perozzi, Giuditta; Phillips, Ian R.; Povey, Sue; Prasad, Suyash; Qi, Ming; Quin, David J.; Ramesar, Rajkumar S.; Richards, C. Sue; Savige, Judith; Scheible, Dagmar G.; Scott, Rodney J.; Seminara, Daniela; Shephard, Elizabeth A.; Sijmons, Rolf H.; Smith, Timothy D.; Sobrido, María-Jesús; Tanaka, Toshihiro; Tavtigian, Sean V.; Taylor, Graham R.; Teague, Jon; Töpel, Thoralf; Ullman-Cullere, Mollie; Utsunomiya, Joji; van Kranen, Henk J.; Vihinen, Mauno; Watson, Michael; Webb, Elizabeth; Weber, Thomas K.; Yeager, Meredith; Yeom, Young I.; Yim, Seon-Hee; Yoo, Hyang-Sook
2018-01-01
The remarkable progress in characterizing the human genome sequence, exemplified by the Human Genome Project and the HapMap Consortium, has led to the perception that knowledge and the tools (e.g., microarrays) are sufficient for many if not most biomedical research efforts. A large amount of data from diverse studies proves this perception inaccurate at best, and at worst, an impediment for further efforts to characterize the variation in the human genome. Since variation in genotype and environment are the fundamental basis to understand phenotypic variability and heritability at the population level, identifying the range of human genetic variation is crucial to the development of personalized nutrition and medicine. The Human Variome Project (HVP; http://www.humanvariomeproject.org/) was proposed initially to systematically collect mutations that cause human disease and create a cyber infrastructure to link locus specific databases (LSDB). We report here the discussions and recommendations from the 2008 HVP planning meeting held in San Feliu de Guixols, Spain, in May 2008. PMID:19306394
Connecting the Human Variome Project to nutrigenomics.
Kaput, Jim; Evelo, Chris T; Perozzi, Giuditta; van Ommen, Ben; Cotton, Richard
2010-12-01
Nutrigenomics is the science of analyzing and understanding gene-nutrient interactions, which because of the genetic heterogeneity, varying degrees of interaction among gene products, and the environmental diversity is a complex science. Although much knowledge of human diversity has been accumulated, estimates suggest that ~90% of genetic variation has not yet been characterized. Identification of the DNA sequence variants that contribute to nutrition-related disease risk is essential for developing a better understanding of the complex causes of disease in humans, including nutrition-related disease. The Human Variome Project (HVP; http://www.humanvariomeproject.org/) is an international effort to systematically identify genes, their mutations, and their variants associated with phenotypic variability and indications of human disease or phenotype. Since nutrigenomic research uses genetic information in the design and analysis of experiments, the HVP is an essential collaborator for ongoing studies of gene-nutrient interactions. With the advent of next generation sequencing methodologies and the understanding of the undiscovered variation in human genomes, the nutrigenomic community will be generating novel sequence data and results. The guidelines and practices of the HVP can guide and harmonize these efforts.
DEFF Research Database (Denmark)
Kohonen-Corish, Maija R J; Macrae, Finlay; Genuardi, Maurizio
2011-01-01
The Human Variome Project (HVP) has established a pilot program with the International Society for Gastrointestinal Hereditary Tumours (InSiGHT) to compile all inherited variation affecting colon cancer susceptibility genes. An HVP-InSiGHT Workshop was held on May 10, 2010, prior to the HVP...... Integration and Implementation Meeting at UNESCO in Paris, to review the progress of this pilot program. A wide range of topics were covered, including issues relating to genotype-phenotype data submission to the InSiGHT Colon Cancer Gene Variant Databases (chromium.liacs.nl/LOVD2/colon_cancer...
Planning the human variome project: the Spain report.
Kaput, Jim; Cotton, Richard G H; Hardman, Lauren; Watson, Michael; Al Aqeel, Aida I; Al-Aama, Jumana Y; Al-Mulla, Fahd; Alonso, Santos; Aretz, Stefan; Auerbach, Arleen D; Bapat, Bharati; Bernstein, Inge T; Bhak, Jong; Bleoo, Stacey L; Blöcker, Helmut; Brenner, Steven E; Burn, John; Bustamante, Mariona; Calzone, Rita; Cambon-Thomsen, Anne; Cargill, Michele; Carrera, Paola; Cavedon, Lawrence; Cho, Yoon Shin; Chung, Yeun-Jun; Claustres, Mireille; Cutting, Garry; Dalgleish, Raymond; den Dunnen, Johan T; Díaz, Carlos; Dobrowolski, Steven; dos Santos, M Rosário N; Ekong, Rosemary; Flanagan, Simon B; Flicek, Paul; Furukawa, Yoichi; Genuardi, Maurizio; Ghang, Ho; Golubenko, Maria V; Greenblatt, Marc S; Hamosh, Ada; Hancock, John M; Hardison, Ross; Harrison, Terence M; Hoffmann, Robert; Horaitis, Rania; Howard, Heather J; Barash, Carol Isaacson; Izagirre, Neskuts; Jung, Jongsun; Kojima, Toshio; Laradi, Sandrine; Lee, Yeon-Su; Lee, Jong-Young; Gil-da-Silva-Lopes, Vera L; Macrae, Finlay A; Maglott, Donna; Marafie, Makia J; Marsh, Steven G E; Matsubara, Yoichi; Messiaen, Ludwine M; Möslein, Gabriela; Netea, Mihai G; Norton, Melissa L; Oefner, Peter J; Oetting, William S; O'Leary, James C; de Ramirez, Ana Maria Oller; Paalman, Mark H; Parboosingh, Jillian; Patrinos, George P; Perozzi, Giuditta; Phillips, Ian R; Povey, Sue; Prasad, Suyash; Qi, Ming; Quin, David J; Ramesar, Rajkumar S; Richards, C Sue; Savige, Judith; Scheible, Dagmar G; Scott, Rodney J; Seminara, Daniela; Shephard, Elizabeth A; Sijmons, Rolf H; Smith, Timothy D; Sobrido, María-Jesús; Tanaka, Toshihiro; Tavtigian, Sean V; Taylor, Graham R; Teague, Jon; Töpel, Thoralf; Ullman-Cullere, Mollie; Utsunomiya, Joji; van Kranen, Henk J; Vihinen, Mauno; Webb, Elizabeth; Weber, Thomas K; Yeager, Meredith; Yeom, Young I; Yim, Seon-Hee; Yoo, Hyang-Sook
2009-04-01
The remarkable progress in characterizing the human genome sequence, exemplified by the Human Genome Project and the HapMap Consortium, has led to the perception that knowledge and the tools (e.g., microarrays) are sufficient for many if not most biomedical research efforts. A large amount of data from diverse studies proves this perception inaccurate at best, and at worst, an impediment for further efforts to characterize the variation in the human genome. Because variation in genotype and environment are the fundamental basis to understand phenotypic variability and heritability at the population level, identifying the range of human genetic variation is crucial to the development of personalized nutrition and medicine. The Human Variome Project (HVP; http://www.humanvariomeproject.org/) was proposed initially to systematically collect mutations that cause human disease and create a cyber infrastructure to link locus specific databases (LSDB). We report here the discussions and recommendations from the 2008 HVP planning meeting held in San Feliu de Guixols, Spain, in May 2008. (c) 2009 Wiley-Liss, Inc.
Initiating a Human Variome Project Country Node.
AlAama, Jumana; Smith, Timothy D; Lo, Alan; Howard, Heather; Kline, Alexandria A; Lange, Matthew; Kaput, Jim; Cotton, Richard G H
2011-05-01
Genetic diseases are a pressing global health problem that requires comprehensive access to basic clinical and genetic data to counter. The creation of regional and international databases that can be easily accessed by clinicians and diagnostic labs will greatly improve our ability to accurately diagnose and treat patients with genetic disorders. The Human Variome Project is currently working in conjunction with human genetics societies to achieve this by establishing systems to collect every mutation reported by a diagnostic laboratory, clinic, or research laboratory in a country and store these within a national repository, or HVP Country Node. Nodes have already been initiated in Australia, Belgium, China, Egypt, Malaysia, and Kuwait. Each is examining how to systematically collect and share genetic, clinical, and biochemical information in a country-specific manner that is sensitive to local ethical and cultural issues. This article gathers cases of genetic data collection within countries and takes recommendations from the global community to develop a procedure for countries wishing to establish their own collection system as part of the Human Variome Project. We hope this may lead to standard practices to facilitate global collection of data and allow efficient use in clinical practice, research and therapy. © 2011 Wiley-Liss, Inc.
Getting ready for the Human Phenome Project: the 2012 forum of the Human Variome Project.
Oetting, William S; Robinson, Peter N; Greenblatt, Marc S; Cotton, Richard G; Beck, Tim; Carey, John C; Doelken, Sandra C; Girdea, Marta; Groza, Tudor; Hamilton, Carol M; Hamosh, Ada; Kerner, Berit; MacArthur, Jacqueline A L; Maglott, Donna R; Mons, Barend; Rehm, Heidi L; Schofield, Paul N; Searle, Beverly A; Smedley, Damian; Smith, Cynthia L; Bernstein, Inge Thomsen; Zankl, Andreas; Zhao, Eric Y
2013-04-01
A forum of the Human Variome Project (HVP) was held as a satellite to the 2012 Annual Meeting of the American Society of Human Genetics in San Francisco, California. The theme of this meeting was "Getting Ready for the Human Phenome Project." Understanding the genetic contribution to both rare single-gene "Mendelian" disorders and more complex common diseases will require integration of research efforts among many fields and better defined phenotypes. The HVP is dedicated to bringing together researchers and research populations throughout the world to provide the resources to investigate the impact of genetic variation on disease. To this end, there needs to be a greater sharing of phenotype and genotype data. For this to occur, many databases that currently exist will need to become interoperable to allow for the combining of cohorts with similar phenotypes to increase statistical power for studies attempting to identify novel disease genes or causative genetic variants. Improved systems and tools that enhance the collection of phenotype data from clinicians are urgently needed. This meeting begins the HVP's effort toward this important goal. © 2013 Wiley Periodicals, Inc.
Kohonen-Corish, Maija R J; Macrae, Finlay; Genuardi, Maurizio; Aretz, Stefan; Bapat, Bharati; Bernstein, Inge T; Burn, John; Cotton, Richard G H; den Dunnen, Johan T; Frebourg, Thierry; Greenblatt, Marc S; Hofstra, Robert; Holinski-Feder, Elke; Lappalainen, Ilkka; Lindblom, Annika; Maglott, Donna; Møller, Pål; Morreau, Hans; Möslein, Gabriela; Sijmons, Rolf; Spurdle, Amanda B; Tavtigian, Sean; Tops, Carli M J; Weber, Thomas K; de Wind, Niels; Woods, Michael O
2011-04-01
The Human Variome Project (HVP) has established a pilot program with the International Society for Gastrointestinal Hereditary Tumours (InSiGHT) to compile all inherited variation affecting colon cancer susceptibility genes. An HVP-InSiGHT Workshop was held on May 10, 2010, prior to the HVP Integration and Implementation Meeting at UNESCO in Paris, to review the progress of this pilot program. A wide range of topics were covered, including issues relating to genotype-phenotype data submission to the InSiGHT Colon Cancer Gene Variant Databases (chromium.liacs.nl/LOVD2/colon_cancer/home.php). The meeting also canvassed the recent exciting developments in models to evaluate the pathogenicity of unclassified variants using in silico data, tumor pathology information, and functional assays, and made further plans for the future progress and sustainability of the pilot program. © 2011 Wiley-Liss, Inc.
Human Variome Project Quality Assessment Criteria for Variation Databases.
Vihinen, Mauno; Hancock, John M; Maglott, Donna R; Landrum, Melissa J; Schaafsma, Gerard C P; Taschner, Peter
2016-06-01
Numerous databases containing information about DNA, RNA, and protein variations are available. Gene-specific variant databases (locus-specific variation databases, LSDBs) are typically curated and maintained for single genes or groups of genes for a certain disease(s). These databases are widely considered as the most reliable information source for a particular gene/protein/disease, but it should also be made clear they may have widely varying contents, infrastructure, and quality. Quality is very important to evaluate because these databases may affect health decision-making, research, and clinical practice. The Human Variome Project (HVP) established a Working Group for Variant Database Quality Assessment. The basic principle was to develop a simple system that nevertheless provides a good overview of the quality of a database. The HVP quality evaluation criteria that resulted are divided into four main components: data quality, technical quality, accessibility, and timeliness. This report elaborates on the developed quality criteria and how implementation of the quality scheme can be achieved. Examples are provided for the current status of the quality items in two different databases, BTKbase, an LSDB, and ClinVar, a central archive of submissions about variants and their clinical significance. © 2016 WILEY PERIODICALS, INC.
DEFF Research Database (Denmark)
Kohonen-Corish, Maija R J; Al-Aama, Jumana Y; Auerbach, Arleen D
2010-01-01
. The HVP has drawn together disparate groups, by country, gene of interest, and expertise, who are working for the common good with the shared goal of pushing the boundaries of the human variome and collaborating to avoid unnecessary duplication. The meeting addressed the 12 key areas that form the current...
Kim, Jungeun; Weber, Jessica A; Jho, Sungwoong; Jang, Jinho; Jun, JeHoon; Cho, Yun Sung; Kim, Hak-Min; Kim, Hyunho; Kim, Yumi; Chung, OkSung; Kim, Chang Geun; Lee, HyeJin; Kim, Byung Chul; Han, Kyudong; Koh, InSong; Chae, Kyun Shik; Lee, Semin; Edwards, Jeremy S; Bhak, Jong
2018-04-04
High-coverage whole-genome sequencing data of a single ethnicity can provide a useful catalogue of population-specific genetic variations, and provides a critical resource that can be used to more accurately identify pathogenic genetic variants. We report a comprehensive analysis of the Korean population, and present the Korean National Standard Reference Variome (KoVariome). As a part of the Korean Personal Genome Project (KPGP), we constructed the KoVariome database using 5.5 terabases of whole genome sequence data from 50 healthy Korean individuals in order to characterize the benign ethnicity-relevant genetic variation present in the Korean population. In total, KoVariome includes 12.7M single-nucleotide variants (SNVs), 1.7M short insertions and deletions (indels), 4K structural variations (SVs), and 3.6K copy number variations (CNVs). Among them, 2.4M (19%) SNVs and 0.4M (24%) indels were identified as novel. We also discovered selective enrichment of 3.8M SNVs and 0.5M indels in Korean individuals, which were used to filter out 1,271 coding-SNVs not originally removed from the 1,000 Genomes Project when prioritizing disease-causing variants. KoVariome health records were used to identify novel disease-causing variants in the Korean population, demonstrating the value of high-quality ethnic variation databases for the accurate interpretation of individual genomes and the precise characterization of genetic variations.
The first Malay database toward the ethnic-specific target molecular variation.
Halim-Fikri, Hashim; Etemad, Ali; Abdul Latif, Ahmad Zubaidi; Merican, Amir Feisal; Baig, Atif Amin; Annuar, Azlina Ahmad; Ismail, Endom; Salahshourifar, Iman; Liza-Sharmini, Ahmad Tajudin; Ramli, Marini; Shah, Mohamed Irwan; Johan, Muhammad Farid; Hassan, Nik Norliza Nik; Abdul-Aziz, Noraishah Mydin; Mohd Noor, Noor Haslina; Nur-Shafawati, Ab Rajab; Hassan, Rosline; Bahar, Rosnah; Zain, Rosnah Binti; Yusoff, Shafini Mohamed; Yusoff, Surini; Tan, Soon Guan; Thong, Meow-Keong; Wan-Isa, Hatin; Abdullah, Wan Zaidah; Mohamed, Zahurin; Abdul Latiff, Zarina; Zilfalil, Bin Alwi
2015-04-30
The Malaysian Node of the Human Variome Project (MyHVP) is one of the eighteen official Human Variome Project (HVP) country-specific nodes. Since its inception in 9(th) October 2010, MyHVP has attracted the significant number of Malaysian clinicians and researchers to participate and contribute their data to this project. MyHVP also act as the center of coordination for genotypic and phenotypic variation studies of the Malaysian population. A specialized database was developed to store and manage the data based on genetic variations which also associated with health and disease of Malaysian ethnic groups. This ethnic-specific database is called the Malaysian Node of the Human Variome Project database (MyHVPDb). Currently, MyHVPDb provides only information about the genetic variations and mutations found in the Malays. In the near future, it will expand for the other Malaysian ethnics as well. The data sets are specified based on diseases or genetic mutation types which have three main subcategories: Single Nucleotide Polymorphism (SNP), Copy Number Variation (CNV) followed by the mutations which code for the common diseases among Malaysians. MyHVPDb has been open to the local researchers, academicians and students through the registration at the portal of MyHVP ( http://hvpmalaysia.kk.usm.my/mhgvc/index.php?id=register ). This database would be useful for clinicians and researchers who are interested in doing a study on genomics population and genetic diseases in order to obtain up-to-date and accurate information regarding the population-specific variations and also useful for those in countries with similar ethnic background.
Getting Ready for the Human Phenome Project
DEFF Research Database (Denmark)
Oetting, William S; Robinson, Peter N; Greenblatt, Marc S
2013-01-01
A forum of the Human Variome Project (HVP) was held as a satellite to the 2012 Annual Meeting of the American Society of Human Genetics in San Francisco, California. The theme of this meeting was "Getting Ready for the Human Phenome Project". Understanding the genetic contribution to both rare si...... for studies attempting to identify novel disease genes or causative genetic variants. Improved systems and tools that enhance the collection of phenotype data from clinicians are urgently needed. This meeting begins the HVP's effort towards this important goal....... the impact of genetic variation on disease. To this end, there needs to be a greater sharing of phenotype and genotype data. For this to occur, the many databases that currently exist will need to become interoperable to allow for the combining of cohorts with similar phenotypes to increase statistical power...
Directory of Open Access Journals (Sweden)
B. Bennetts
2014-09-01
Full Text Available Despite the routine nature of comparing sequence variations identified during clinical testing to database records, few databases meet quality requirements for clinical diagnostics. To address this issue, The Royal College of Pathologists of Australasia (RCPA in collaboration with the Human Genetics Society of Australasia (HGSA, and the Human Variome Project (HVP is developing standards for DNA sequence variation databases intended for use in the Australian clinical environment. The outputs of this project will be promoted to other health systems and accreditation bodies by the Human Variome Project to support the development of similar frameworks in other jurisdictions.
Call for participation in the neurogenetics consortium within the Human Variome Project.
Haworth, Andrea; Bertram, Lars; Carrera, Paola; Elson, Joanna L; Braastad, Corey D; Cox, Diane W; Cruts, Marc; den Dunnen, Johann T; Farrer, Matthew J; Fink, John K; Hamed, Sherifa A; Houlden, Henry; Johnson, Dennis R; Nuytemans, Karen; Palau, Francesc; Rayan, Dipa L Raja; Robinson, Peter N; Salas, Antonio; Schüle, Birgitt; Sweeney, Mary G; Woods, Michael O; Amigo, Jorge; Cotton, Richard G H; Sobrido, Maria-Jesus
2011-08-01
The rate of DNA variation discovery has accelerated the need to collate, store and interpret the data in a standardised coherent way and is becoming a critical step in maximising the impact of discovery on the understanding and treatment of human disease. This particularly applies to the field of neurology as neurological function is impaired in many human disorders. Furthermore, the field of neurogenetics has been proven to show remarkably complex genotype-to-phenotype relationships. To facilitate the collection of DNA sequence variation pertaining to neurogenetic disorders, we have initiated the "Neurogenetics Consortium" under the umbrella of the Human Variome Project. The Consortium's founding group consisted of basic researchers, clinicians, informaticians and database creators. This report outlines the strategic aims established at the preliminary meetings of the Neurogenetics Consortium and calls for the involvement of the wider neurogenetic community in enabling the development of this important resource.
DEFF Research Database (Denmark)
Kohonen-Corish, Maija R J; Al-Aama, Jumana Y; Auerbach, Arleen D
2010-01-01
framework of HVP activities: Ethics; Nomenclature and Standards; Publication, Credit and Incentives; Data Collection from Clinics; Overall Data Integration and Access-Peripheral Systems/Software; Data Collection from Laboratories; Assessment of Pathogenicity; Country Specific Collection; Translation...... disease-specific variation data collection and utilization: the International Society for Gastrointestinal Hereditary Tumours, the Micronutrient Genomics Project, and the Neurogenetics Consortium....
Numerical investigation of finite-volume effects for the HVP
Boyle, Peter; Gülpers, Vera; Harrison, James; Jüttner, Andreas; Portelli, Antonin; Sachrajda, Christopher
2018-03-01
It is important to correct for finite-volume (FV) effects in the presence of QED, since these effects are typically large due to the long range of the electromagnetic interaction. We recently made the first lattice calculation of electromagnetic corrections to the hadronic vacuum polarisation (HVP). For the HVP, an analytical derivation of FV corrections involves a two-loop calculation which has not yet been carried out. We instead calculate the universal FV corrections numerically, using lattice scalar QED as an effective theory. We show that this method gives agreement with known analytical results for scalar mass FV effects, before applying it to calculate FV corrections for the HVP. This method for numerical calculation of FV effects is also widely applicable to quantities beyond the HVP.
Annotating the biomedical literature for the human variome.
Verspoor, Karin; Jimeno Yepes, Antonio; Cavedon, Lawrence; McIntosh, Tara; Herten-Crabb, Asha; Thomas, Zoë; Plazzer, John-Paul
2013-01-01
This article introduces the Variome Annotation Schema, a schema that aims to capture the core concepts and relations relevant to cataloguing and interpreting human genetic variation and its relationship to disease, as described in the published literature. The schema was inspired by the needs of the database curators of the International Society for Gastrointestinal Hereditary Tumours (InSiGHT) database, but is intended to have application to genetic variation information in a range of diseases. The schema has been applied to a small corpus of full text journal publications on the subject of inherited colorectal cancer. We show that the inter-annotator agreement on annotation of this corpus ranges from 0.78 to 0.95 F-score across different entity types when exact matching is measured, and improves to a minimum F-score of 0.87 when boundary matching is relaxed. Relations show more variability in agreement, but several are reliable, with the highest, cohort-has-size, reaching 0.90 F-score. We also explore the relevance of the schema to the InSiGHT database curation process. The schema and the corpus represent an important new resource for the development of text mining solutions that address relationships among patient cohorts, disease and genetic variation, and therefore, we also discuss the role text mining might play in the curation of information related to the human variome. The corpus is available at http://opennicta.com/home/health/variome.
Numerical investigation of finite-volume effects for the HVP
Directory of Open Access Journals (Sweden)
Boyle Peter
2018-01-01
Full Text Available It is important to correct for finite-volume (FV effects in the presence of QED, since these effects are typically large due to the long range of the electromagnetic interaction. We recently made the first lattice calculation of electromagnetic corrections to the hadronic vacuum polarisation (HVP. For the HVP, an analytical derivation of FV corrections involves a two-loop calculation which has not yet been carried out. We instead calculate the universal FV corrections numerically, using lattice scalar QED as an effective theory. We show that this method gives agreement with known analytical results for scalar mass FV effects, before applying it to calculate FV corrections for the HVP. This method for numerical calculation of FV effects is also widely applicable to quantities beyond the HVP.
Hayashi, K; Joko, H; Koirala, T R; Onoda, S; Jin, Z-S; Munemasa, M; Ohara, N; Oda, W; Tanaka, T; Oka, T; Kondo, E; Yoshino, T; Takahashi, K; Yamada, M; Akagi, T
2003-10-01
Epstein-Barr virus-associated hemophagocytic syndrome (EBV-AHS), which is often associated with fatal infectious mononucleosis or T-cell lymphoproliferative diseases (LPD), is a distinct disease characterized by high mortality. Treatment of patients with EBV-AHS has proved challenging. To develop some therapeutic interventions for EBV-AHS, we examined the effectiveness of an antiviral agent (vidarabine) or chemotherapy (CHOP), using a rabbit model for EBV-AHS. Fourteen untreated rabbits were inoculated intravenously with cell-free virions of the EBV-like virus Herpesvirus papio (HVP). All of the rabbits died of HVP-associated (LPD) and hemophagocytic syndrome (HPS) between 21 and 31 days after inoculation. Furthermore, three HVP-infected rabbits treated with vidarabine died between days 23 and 28 after inoculation, and their clinicopathological features were no different from those of untreated rabbits, indicating that this drug is not effective at all to treat HVP-induced rabbit LPD and HPS. Three of the infected rabbits that were treated with one course, with an incomplete set of three courses, or with three full courses of CHOP treatment died of HVP-induced LPD and HPS with a bleeding tendency and/or with opportunistic infections. They died on the 26th, 62nd and 105th day after virus inoculation, respectively. CHOP treatment transiently suppressed the HVP-induced LPD and contributed to the prolonged survival time of two infected rabbits. However, it did not remove all of the HVP-infected cells from the infected rabbits, and residual HVP-infected lymphocytes caused recurrences of rabbit LPD and HPS. The most interesting finding of this experiment was observed in the infected rabbit with the longest survival time of 105 days: HVP-negative lymphomas surrounded by HVP-induced LPD developed in the larynx and ileum of this rabbit, causing an obstruction of the lumen. We concluded that these were not secondary lymphomas caused by CHOP treatment, because no suspicious
Lattice study of finite volume effect in HVP for muon g-2
Directory of Open Access Journals (Sweden)
Izubuchi Taku
2018-01-01
Full Text Available We study the finite volume effect of the hadronic vacuum polarization contribution to muon g-2, aμhvp,in lattice QCD by comparison with two different volumes, L4 = (5.44 and (8.14 fm4, at physical pion. We perform the lattice computation of highly precise vector-vector current correlator with optimized AMA technique on Nf = 2 + 1 PACS gauge configurations in Wilson-clover fermion and stout smeared gluon action at one lattice cut-off, a−1 = 2.33 GeV. We compare two integrals of aμhvp, momentum integral and time-slice summation, on the lattice and numerically show that the different size of finite volume effect appears between two methods. We also discuss the effect of backward-state propagation into the result of aμhvp with the different boundary condition. Our model-independent study suggest that the lattice computation at physical pion is important for correct estimate of finite volume and other lattice systematics in aμhvp.
Lattice study of finite volume effect in HVP for muon g-2
Izubuchi, Taku; Kuramashi, Yoshinobu; Lehner, Christoph; Shintani, Eigo
2018-03-01
We study the finite volume effect of the hadronic vacuum polarization contribution to muon g-2, aμhvp, in lattice QCD by comparison with two different volumes, L4 = (5.4)4 and (8.1)4 fm4, at physical pion. We perform the lattice computation of highly precise vector-vector current correlator with optimized AMA technique on Nf = 2 + 1 PACS gauge configurations in Wilson-clover fermion and stout smeared gluon action at one lattice cut-off, a-1 = 2.33 GeV. We compare two integrals of aμhvp, momentum integral and time-slice summation, on the lattice and numerically show that the different size of finite volume effect appears between two methods. We also discuss the effect of backward-state propagation into the result of aμhvp with the different boundary condition. Our model-independent study suggest that the lattice computation at physical pion is important for correct estimate of finite volume and other lattice systematics in aμhvp.
Cotton, R G H; Auerbach, A D; Brown, A F; Carrera, P; Christodoulou, J; Claustres, M; Compton, J; Cox, D W; De Baere, E; den Dunnen, J T; Greenblatt, M; Fujiwara, M; Hilbert, P; Jani, A; Lehvaslaiho, H; Nebert, D W; Verma, I; Vihinen, M
2007-10-01
Researchers and clinicians ideally need instant access to all the variation in their gene/locus of interest to efficiently conduct their research and genetic healthcare to the highest standards. Currently much key data resides in the laboratory books or patient records around the world, as there are many impediments to submitting this data. It would be ideal therefore if a semiautomated pathway was available, with a minimum of effort, to make the deidentified data publicly available for others to use. The Human Variome Project (HVP) meeting listed 96 recommendations to work toward this situation. This article is planned to initiate a strategy to enhance the collection of phenotype and genotype data from the clinician/diagnostic laboratory nexus. Thus, the aim is to develop universally applicable forms that people can use when investigating patients for each inherited disease, to assist in satisfying many of the recommendations of the HVP Meeting [Cotton et al., 2007]. We call for comment and collaboration in this article. Copyright 2007 Wiley-Liss, Inc.
[DNA-dependent DNA polymerase induced by herpes virus papio (HVP) in producing cells].
D'iachenko, A G; Beriia, L Ia; Matsenko, L D; Kakubava, V V; Kokosh, L V
1980-11-01
A new DNA polymerase was found in the cells of suspension lymphoblastoid cultures, which produce lymphotropic baboon herpes virus (HVP). The enzyme was isolated in a partially purified form. In some properties the enzyme differs from other cellular DNA polymerases. The HVP-induced DNA polymerase has the molecular weight of 1,6 x 10(5) and sedimentation coefficient of about 8S. The enzyme is resistant to high salt concentrations and N-ethylmaleimide, but shows a pronounced sensitivity to phosphonoacetate. The enzyme effectively copies "activated" DNA and synthetic deoxyribohomopolymers. The attempts to detect the DNA polymerase activity in HVP virions were unsuccessful.
Voevodin, A F; Ponomarjeva, T I; Lapin, B A
1985-01-01
Seroepizootiology of Herpesvirus Papio (HVP) infection was studied in three groups of healthy hamadryas baboons (Papio hamadryas): the main Sukhumi (high-lymphoma) stock, forest Sukhumi (lymphoma-free) stock and newly imported wild animals. The prevalence to HVP infection, as judged by anti-VCA-HVP positivity, was approximately the same in both Sukhumi stocks (86% and 90% respectively) and it was significantly lower in the pooled group of newly imported baboons. It is interesting that prevalence of HVP infection in the different independent groups varied markedly (35-79%). Geometric mean titers of positives in all groups were approximately the same. The prevalence of HVP infection was age-dependent. It increased during the first years of life reaching the maximum (about 100%) at the age of 5 years being stable up to the age of 18 years and "decreased" at very old ages (over 18 years). The prevalence of HVP infection in newly imported baboons increased with age up to 71% in a group of the "oldest" monkeys and did not plateau. No significant sex differences in anti-HVP titers were found. Anti-EA-HVP-positive (with one exception) and anti-HUPNA-positive animals were found only in the main Sukhumi stock. Thus, "serologic activity" against HVP infection was the highest in the ligh-lymphoma stock.
Djachenko, A G; Lapin, B A
1981-01-01
A new DNA-polymerase was found in the cells of suspension lymphoblastoid cultures which produce lymphotropic baboon herpesvirus (HVP). This enzyme was isolated in a partially purified form. Some of its properties vary from those of other cellular DNA-polymerases. HVP-induced DNA-polymerase has a molecule weight of 160,000 and sedimentation coefficient of about 8 S. The enzyme is resistant to high salt concentration and N-ethylmaleimide, but it is very sensitive to phosphonoacetate. It effectively copies "activated" DNA and synthetic deoxyribohomopolymers. Attempts to reveal the DNA-polymerase activity in HVP virions were unsuccessful.
Lancaster, Owen; Beck, Tim; Atlan, David; Swertz, Morris; Thangavelu, Dhiwagaran; Veal, Colin; Dalgleish, Raymond; Brookes, Anthony J.
2015-01-01
Biomedical data sharing is desirable, but problematic. Data "discovery" approaches-which establish the existence rather than the substance of data-precisely connect data owners with data seekers, and thereby promote data sharing. Cafe Variome (http://www.cafevariome.org) was therefore designed to
Pan, Min; Cong, Peikuan; Wang, Yue; Lin, Changsong; Yuan, Ying; Dong, Jian; Banerjee, Santasree; Zhang, Tao; Chen, Yanling; Zhang, Ting; Chen, Mingqing; Hu, Peter; Zheng, Shu; Zhang, Jin; Qi, Ming
2011-12-01
The Human Variome Project (HVP) is an international consortium of clinicians, geneticists, and researchers from over 30 countries, aiming to facilitate the establishment and maintenance of standards, systems, and infrastructure for the worldwide collection and sharing of all genetic variations effecting human disease. The HVP-China Node will build new and supplement existing databases of genetic diseases. As the first effort, we have created a novel variant database of BRCA1 and BRCA2, mismatch repair genes (MMR), and APC genes for breast cancer, Lynch syndrome, and familial adenomatous polyposis (FAP), respectively, in the Chinese population using the Leiden Open Variation Database (LOVD) format. We searched PubMed and some Chinese search engines to collect all the variants of these genes in the Chinese population that have already been detected and reported. There are some differences in the gene variants between the Chinese population and that of other ethnicities. The database is available online at http://www.genomed.org/LOVD/. Our database will appear to users who survey other LOVD databases (e.g., by Google search, or by NCBI GeneTests search). Remote submissions are accepted, and the information is updated monthly. © 2011 Wiley Periodicals, Inc.
Norris, J S; Kohler, P O
1978-01-01
Two hamster cell lines have been isolated from androgen target tissue. The DDT1 cells derived from ductus deferens tissue exhibit a growth response to androgens, while the HVP cells derived from ventral prostate are androgen unresponsive. Both cell lines contain androgen receptors, that are similar when compared by kinetic methods, sedimentation velocity, chromatographic procedures or nuclear translocation ability. The forms of the high salt extracted nuclear receptors are indistinguishable chromatographically. Therefore, we postulate that the lesion preventing androgen induced growth in the HVP cell line is subseqent to nuclear translocation of the steroid receptor complex.
Voevodin, A F; Yakovleva, L A; Lapin, B A; Ponomarjeva, T I
1983-11-15
Antibody responses to Herpes virus papio (HVP) antigens were studied in 21 pre-lymphoma baboons (which subsequently died of malignant lymphoma), 21 paired controls, i.e. age-, sex- and population-matched healthy baboons, and 185 randomly selected healthy baboons of the same population. The sera were all collected at the same time and were tested blind in the fixed-cell indirect immunofluorescence test against HVP viral capsid antigen (VCA)-positive, early antigen (EA)-positive cell targets before and after absorption with HVP. Eleven of the pre-lymphoma sera were anti-EA-positive whereas none of the paired controls contained anti-EA. Anti-VCA titers of pre-lymphoma sera were higher than those of paired controls in thirteen cases. Only in four cases were anti-VCA titers of pre-lymphoma sera lower than those of paired controls. Qualitatively, the same results were obtained when anti-VCA and anti-EA titers of pre-lymphoma sera were compared with respective mean population values. The differences between pre-lymphoma group and control groups, especially in the case of anti-EA, were statistically highly significant. Thus, elevated anti-HVP titers in healthy baboons of the Sukhumi lymphoma-prone stock can be considered as a marker of high risk for development of malignant lymphoma.
Agrba, V Z; Lapin, B A; Timanovskaya, V V; Dzhachvliany, M C; Kokosha, L V; Chuvirov, G N; Djatchenko, A G
1980-01-01
Ways of lymphotropic baboon herpesvirus (HVP) secretion and its excretion into the environment were investigated. Oral swabs and feces from the Sukhumi main stock hamadryas baboons characterized by a high risk for malignant lymphoma and the baboon stock living in isolation in the forest were used as materials for the investigations. Macaque groups of the Sukhumi stock were used as controls. It could be shown that the HVP was resistent in the oral cavity of the main stock baboons and was isolated from oral swabs of these animals both from those with malignant lymphoma and clinically healthy individuals. No virus was isolated from feces of these animals. The virus could not be isolated from oral swabs of the isolated baboon stock and macaques.
Gao, Jian-Fei; Li, Chang-Sheng; Zhang, Bi-Cheng; Du, Guang-Zu; Zhang, Xin-Hua; Wang, Jun; Zhu, Yu-Ze; Ou, Wu-Ling; Yang, Bo
2004-04-01
Non-small cell lung cancer (NSCLC) is hyposensitive to the normal first and second-line chemotherapy regimens. Camptothecin derivative is becoming a hot point in the treatment of advanced NSCLC. The objective of this article was to evaluate the response, toxicity, and survival time of HMVP, MVP, and HVP regimens (detail in below) in the treatment of advanced NSCLC. A total of 134 cases with advanced NSCLC was randomized into three groups: HMVP group [46 patients, hydroxycamptothecin (HCPT) 12 mg/m(2) from d1 to d5, mitomycin C (MMC) 6 mg/m(2) d1, vindesine (VDS) 2.5-3 mg/m(2) d1 and d8, cisplatin (DDP) 50 mg/m(2) d2 and d3], MVP group (44 patients, MMC, VDS and DDP were the same as HMVP group) and HVP group (44 patients, HCPT, VDS, DDP were the same as HMVP group). The response rates were 39.54% (17/43), 35.57% (15/42), and 26.19% (11/42) in HMVP, MVP, and HVP groups, respectively; no significant difference was detected among the three groups (P >0.05). No significant difference was detected in the median time of remission, median survival time, and 1-, 2-year survival rates among the three groups. Moreover, no significant difference was detected in grade III-IV leukopenia, grade III-IV thrombocytopenia, grade III-IV nausea and vomiting and grade III-IV constipation among the three groups. The response rate of MVP regimen is slightly lower than that of HMVP regimen, but HMVP regimen do not show obvious superiority. It may increase toxicities such as leukopenia, nausea/vomiting, and constipation. The response rate of HVP regimen is slightly lower than that of MVP regimen.
Ohno, S; Luka, J; Falk, L; Klein, G
1977-12-15
In agreement with the findings of previous authors, we could not detect a virally determined nuclear antigen in Herpesvirus papio (HVP)-transformed baboon lymphoid lines by anticomplementary staining in situ, as for EBNA. However, by means of our recently developed acid-fixed nuclear binding technique an EBNA-like antigen could be readily demonstrated, after extraction from both producer and non-producer lines. We propose to designate the antigen as HUPNA. It can be detected by a human anti-EBNA antibody, suggesting cross-reactivity, if not identity, between EBNA and HUPNA. HVP-DNA carrying non-producer lines, negative for in situ ACIF stainability but capable of yielding HUPNA by the nuclear binding technique, can be superinfected with EBV, with brilliant EBNA expression as the result, suggesting that the defective in situ staining is a property associated with the baboon HVP, rather than the baboon lymphoid cell per se.
Pion mass dependence of the HVP contribution to muon g - 2
Golterman, Maarten; Maltman, Kim; Peris, Santiago
2018-03-01
One of the systematic errors in some of the current lattice computations of the HVP contribution to the muon anomalous magnetic moment g - 2 is that associated with the extrapolation to the physical pion mass. We investigate this extrapolation assuming lattice pion masses in the range of 220 to 440 MeV with the help of two-loop chiral perturbation theory, and find that such an extrapolation is unlikely to lead to control of this systematic error at the 1% level. This remains true even if various proposed tricks to improve the chiral extrapolation are taken into account.
Pion mass dependence of the HVP contribution to muon g – 2
Directory of Open Access Journals (Sweden)
Golterman Maarten
2018-01-01
Full Text Available One of the systematic errors in some of the current lattice computations of the HVP contribution to the muon anomalous magnetic moment g – 2 is that associated with the extrapolation to the physical pion mass. We investigate this extrapolation assuming lattice pion masses in the range of 220 to 440 MeV with the help of two-loop chiral perturbation theory, and find that such an extrapolation is unlikely to lead to control of this systematic error at the 1% level. This remains true even if various proposed tricks to improve the chiral extrapolation are taken into account.
Planning the human variome project: the Spain report.
Kaput, J.; Cotton, R.G.; Hardman, L.; Watson, M.; Aqeel, A.I. Al; Al-Aama, J.Y.; Al-Mulla, F.; Alonso, S.; Aretz, S.; Auerbach, A.D.; Bapat, B.; Bernstein, I.T.; Bhak, J.; Bleoo, S.L.; Blocker, H.; Brenner, S.E.; Burn, J.; Bustamante, M.; Calzone, R.; Cambon-Thomsen, A.; Cargill, M.; Carrera, P.; Cavedon, L.; Cho, Y.S.; Chung, Y.J.; Claustres, M.; Cutting, G.; Dalgleish, R.; Dunnen, J.T. den; Diaz, C.; Dobrowolski, S.; Santos, M.R. dos; Ekong, R.; Flanagan, S.B.; Flicek, P.; Furukawa, Y.; Genuardi, M.; Ghang, H.; Golubenko, M.V.; Greenblatt, M.S.; Hamosh, A.; Hancock, J.M.; Hardison, R.; Harrison, T.M.; Hoffmann, R.; Horaitis, R.; Howard, H.J.; Barash, C.I.; Izagirre, N.; Jung, J.; Kojima, T.; Laradi, S.; Lee, Y.S.; Lee, J.Y.; Gil-da-Silva-Lopes, V.L.; Macrae, F.A.; Maglott, D.; Marafie, M.J.; Marsh, S.G.; Matsubara, Y.; Messiaen, L.M.; Moslein, G.; Netea, M.G.; Norton, M.L.; Oefner, P.J.; Oetting, W.S.; O'Leary, J.C.; Ramirez, A.M. de; Paalman, M.H.; Parboosingh, J.; Patrinos, G.P.; Perozzi, G.; Phillips, I.R.; Povey, S.; Prasad, S.; Qi, M.; Quin, D.J.; Ramesar, R.S.; Richards, C.S.; Savige, J.; Scheible, D.G.; Scott, R.J.; Seminara, D.; Shephard, E.A.; Sijmons, R.H.; Smith, T.D.; Sobrido, M.J.; Tanaka, T.; Tavtigian, S.V.; Taylor, G.R.; Teague, J.; Topel, T.; Ullman-Cullere, M.; Utsunomiya, J.; Kranen, H.J. van; Vihinen, M.; Webb, E.; Weber, T.K.; Yeager, M.
2009-01-01
The remarkable progress in characterizing the human genome sequence, exemplified by the Human Genome Project and the HapMap Consortium, has led to the perception that knowledge and the tools (e.g., microarrays) are sufficient for many if not most biomedical research efforts. A large amount of data
Planning the Human Variome Project : The Spain Report
Kaput, Jim; Cotton, Richard G. H.; Hardman, Lauren; Watson, Michael; Al Aqeel, Aida I.; Al-Aama, Jumana Y.; Al-Mulla, Fahd; Alonso, Santos; Aretz, Stefan; Auerbach, Arleen D.; Bapat, Bharati; Bernstein, Inge T.; Bhak, Jong; Bleoo, Stacey L.; Bloecker, Helmut; Brenner, Steven E.; Burn, John; Bustamante, Mariona; Calone, Rita; Cambon-Thomsen, Anne; Cargill, Michele; Carrera, Paola; Cavedon, Lawrence; Cho, Yoon Shin; Chung, Yeun-Jun; Claustres, Mireille; Cutting, Garry; Dalgleish, Raymond; den Dunnen, Johan T.; Diaz, Carlos; Dobrowolski, Steven; dos Santos, M. Rosario N.; Ekong, Rosemary; Flanagan, Simon B.; Flicek, Paul; Furukawa, Yoichi; Genuardi, Maurizio; Ghang, Ho; Golubenko, Maria V.; Greenblatt, Marc S.; Hamosh, Ada; Hancock, John M.; Hardison, Ross; Harrison, Terence M.; Hoffmann, Robert; Horaitis, Rania; Howard, Heather J.; Barash, Carol Isaacson; Izagirre, Neskuts; Sijmons, Rolf H.
The remarkable progress in characterizing the human genome sequence, exemplified by the Human Genome Project and the HapMap Consortium, has led to the perception that knowledge and the tools (e.g., microarrays) are sufficient for many if not most biomedical research efforts. A large amount of data
Planning the human variome project: the Spain report
DEFF Research Database (Denmark)
Kaput, Jim; Cotton, Richard G H; Hardman, Lauren
2009-01-01
The remarkable progress in characterizing the human genome sequence, exemplified by the Human Genome Project and the HapMap Consortium, has led to the perception that knowledge and the tools (e.g., microarrays) are sufficient for many if not most biomedical research efforts. A large amount of dat...
Planning the human variome project: the Spain report.
Kaput, Jim; Cotton, Richard G H; Hardman, Lauren; Watson, Michael; Al Aqeel, Aida I; Al-Aama, Jumana Y; Al-Mulla, Fahd; Alonso, Santos; Aretz, Stefan; Auerbach, Arleen D; Bapat, Bharati; Bernstein, Inge T; Bhak, Jong; Bleoo, Stacey L; Blöcker, Helmut
2009-01-01
The remarkable progress in characterizing the human genome sequence, exemplified by the Human Genome Project and the HapMap Consortium, has led to the perception that knowledge and the tools (e.g., microarrays) are sufficient for many if not most biomedical research efforts. A large amount of data from diverse studies proves this perception inaccurate at best, and at worst, an impediment for further efforts to characterize the variation in the human genome. Because variation in genotype and e...
HGVS Recommendations for the Description of Sequence Variants: 2016 Update.
den Dunnen, Johan T; Dalgleish, Raymond; Maglott, Donna R; Hart, Reece K; Greenblatt, Marc S; McGowan-Jordan, Jean; Roux, Anne-Francoise; Smith, Timothy; Antonarakis, Stylianos E; Taschner, Peter E M
2016-06-01
The consistent and unambiguous description of sequence variants is essential to report and exchange information on the analysis of a genome. In particular, DNA diagnostics critically depends on accurate and standardized description and sharing of the variants detected. The sequence variant nomenclature system proposed in 2000 by the Human Genome Variation Society has been widely adopted and has developed into an internationally accepted standard. The recommendations are currently commissioned through a Sequence Variant Description Working Group (SVD-WG) operating under the auspices of three international organizations: the Human Genome Variation Society (HGVS), the Human Variome Project (HVP), and the Human Genome Organization (HUGO). Requests for modifications and extensions go through the SVD-WG following a standard procedure including a community consultation step. Version numbers are assigned to the nomenclature system to allow users to specify the version used in their variant descriptions. Here, we present the current recommendations, HGVS version 15.11, and briefly summarize the changes that were made since the 2000 publication. Most focus has been on removing inconsistencies and tightening definitions allowing automatic data processing. An extensive version of the recommendations is available online, at http://www.HGVS.org/varnomen. © 2016 WILEY PERIODICALS, INC.
Delta-1-pyrroline-5-carboxylate synthase gene1 (P5CS1) is the key gene involved in the biosynthesis of proline and is significantly induced by drought stress. The exploration of genetic variation in HvP5CS1 may facilitate a better understanding of the mechanism of drought adaptation in barley. In th...
Patrinos, George P; Al Aama, Jumana; Al Aqeel, Aida; Al-Mulla, Fahd; Borg, Joseph; Devereux, Andrew; Felice, Alex E; Macrae, Finlay; Marafie, Makia J; Petersen, Michael B; Qi, Ming; Ramesar, Rajkumar S; Zlotogora, Joel; Cotton, Richard GH
2011-01-01
Developing countries have significantly contributed to the elucidation of the genetic basis of both common and rare disorders, providing an invaluable resource of cases due to large family sizes, consanguinity, and potential founder effects. Moreover, the recognized depth of genomic variation in indigenous African populations, reflecting the ancient origins of humanity on the African continent, and the effect of selection pressures on the genome, will be valuable in understanding the range of both pathological and nonpathological variations. The involvement of these populations in accurately documenting the extant genetic heterogeneity is more than essential. Developing nations are regarded as key contributors to the Human Variome Project (HVP; http://www.humanvariomeproject.org), a major effort to systematically collect mutations that contribute to or cause human disease and create a cyber infrastructure to tie databases together. However, biomedical research has not been the primary focus in these countries even though such activities are likely to produce economic and health benefits for all. Here, we propose several recommendations and guidelines to facilitate participation of developing countries in genetic variation data documentation, ensuring an accurate and comprehensive worldwide data collection. We also summarize a few well-coordinated genetic data collection initiatives that would serve as paradigms for similar projects. Hum Mutat 31:1–8, 2010. © 2010 Wiley-Liss, Inc. PMID:21089065
Voevodin, A F; Lapin, B A; Agrba, V Z; Timanovskaya, V V
1978-01-01
A new technique (indirect double immunodiffusion) for detection of EBV-associated soluble antigen and corresponding antibodies has been developed. This technique includes three steps: 1) simple double immunodiffusion with extracts of Raji cells (or other EBV-genome positive cells) and human sera containing antibodies against EBV-associated soluble antigen; 2) extensive washing and treatment with anti-human globulin; 3) extensive washing and treatment with tannic acid. Using this test it was shown that the soluble antigen indistinguishable from EBV-associated soluble antigen was present in KMPG-1 cells producing HVP.
Yahya, Padillah; Sulong, Sarina; Harun, Azian; Wan Isa, Hatin; Ab Rajab, Nur-Shafawati; Wangkumhang, Pongsakorn; Wilantho, Alisa; Ngamphiw, Chumpol; Tongsima, Sissades; Zilfalil, Bin Alwi
2017-09-01
Malay, the main ethnic group in Peninsular Malaysia, is represented by various sub-ethnic groups such as Melayu Banjar, Melayu Bugis, Melayu Champa, Melayu Java, Melayu Kedah Melayu Kelantan, Melayu Minang and Melayu Patani. Using data retrieved from the MyHVP (Malaysian Human Variome Project) database, a total of 135 individuals from these sub-ethnic groups were profiled using the Affymetrix GeneChip Mapping Xba 50-K single nucleotide polymorphism (SNP) array to identify SNPs that were ancestry-informative markers (AIMs) for Malays of Peninsular Malaysia. Prior to selecting the AIMs, the genetic structure of Malays was explored with reference to 11 other populations obtained from the Pan-Asian SNP Consortium database using principal component analysis (PCA) and ADMIXTURE. Iterative pruning principal component analysis (ipPCA) was further used to identify sub-groups of Malays. Subsequently, we constructed an AIMs panel for Malays using the informativeness for assignment (I n ) of genetic markers, and the K-nearest neighbor classifier (KNN) was used to teach the classification models. A model of 250 SNPs ranked by I n , correctly classified Malay individuals with an accuracy of up to 90%. The identified panel of SNPs could be utilized as a panel of AIMs to ascertain the specific ancestry of Malays, which may be useful in disease association studies, biomedical research or forensic investigation purposes. Copyright © 2017 Elsevier B.V. All rights reserved.
Lancaster, Owen; Beck, Tim; Atlan, David; Swertz, Morris; Thangavelu, Dhiwagaran; Veal, Colin; Dalgleish, Raymond; Brookes, Anthony J
2015-10-01
Biomedical data sharing is desirable, but problematic. Data "discovery" approaches-which establish the existence rather than the substance of data-precisely connect data owners with data seekers, and thereby promote data sharing. Cafe Variome (http://www.cafevariome.org) was therefore designed to provide a general-purpose, Web-based, data discovery tool that can be quickly installed by any genotype-phenotype data owner, or network of data owners, to make safe or sensitive content appropriately discoverable. Data fields or content of any type can be accommodated, from simple ID and label fields through to extensive genotype and phenotype details based on ontologies. The system provides a "shop window" in front of data, with main interfaces being a simple search box and a powerful "query-builder" that enable very elaborate queries to be formulated. After a successful search, counts of records are reported grouped by "openAccess" (data may be directly accessed), "linkedAccess" (a source link is provided), and "restrictedAccess" (facilitated data requests and subsequent provision of approved records). An administrator interface provides a wide range of options for system configuration, enabling highly customized single-site or federated networks to be established. Current uses include rare disease data discovery, patient matchmaking, and a Beacon Web service. © 2015 WILEY PERIODICALS, INC.
HVP contributions to the muon (g-2) including QED corrections with twisted-mass fermions
Giusti, Davide; Lubicz, Vittorio; Martinelli, Guido; Sanfilippo, Francesco; Simula, Silvano
2018-03-01
We present a lattice calculation of the Hadronic Vacuum Polarization (HVP) contribution of the strange and charm quarks to the anomalous magnetic moment of the muon including leading-order electromagnetic (e.m.) corrections. We employ the gauge configurations generated by the European Twisted Mass Collaboration (ETMC) with Nf = 2+1 + 1 dynamical quarks at three values of the lattice spacing (a ≃ 0.062,0.082,0.089 fm) with pion masses in the range Mπ ≃ 210 - 450 MeV. The strange and charm quark masses are tuned at their physical values. Neglecting discon-nected diagrams and after the extrapolations to the physical pion mass and to the continuum limit we obtain: aμs(αem2) = (53.1 ± 2.5 )×10-10, aμs(αem2) = (-0.018 ± 0.011)×10-10 and aμs(αem2) = (14.75±0.56)×10-10,aμs(αem2) = (-0.030±0.013)×10-10 for the strange and charm contributions, respectively.!
HVP contributions to the muon (g−2 including QED corrections with twisted-mass fermions
Directory of Open Access Journals (Sweden)
Giusti Davide
2018-01-01
Full Text Available We present a lattice calculation of the Hadronic Vacuum Polarization (HVP contribution of the strange and charm quarks to the anomalous magnetic moment of the muon including leading-order electromagnetic (e.m. corrections. We employ the gauge configurations generated by the European Twisted Mass Collaboration (ETMC with Nf = 2+1 + 1 dynamical quarks at three values of the lattice spacing (a ≃ 0.062,0.082,0.089 fm with pion masses in the range Mπ ≃ 210 - 450 MeV. The strange and charm quark masses are tuned at their physical values. Neglecting discon-nected diagrams and after the extrapolations to the physical pion mass and to the continuum limit we obtain: aμsαem2=53.1±2.5⋅10−10,aμsαem3=−0.018±0.011⋅10−10 and aμcαem2=14.75±0.56⋅10−10,aμcαem3=−0.030±0.013⋅10−10 for the strange and charm contributions, respectively.!
3-MCPD in food other than soy sauce or hydrolysed vegetable protein (HVP).
Baer, Ines; de la Calle, Beatriz; Taylor, Philip
2010-01-01
This review gives an overview of current knowledge about 3-monochloropropane-1,2-diol (3-MCPD) formation and detection. Although 3-MCPD is often mentioned with regard to soy sauce and acid-hydrolysed vegetable protein (HVP), and much research has been done in that area, the emphasis here is placed on other foods. This contaminant can be found in a great variety of foodstuffs and is difficult to avoid in our daily nutrition. Despite its low concentration in most foods, its carcinogenic properties are of general concern. Its formation is a multivariate problem influenced by factors such as heat, moisture and sugar/lipid content, depending on the type of food and respective processing employed. Understanding the formation of this contaminant in food is fundamental to not only preventing or reducing it, but also developing efficient analytical methods of detecting it. Considering the differences between 3-MCPD-containing foods, and the need to test for the contaminant at different levels of food processing, one would expect a variety of analytical approaches. In this review, an attempt is made to provide an up-to-date list of available analytical methods and to highlight the differences among these techniques. Finally, the emergence of 3-MCPD esters and analytical techniques for them are also discussed here, although they are not the main focus of this review.
Connecting the Human Variome Project to nutrigenomics
Kaput, J.; Evelo, C.T.; Perozzi, G.; Ommen, B. van; Cotton, R.
2010-01-01
Nutrigenomics is the science of analyzing and understanding gene-nutrient interactions, which because of the genetic heterogeneity, varying degrees of interaction among gene products, and the environmental diversity is a complex science. Although much knowledge of human diversity has been
Giusti, D.; Lubicz, V.; Martinelli, G.; Sanfilippo, F.; Simula, S.
2017-10-01
We present a lattice calculation of the Hadronic Vacuum Polarization (HVP) contribution of the strange and charm quarks to the anomalous magnetic moment of the muon including leading-order electromagnetic corrections. We employ the gauge configurations generated by the European Twisted Mass Collaboration (ETMC) with N f = 2 + 1 + 1 dynamical quarks at three values of the lattice spacing ( a ≃ 0 .062 , 0 .082 , 0 .089 fm) with pion masses in the range M π ≃ 210-450 MeV. The strange and charm quark masses are tuned at their physical values. Neglecting disconnected diagrams and after the extrapolations to the physical pion mass and to the continuum limit we obtain: a μ s ( α em 2 ) = (53.1 ± 2.5) · 10- 10, a μ s ( α em 3 ) = (-0.018 ± 0.011) · 10- 10 and a μ c ( α em 2 ) = (14.75 ± 0.56) · 10- 10, a μ c ( α em 3 ) = (-0.030 ± 0.013) · 10- 10 for the strange and charm contributions, respectively.
Strong coupling constant from Adler function in lattice QCD
Hudspith, Renwick J.; Lewis, Randy; Maltman, Kim; Shintani, Eigo
2016-09-01
We compute the QCD coupling constant, αs, from the Adler function with vector hadronic vacuum polarization (HVP) function. On the lattice, Adler function can be measured by the differential of HVP at two different momentum scales. HVP is measured from the conserved-local vector current correlator using nf = 2 + 1 flavor Domain Wall lattice data with three different lattice cutoffs, up to a-1 ≈ 3.14 GeV. To avoid the lattice artifact due to O(4) symmetry breaking, we set the cylinder cut on the lattice momentum with reflection projection onto vector current correlator, and it then provides smooth function of momentum scale for extracted HVP. We present a global fit of the lattice data at a justified momentum scale with three lattice cutoffs using continuum perturbation theory at 𝒪(αs4) to obtain the coupling in the continuum limit at arbitrary scale. We take the running to Z boson mass through the appropriate thresholds, and obtain αs(5)(MZ) = 0.1191(24)(37) where the first is statistical error and the second is systematic one.
Luo, Chenglong; Qu, Hao; Wang, Jie; Wang, Yan; Ma, Jie; Li, Chunyu; Yang, Chunfen; Hu, Xiaoxiang; Li, Ning; Shu, Dingming
2013-05-16
Hyperpigmentation of the visceral peritoneum (HVP) has recently garnered much attention in the poultry industry because of the possible risk to the health of affected animals and the damage it causes to the appearance of commercial chicken carcasses. However, the heritable characters of HVP remain unclear. The objective of this study was to investigate the genetic parameters of HVP by genome-wide association study (GWAS) in chickens. HVP was found to be influenced by genetic factors, with a heritability score of 0.33. HVP had positive genetic correlations with growth and carcass traits, such as leg muscle weight (rg = 0.34), but had negative genetic correlations with immune traits, such as the antibody response to Newcastle disease virus (rg = -0.42). The GWAS for HVP using 39,833 single nucleotide polymorphisms indicated the genetic factors associated with HVP displayed an additive effect rather than a dominance effect. In addition, we determined that three genomic regions, involving the 50.5-54.0 Mb region of chicken (Gallus gallus) chromosome 1 (GGA1), the 58.5-60.5 Mb region of GGA1, and the 10.5-12.0 Mb region of GGA20, were strongly associated (P HVP in chickens. Variants in these regions explained >50% of additive genetic variance for HVP. This study also confirmed that expression of BMP7, which codes for a bone morphogenetic protein and is located in one of the candidate regions, was significantly higher in the visceral peritoneum of Huiyang Beard chickens with HVP than in that of chickens without pigmentation (P HVP is a quantitative trait with moderate heritability. Genomic variants resulting in HVP were identified on GGA1 and GGA20, and expression of the BMP7 gene appears to be upregulated in HVP-affected chickens. Findings from this study should be used as a basis for further functional validation of candidate genes involved in HVP.
Structure, mechanical and corrosion properties of powdered stainless steel Kh13
International Nuclear Information System (INIS)
Radomysel'skij, I.D.; Napara-Volgina, S.G.; Orlova, L.N.; Apininskaya, L.M.
1982-01-01
Structure, mechanical and corrosion properties are studied for compact powdered stainless steel, Grade Kh13, produced from prealloyed powder and a mixture of chromium and iron powders by hot vacuum pressing (HVP) following four schemes: HVP of unsintered billets; HVP of presintered billets; HVP of unsintered billets followed by diffusion annealing; HVP of sintered billets followed by diffusion annealing. Analysis of the structure, mechanical and corrosion properties of Kh13 steel produced according to the four schemes confirmed that production of this steel by the HVP method without presintering of porous billets and diffusion annealing of compact stampings is possible only when prealloyed powder of particular composition is used as a starting material
Howe, J G; Shu, M D
1988-08-01
Genes for the Epstein-Barr virus-encoded RNAs (EBERs), two low-molecular-weight RNAs encoded by the human gammaherpesvirus Epstein-Barr virus (EBV), hybridize to two small RNAs in a baboon cell line that contains a similar virus, herpesvirus papio (HVP). The genes for the HVP RNAs (HVP-1 and HVP-2) are located together in the small unique region at the left end of the viral genome and are transcribed by RNA polymerase III in a rightward direction, similar to the EBERs. There is significant similarity between EBER1 and HVP-1 RNA, except for an insert of 22 nucleotides which increases the length of HVP-1 RNA to 190 nucleotides. There is less similarity between the sequences of EBER2 and HVP-2 RNA, but both have a length of about 170 nucleotides. The predicted secondary structure of each HVP RNA is remarkably similar to that of the respective EBER, implying that the secondary structures are important for function. Upstream from the initiation sites of all four RNA genes are several highly conserved sequences which may function in the regulation of transcription. The HVP RNAs, together with the EBERs, are highly abundant in transformed cells and are efficiently bound by the cellular La protein.
Smart biomaterials: Surfaces functionalized with proteolytically stable osteoblast-adhesive peptides
Directory of Open Access Journals (Sweden)
Annj Zamuner
2017-09-01
Full Text Available Engineered scaffolds for bone tissue regeneration are designed to promote cell adhesion, growth, proliferation and differentiation. Recently, covalent and selective functionalization of glass and titanium surfaces with an adhesive peptide (HVP mapped on [351–359] sequence of human Vitronectin allowed to selectively increase osteoblast attachment and adhesion strength in in vitro assays, and to promote osseointegration in in vivo studies. For the first time to our knowledge, in this study we investigated the resistance of adhesion sequences to proteolytic digestion: HVP was completely cleaved after 5 h. In order to overcome the enzymatic degradation of the native peptide under physiological conditions we synthetized three analogues of HVP sequence. A retro-inverted peptide D-2HVP, composed of D amino acids, was completely stable in serum-containing medium. In addition, glass surfaces functionalized with D-2HVP increased human osteoblast adhesion as compared to the native peptide and maintained deposition of calcium. Interestingly, D-2HVP increased expression of IBSP, VTN and SPP1 genes as compared to HVP functionalized surfaces. Total internal reflection fluorescence microscope analysis showed cells with numerous filopodia spread on D-2HVP-functionalized surfaces. Therefore, the D-2HVP sequence is proposed as new osteoblast adhesive peptide with increased bioactivity and high proteolytic resistance.
Zamuner, Annj; Brun, Paola; Scorzeto, Michele; Sica, Giuseppe; Castagliuolo, Ignazio; Dettin, Monica
2017-09-01
Engineered scaffolds for bone tissue regeneration are designed to promote cell adhesion, growth, proliferation and differentiation. Recently, covalent and selective functionalization of glass and titanium surfaces with an adhesive peptide (HVP) mapped on [351-359] sequence of human Vitronectin allowed to selectively increase osteoblast attachment and adhesion strength in in vitro assays, and to promote osseointegration in in vivo studies. For the first time to our knowledge, in this study we investigated the resistance of adhesion sequences to proteolytic digestion: HVP was completely cleaved after 5 h. In order to overcome the enzymatic degradation of the native peptide under physiological conditions we synthetized three analogues of HVP sequence. A retro-inverted peptide D-2HVP, composed of D amino acids, was completely stable in serum-containing medium. In addition, glass surfaces functionalized with D-2HVP increased human osteoblast adhesion as compared to the native peptide and maintained deposition of calcium. Interestingly, D-2HVP increased expression of IBSP, VTN and SPP1 genes as compared to HVP functionalized surfaces. Total internal reflection fluorescence microscope analysis showed cells with numerous filopodia spread on D-2HVP-functionalized surfaces. Therefore, the D-2HVP sequence is proposed as new osteoblast adhesive peptide with increased bioactivity and high proteolytic resistance.
The genome of herpesvirus papio 2 is closely related to the genomes of human herpes simplex viruses.
Bigger, John E; Martin, David W
2003-06-01
Infection of baboons (Papio species) with herpesvirus papio 2 (HVP-2) produces a disease that is clinically similar to herpes simplex virus (HSV-1 and HSV-2) infection of humans. The development of a primate model of simplexvirus infection based on HVP-2 would provide a powerful resource to study virus biology and test vaccine strategies. In order to characterize the molecular biology of HVP-2 and justify further development of this model system we have constructed a physical map of the HVP-2 genome. The results of these studies have identified the presence of 26 reading frames that closely resemble HSV homologues. Furthermore, the HVP-2 genome shares a collinear arrangement with the genome of HSV. These studies further validate the development of the HVP-2 model as a surrogate system to study the biology of HSV infections.
Rabbit Model for Human EBV-Associated Hemophagocytic Syndrome (HPS)
Hayashi, Kazuhiko; Jin, Zaishun; Onoda, Sachiyo; Joko, Hiromasa; Teramoto, Norihiro; Ohara, Nobuya; Oda, Wakako; Tanaka, Takehiro; Liu, Yi-Xuan; Koirala, Tirtha Raj; Oka, Takashi; Kondo, Eisaku; Yoshino, Tadashi; Takahashi, Kiyoshi; Akagi, Tadaatsu
2003-01-01
Epstein-Barr virus-associated hemophagocytic syndrome (EBV-AHS) is often associated with fatal infectious mononucleosis or T-cell lymphoproliferative diseases (LPD). To elucidate the true nature of fatal LPD observed in Herpesvirus papio (HVP)-induced rabbit hemophagocytosis, reactive or neoplastic, we analyzed sequential development of HVP-induced rabbit LPD and their cell lines. All of the seven Japanese White rabbits inoculated intravenously with HVP died of fatal LPD 18 to 27 days after inoculation. LPD was also accompanied by hemophagocytic syndrome (HPS) in five of these seven rabbits. Sequential autopsy revealed splenomegaly and swollen lymph nodes, often accompanied by bleeding, which developed in the last week. Atypical lymphoid cells infiltrated many organs with a “starry sky” pattern, frequently involving the spleen, lymph nodes, and liver. HVP-small RNA-1 expression in these lymphoid cells was clearly demonstrated by a newly developed in situ hybridization (ISH) system. HVP-ISH of immunomagnetically purified lymphoid cells from spleen or lymph nodes revealed HVP-EBER1+ cells in each CD4+, CD8+, or CD79a+ fraction. Hemophagocytic histiocytosis was observed in the lymph nodes, spleen, bone marrow, and thymus. HVP-DNA was detected in the tissues and peripheral blood from the infected rabbits by PCR or Southern blot analysis. Clonality analysis of HVP-induced LPD by Southern blotting with TCR gene probe revealed polyclonal bands, suggesting polyclonal proliferation. Six IL-2-dependent rabbit T-cell lines were established from transplanted scid mouse tumors from LPD. These showed latency type I/II HVP infection and had normal karyotypes except for one line, and three of them showed tumorigenicity in nude mice. These data suggest that HVP-induced fatal LPD in rabbits is reactive polyclonally in nature. PMID:12707056
Hayashi, Kazuhiko; Jin, Zaishun; Onoda, Sachiyo; Joko, Hiromasa; Teramoto, Norihiro; Ohara, Nobuya; Oda, Wakako; Tanaka, Takehiro; Liu, Yi-Xuan; Koirala, Tirtha Raj; Oka, Takashi; Kondo, Eisaku; Yoshino, Tadashi; Takahashi, Kiyoshi; Akagi, Tadaatsu
2003-05-01
Epstein-Barr virus-associated hemophagocytic syndrome (EBV-AHS) is often associated with fatal infectious mononucleosis or T-cell lymphoproliferative diseases (LPD). To elucidate the true nature of fatal LPD observed in Herpesvirus papio (HVP)-induced rabbit hemophagocytosis, reactive or neoplastic, we analyzed sequential development of HVP-induced rabbit LPD and their cell lines. All of the seven Japanese White rabbits inoculated intravenously with HVP died of fatal LPD 18 to 27 days after inoculation. LPD was also accompanied by hemophagocytic syndrome (HPS) in five of these seven rabbits. Sequential autopsy revealed splenomegaly and swollen lymph nodes, often accompanied by bleeding, which developed in the last week. Atypical lymphoid cells infiltrated many organs with a "starry sky" pattern, frequently involving the spleen, lymph nodes, and liver. HVP-small RNA-1 expression in these lymphoid cells was clearly demonstrated by a newly developed in situ hybridization (ISH) system. HVP-ISH of immunomagnetically purified lymphoid cells from spleen or lymph nodes revealed HVP-EBER1+ cells in each CD4+, CD8+, or CD79a+ fraction. Hemophagocytic histiocytosis was observed in the lymph nodes, spleen, bone marrow, and thymus. HVP-DNA was detected in the tissues and peripheral blood from the infected rabbits by PCR or Southern blot analysis. Clonality analysis of HVP-induced LPD by Southern blotting with TCR gene probe revealed polyclonal bands, suggesting polyclonal proliferation. Six IL-2-dependent rabbit T-cell lines were established from transplanted scid mouse tumors from LPD. These showed latency type I/II HVP infection and had normal karyotypes except for one line, and three of them showed tumorigenicity in nude mice. These data suggest that HVP-induced fatal LPD in rabbits is reactive polyclonally in nature.
Plasmid origin of replication of herpesvirus papio: DNA sequence and enhancer function.
Loeb, D D; Sung, N S; Pesano, R L; Sexton, C J; Hutchison, C; Pagano, J S
1990-01-01
Herpesvirus papio (HVP) is a lymphotropic virus of baboons which is related to Epstein-Barr virus (EBV) and produces latent infection. The nucleotide sequence of the 5,775-base-pair (bp) EcoRI K fragment of HVP, which has previously been shown to confer the ability to replicate autonomously, has been determined. Within this DNA fragment is a region which bears structural and sequence similarity to the ori-P region of EBV. The HVP ori-P region has a 10- by 26-bp tandem array which is related to the 20- by 30-bp tandem array from the EBV ori-P region. In HVP there is an intervening region of 764 bp followed by five partial copies of the 26-bp monomer. Both the EBV and HVP 3' regions have the potential to form dyad structures which, however, differ in arrangement. We also demonstrate that a transcriptional enhancer which requires transactivation by a virus-encoded factor is present in the HVP ori-P. Images PMID:2159548
Goecke, Tobias; Fischer, Christian S.; Williams, Richard
2011-10-01
We present a calculation of the hadronic vacuum polarisation (HVP) tensor within the framework of Dyson-Schwinger equations. To this end we use a well-established phenomenological model for the quark-gluon interaction with parameters fixed to reproduce hadronic observables. From the HVP tensor we compute both the Adler function and the HVP contribution to the anomalous magnetic moment of the muon, aμ. We find aμHVP = 6760 ×10-11 which deviates about two percent from the value extracted from experiment. Additionally, we make comparison with a recent lattice determination of aμHVP and find good agreement within our approach. We also discuss the implications of our result for a corresponding calculation of the hadronic light-by-light scattering contribution to aμ.
International Nuclear Information System (INIS)
Goecke, Tobias; Fischer, Christian S.; Williams, Richard
2011-01-01
We present a calculation of the hadronic vacuum polarisation (HVP) tensor within the framework of Dyson-Schwinger equations. To this end we use a well-established phenomenological model for the quark-gluon interaction with parameters fixed to reproduce hadronic observables. From the HVP tensor we compute both the Adler function and the HVP contribution to the anomalous magnetic moment of the muon, a μ . We find a μ HVP =6760x10 -11 which deviates about two percent from the value extracted from experiment. Additionally, we make comparison with a recent lattice determination of a μ HVP and find good agreement within our approach. We also discuss the implications of our result for a corresponding calculation of the hadronic light-by-light scattering contribution to a μ .
Hwang, Shin Hye; You, Je Sung; Song, Mi Kyong; Choi, Jin-Young; Kim, Myeong-Jin; Chung, Yong Eun
2015-04-01
To evaluate feasibility of radiation dose reduction by optimal phase selection of computed tomography (CT) in patients who visited the emergency department (ED) for abdominal pain. We included 253 patients who visited the ED for abdominal pain. They underwent multiphasic CT including precontrast, late arterial phase (LAP), and hepatic venous phase (HVP). Three image sets (HVP, precontrast + HVP, and precontrast + LAP + HVP) were reviewed. Two reviewers determined the most appropriate diagnosis with five-point confidence scale. Diagnostic performances were compared among image sets by weighted-least-squares method or DeLong's method. Linear mixed model was used to assess changes of diagnostic confidence and radiation dose. There was no difference in diagnostic performance among three image sets, although diagnostic confidence level was significantly improved after review of triphasic images compared with both HVP images only or HVP with precontrast images (confidence scale, 4.64 ± 0.05, 4.66 ± 0.05, and 4.76 ± 0.04 in the order of the sets; overall P = 0.0008). Similar trends were observed in the subgroup analysis for diagnosis of pelvic inflammatory disease and cholecystitis. There is no difference between HVP-CT alone and multiphasic CT for the diagnosis of causes of abdominal pain in patients admitted to the ED without prior chronic disease or neoplasia. • There was no difference in diagnostic performance of HVP CT and multiphasic CT. • The diagnostic confidence level was improved after review of the LAP images. • HVP CT can achieve diagnostic performance similar to that of multiphasic CT, while minimizing radiation.
Energy Technology Data Exchange (ETDEWEB)
Goecke, Tobias [Institut fuer Theoretische Physik, Universitaet Giessen, 35392 Giessen (Germany); Fischer, Christian S., E-mail: christian.fischer@theo.physik.uni-giessen.de [Institut fuer Theoretische Physik, Universitaet Giessen, 35392 Giessen (Germany); Gesellschaft fuer Schwerionenforschung mbH, Planckstr. 1, D-64291 Darmstadt (Germany); Williams, Richard [Dept. Fisica Teorica I, Universidad Complutense, 28040 Madrid (Spain)
2011-10-13
We present a calculation of the hadronic vacuum polarisation (HVP) tensor within the framework of Dyson-Schwinger equations. To this end we use a well-established phenomenological model for the quark-gluon interaction with parameters fixed to reproduce hadronic observables. From the HVP tensor we compute both the Adler function and the HVP contribution to the anomalous magnetic moment of the muon, a{sub {mu}}. We find a{sub {mu}}{sup HVP}=6760x10{sup -11} which deviates about two percent from the value extracted from experiment. Additionally, we make comparison with a recent lattice determination of a{sub {mu}}{sup HVP} and find good agreement within our approach. We also discuss the implications of our result for a corresponding calculation of the hadronic light-by-light scattering contribution to a{sub {mu}.}
Clemmesen, J O; Gerbes, A L; Gülberg, V; Hansen, B A; Larsen, F S; Skak, C; Tygstrup, N; Ott, P
1999-02-01
Liver failure represents a major therapeutic challenge, and yet basic pathophysiological questions about hepatic perfusion and oxygenation in this condition have been poorly investigated. In this study, hepatic blood flow (HBF) and splanchnic oxygen delivery (DO2, sp) and oxygen consumption (VO2,sp) were assessed in patients with liver failure defined as hepatic encephalopathy grade II or more. Measurements were repeated after high-volume plasmapheresis (HVP) with exchange of 8 to 10 L of plasma. HBF was estimated by use of constant infusion of D-sorbitol and calculated according to Fick's principle from peripheral artery and hepatic vein concentrations. In 14 patients with acute liver failure (ALF), HBF (1.78 +/- 0.78 L/min) and VO2,sp (3.9 +/- 0.9 mmol/min) were higher than in 11 patients without liver disease (1.07 +/- 0.19 L/min, P HVP, HBF increased from 1.67 +/- 0.72 to 2.07 +/- 1.11 L/min (n=11) in ALF, and from 1.89 +/- 1.32 to 2.34 +/- 1.54 L/min (n=7) in AOCLD, P HVP. Blood flow was redirected to the liver as the systemic vascular resistance index increased (1,587 +/- 650 vs. 2, 020 +/- 806 Dyne. s. cm-5. m2, P HVP, but as cardiac output increased from 9.1 +/- 2.8 to 10.1 +/- 2.9 L/min (P HVP (n=18), DO2,sp increased by 15% (P HVP. Changes of ET-1 were positively correlated with changes in HBF (P HVP (P HVP did not correlate. Our data suggest that liver failure is associated with increased HBF and VO2, sp. HVP further increased HBF and DO2,sp but VO2,sp was unchanged, indicating that splanchnic hypoxia was not present.
The Brachyspira hyodysenteriae B204 genome sequence revealed three VSH-1 tail genes hvp31, hvp60, and hvp37, in a 3.6 kb cluster. The location and transcription direction of these genes relative to the previously described VSH-1 16.3 kb gene operon indicate that the gene transfer agent VSH-1 has a ...
Moment analysis of hadronic vacuum polarization. Proposal for a lattice QCD evaluation of gμ - 2
de Rafael, Eduardo
2014-09-01
I suggest a new approach to the determination of the hadronic vacuum polarization (HVP) contribution to the anomalous magnetic moment of the muon aμHVP in lattice QCD. It is based on properties of the Mellin transform of the hadronic spectral function and their relation to the HVP self-energy in the Euclidean. I show how aμHVP is very well approximated by a few moments associated to this Mellin transform and how these moments can be evaluated in lattice QCD, providing thus a series of tests when compared with the corresponding determinations using experimental data.
Moment analysis of hadronic vacuum polarization
Directory of Open Access Journals (Sweden)
Eduardo de Rafael
2014-09-01
Full Text Available I suggest a new approach to the determination of the hadronic vacuum polarization (HVP contribution to the anomalous magnetic moment of the muon aμHVP in lattice QCD. It is based on properties of the Mellin transform of the hadronic spectral function and their relation to the HVP self-energy in the Euclidean. I show how aμHVP is very well approximated by a few moments associated to this Mellin transform and how these moments can be evaluated in lattice QCD, providing thus a series of tests when compared with the corresponding determinations using experimental data.
Moment analysis of hadronic vacuum polarization
International Nuclear Information System (INIS)
Rafael, Eduardo de
2014-01-01
I suggest a new approach to the determination of the hadronic vacuum polarization (HVP) contribution to the anomalous magnetic moment of the muon a μ HVP in lattice QCD. It is based on properties of the Mellin transform of the hadronic spectral function and their relation to the HVP self-energy in the Euclidean. I show how a μ HVP is very well approximated by a few moments associated to this Mellin transform and how these moments can be evaluated in lattice QCD, providing thus a series of tests when compared with the corresponding determinations using experimental data
Moment analysis of hadronic vacuum polarization
Energy Technology Data Exchange (ETDEWEB)
Rafael, Eduardo de
2014-09-07
I suggest a new approach to the determination of the hadronic vacuum polarization (HVP) contribution to the anomalous magnetic moment of the muon a{sub μ}{sup HVP} in lattice QCD. It is based on properties of the Mellin transform of the hadronic spectral function and their relation to the HVP self-energy in the Euclidean. I show how a{sub μ}{sup HVP} is very well approximated by a few moments associated to this Mellin transform and how these moments can be evaluated in lattice QCD, providing thus a series of tests when compared with the corresponding determinations using experimental data.
International Nuclear Information System (INIS)
Hwang, Shin Hye; You, Je Sung; Choi, Jin-Young; Kim, Myeong-Jin; Chung, Yong Eun; Song, Mi Kyong
2015-01-01
To evaluate feasibility of radiation dose reduction by optimal phase selection of computed tomography (CT) in patients who visited the emergency department (ED) for abdominal pain. We included 253 patients who visited the ED for abdominal pain. They underwent multiphasic CT including precontrast, late arterial phase (LAP), and hepatic venous phase (HVP). Three image sets (HVP, precontrast + HVP, and precontrast + LAP + HVP) were reviewed. Two reviewers determined the most appropriate diagnosis with five-point confidence scale. Diagnostic performances were compared among image sets by weighted-least-squares method or DeLong's method. Linear mixed model was used to assess changes of diagnostic confidence and radiation dose. There was no difference in diagnostic performance among three image sets, although diagnostic confidence level was significantly improved after review of triphasic images compared with both HVP images only or HVP with precontrast images (confidence scale, 4.64 ± 0.05, 4.66 ± 0.05, and 4.76 ± 0.04 in the order of the sets; overall P = 0.0008). Similar trends were observed in the subgroup analysis for diagnosis of pelvic inflammatory disease and cholecystitis. There is no difference between HVP-CT alone and multiphasic CT for the diagnosis of causes of abdominal pain in patients admitted to the ED without prior chronic disease or neoplasia. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hwang, Shin Hye; You, Je Sung; Choi, Jin-Young; Kim, Myeong-Jin; Chung, Yong Eun [Yonsei University College of Medicine, Department of Radiology, Research Institute of Radiological Science, Seodaemun-gu, Seoul (Korea, Republic of); Song, Mi Kyong [Yonsei University, Biostatistics Collaboration Unit, College of Medicine, Seoul (Korea, Republic of)
2015-04-01
To evaluate feasibility of radiation dose reduction by optimal phase selection of computed tomography (CT) in patients who visited the emergency department (ED) for abdominal pain. We included 253 patients who visited the ED for abdominal pain. They underwent multiphasic CT including precontrast, late arterial phase (LAP), and hepatic venous phase (HVP). Three image sets (HVP, precontrast + HVP, and precontrast + LAP + HVP) were reviewed. Two reviewers determined the most appropriate diagnosis with five-point confidence scale. Diagnostic performances were compared among image sets by weighted-least-squares method or DeLong's method. Linear mixed model was used to assess changes of diagnostic confidence and radiation dose. There was no difference in diagnostic performance among three image sets, although diagnostic confidence level was significantly improved after review of triphasic images compared with both HVP images only or HVP with precontrast images (confidence scale, 4.64 ± 0.05, 4.66 ± 0.05, and 4.76 ± 0.04 in the order of the sets; overall P = 0.0008). Similar trends were observed in the subgroup analysis for diagnosis of pelvic inflammatory disease and cholecystitis. There is no difference between HVP-CT alone and multiphasic CT for the diagnosis of causes of abdominal pain in patients admitted to the ED without prior chronic disease or neoplasia. (orig.)
Linkage map of the fragments of herpesvirus papio DNA.
Lee, Y S; Tanaka, A; Lau, R Y; Nonoyama, M; Rabin, H
1981-01-01
Herpesvirus papio (HVP), an Epstein-Barr-like virus, causes lymphoblastoid disease in baboons. The physical map of HVP DNA was constructed for the fragments produced by cleavage of HVP DNA with restriction endonucleases EcoRI, HindIII, SalI, and PvuI, which produced 12, 12, 10, and 4 fragments, respectively. The total molecular size of HVP DNA was calculated as close to 110 megadaltons. The following methods were used for construction of the map; (i) fragments near the ends of HVP DNA were identified by treating viral DNA with lambda exonuclease before restriction enzyme digestion; (ii) fragments containing nucleotide sequences in common with fragments from the second enzyme digest of HVP DNA were examined by Southern blot hybridization; and (iii) the location of some fragments was determined by isolating individual fragments from agarose gels and redigesting the isolated fragments with a second restriction enzyme. Terminal heterogeneity and internal repeats were found to be unique features of HVP DNA molecule. One to five repeats of 0.8 megadaltons were found at both terminal ends. Although the repeats of both ends shared a certain degree of homology, it was not determined whether they were identical repeats. The internal repeat sequence of HVP DNA was found in the EcoRI-C region, which extended from 8.4 to 23 megadaltons from the left end of the molecule. The average number of the repeats was calculated to be seven, and the molecular size was determined to be 1.8 megadaltons. Similar unique features have been reported in EBV DNA (D. Given and E. Kieff, J. Virol. 28:524-542, 1978). Images PMID:6261015
Hadronic vacuum polarization in QCD and its evaluation in Euclidean spacetime
de Rafael, Eduardo
2017-07-01
We discuss a new technique to evaluate integrals of QCD Green's functions in the Euclidean based on their Mellin-Barnes representation. We present as a first application the evaluation of the lowest order hadronic vacuum polarization (HVP) contribution to the anomalous magnetic moment of the muon 1/2 (gμ-2 )HVP≡aμHVP . It is shown that with a precise determination of the slope and curvature of the HVP function at the origin from lattice QCD (LQCD), one can already obtain a result for aμHVP which may serve as a test of the determinations based on experimental measurements of the e+e- annihilation cross section into hadrons.
Hayashi, K; Ohara, N; Teramoto, N; Onoda, S; Chen, H L; Oka, T; Kondo, E; Yoshino, T; Takahashi, K; Yates, J; Akagi, T
2001-04-01
Epstein-Barr virus-associated hemophagocytic syndrome (EBV-AHS) is often associated with fatal infectious mononucleosis. However, the animal model for EBV-AHS has not been developed. We reported the first animal model for EBV-AHS using rabbits infected with EBV-related herpesvirus of baboon (HVP). Eleven of 13 (85%) rabbits inoculated intravenously with HVP-producing cells developed fatal lymphoproliferative disorders (LPD) between 22 and 105 days after inoculation. LPD was also accompanied by hemophagocytic syndrome (HPS) in nine of these 11 rabbits. The peroral spray of cell-free HVP induced the virus infection with increased anti-EBV-viral capsid antigen-IgG titers in three of five rabbits, and two of these three infected rabbits died of LPD with HPS. Autopsy revealed hepatosplenomegaly and swollen lymph nodes. Atypical lymphoid T cells expressing EBV-encoded small RNA-1 infiltrated diffusely in many organs, frequently involving the lymph nodes, spleen, and liver. Hemophagocytic histiocytosis was observed in the lymph nodes, spleen, bone marrow, and thymus. HVP-DNA was detected in the tissues and peripheral blood from the infected rabbits by polymerase chain reaction or Southern blot analysis. Reverse transcriptase-polymerase chain reaction revealed both HVP-EBNA1 and HVP-EBNA2 transcripts, suggesting latency type III infection. These data indicate that the high rate of rabbit LPD with HPS induction is caused by HVP. This system is useful for studying the pathogenesis, prevention, and treatment of human EBV-AHS.
An Animal Model for Human EBV-Associated Hemophagocytic Syndrome
Hayashi, Kazuhiko; Ohara, Nobuya; Teramoto, Norihiro; Onoda, Sachiyo; Chen, Hong-Li; Oka, Takashi; Kondo, Eisaku; Yoshino, Tadashi; Takahashi, Kiyoshi; Yates, John; Akagi, Tadaatsu
2001-01-01
Epstein-Barr virus-associated hemophagocytic syndrome (EBV-AHS) is often associated with fatal infectious mononucleosis. However, the animal model for EBV-AHS has not been developed. We reported the first animal model for EBV-AHS using rabbits infected with EBV-related herpesvirus of baboon (HVP). Eleven of 13 (85%) rabbits inoculated intravenously with HVP-producing cells developed fatal lymphoproliferative disorders (LPD) between 22 and 105 days after inoculation. LPD was also accompanied by hemophagocytic syndrome (HPS) in nine of these 11 rabbits. The peroral spray of cell-free HVP induced the virus infection with increased anti-EBV-viral capsid antigen-IgG titers in three of five rabbits, and two of these three infected rabbits died of LPD with HPS. Autopsy revealed hepatosplenomegaly and swollen lymph nodes. Atypical lymphoid T cells expressing EBV-encoded small RNA-1 infiltrated diffusely in many organs, frequently involving the lymph nodes, spleen, and liver. Hemophagocytic histiocytosis was observed in the lymph nodes, spleen, bone marrow, and thymus. HVP-DNA was detected in the tissues and peripheral blood from the infected rabbits by polymerase chain reaction or Southern blot analysis. Reverse transcriptase-polymerase chain reaction revealed both HVP-EBNA1 and HVP-EBNA2 transcripts, suggesting latency type III infection. These data indicate that the high rate of rabbit LPD with HPS induction is caused by HVP. This system is useful for studying the pathogenesis, prevention, and treatment of human EBV-AHS. PMID:11290571
Pesano, R L; Pagano, J S
1986-01-01
Herpesvirus papio (HVP) and Epstein-Barr virus (EBV) are closely related biologically and biochemically; lymphoblastoid cells infected with either virus contain episomal viral DNA. The putative origin of replication for EBV plasmids (oriP) has been assigned to a 1,790-base-pair fragment (cis) in the short unique region of the genome which requires a viral function supplied in trans from elsewhere in the genome (J. Yates, N. Warren, D. Reisman, and B. Sugden, Proc. Natl. Acad. Sci. USA 81:3806-3810, 1984). We report here the identification of the putative origin of replication (cis) in HVP; we assigned it to the HVP EcoRI K fragment. The results indicate that the HVP replication process requires both a cis and a trans-acting function, analogous to that found in EBV. Images PMID:3023667
Lifescience Database Archive (English)
Full Text Available quence nvl*ihvqtqlvv*ilqltvtivihvp*thaiiqlvv*tlqsmlmiiihvpsmpvpnqqv llipqsm*mittnvqlmhvpkkvv*lipqsilmitm...pvqlmhvqkkvv*lilqsilmitm lvpltpvhhqlafptpqltvmivihvp*thvqiqpvvatlqsmlmiiihvl*ihvpnqqv... slipqsm*mittnvqlmhvpkkvv*lilqsilmitmhvplipvhhqlvfptlqltvmivi hvp*IHAIIQLGVATLQSMVDDNNPCXVNHVLN--- ---XGLXGG...qv llipqsm*mittnvqlmhvpkkvv*lipqsilmitmpvqlmhvqkkvv*lilqsilmitm lvpltpvhhqlafptpqltvmivihvp*thvqiqpvvatlqsml...miiihvl*ihvpnqqv slipqsm*mittnvqlmhvpkkvv*lilqsilmitmhvplipvhhqlvfptlqltvmivi hvp*IHAIIQLGVATLQSMVDDNNPCXVNH
Larsen, Fin Stolze; Schmidt, Lars Ebbe; Bernsmeier, Christine; Rasmussen, Allan; Isoniemi, Helena; Patel, Vishal C; Triantafyllou, Evangelos; Bernal, William; Auzinger, Georg; Shawcross, Debbie; Eefsen, Martin; Bjerring, Peter Nissen; Clemmesen, Jens Otto; Hockerstedt, Krister; Frederiksen, Hans-Jørgen; Hansen, Bent Adel; Antoniades, Charalambos G; Wendon, Julia
2016-01-01
Acute liver failure (ALF) often results in cardiovascular instability, renal failure, brain oedema and death either due to irreversible shock, cerebral herniation or development of multiple organ failure. High-volume plasma exchange (HVP), defined as exchange of 8-12 or 15% of ideal body weight with fresh frozen plasma in case series improves systemic, cerebral and splanchnic parameters. In this prospective, randomised, controlled, multicentre trial we randomly assigned 182 patients with ALF to receive either standard medical therapy (SMT; 90 patients) or SMT plus HVP for three days (92 patients). The baseline characteristics of the groups were similar. The primary endpoint was liver transplantation-free survival during hospital stay. Secondary-endpoints included survival after liver transplantation with or without HVP with intention-to-treat analysis. A proof-of-principle study evaluating the effect of HVP on the immune cell function was also undertaken. For the entire patient population, overall hospital survival was 58.7% for patients treated with HVP vs. 47.8% for the control group (hazard ratio (HR), with stratification for liver transplantation: 0.56; 95% confidence interval (CI), 0.36-0.86; p=0.0083). HVP prior to transplantation did not improve survival compared with patients who received SMT alone (CI 0.37 to 3.98; p=0.75). The incidence of severe adverse events was similar in the two groups. Systemic inflammatory response syndrome (SIRS) and sequential organ failure assessment (SOFA) scores fell in the treated group compared to control group, over the study period (pHVP improves outcome in patients with ALF by increasing liver transplant-free survival. This is attributable to attenuation of innate immune activation and amelioration of multi-organ dysfunction. Copyright © 2015 European Association for the Study of the Liver. Published by Elsevier B.V. All rights reserved.
Lyon, M; Wood, S; Pelletier, X; Donazzolo, Y; Gahler, R; Bellisle, F
2011-08-01
High viscosity fibre is known to exert many beneficial effects on appetite and metabolism. It could potentially help in weight management, in dieting or nondieting individuals. The present study investigated the effects of the daily intake of a novel high viscosity polysaccharide (HVP) over 3 months in nondieting obese or overweight men and women. The study comprised a double-blind, randomised controlled clinical trial. Participants ingested 5-15 g per day of either HVP (n = 29, experimental group) or inulin (n = 30, control group) for 15 weeks. Changes in anthropometry (weight, waist and hip circumferences), blood lipids and glucose tolerance were studied from the beginning to the end of administration. Compliance and tolerance were examined. Differences appeared between HVP and inulin supplementation in female participants only. Mean (SD) decreases in body weight [1.6 (3.2) kg; approximately 2% of initial weight] and hip circumference [2.8 (3.6 ) cm] occurred in women of the HVP group but not in controls (Time × Group interactions, P ≤ 0.002). Total, high-density lipoprotein and low-density lipoprotein-cholesterol were lower at the end of supplementation in the women of the HVP group compared to controls (P ≤ 0.021). No effect appeared in waist circumference and triacylglycerol. No difference was noted in the number or severity of the adverse effects reported in both groups. Adverse effects were mild and agreed with commonly reported reactions to intake of dietary fibre. Beneficial although modest effects appeared after several weeks of daily HVP intake in nondieting obese or overweight women. The effects of HVP should be investigated in the context of a weight loss programme. © 2011 The Authors. Journal of Human Nutrition and Dietetics © 2011 The British Dietetic Association Ltd.
Ulman, I; Avanoğlu, A; Ozcan, C; Demircan, M; Ozok, G; Erdener, A
1996-07-01
The present trend towards conservative management of hemodynamically stable pediatric trauma patients may be increasing the risk of delay in the diagnosis of traumatic hollow viscus perforations (HVP). The purpose of this study is to determine whether there is a delay in the diagnosis of HVP because of expectant management. A survey of factors leading to diagnostic delay was also made and the value of current diagnostic tools were reevaluated. In 1,283 trauma admissions between 1980-1994, 34 patients were operated for HVP caused by blunt abdominal trauma. Sites of perforation were; stomach (four), duodenum (five), jejunum (12), ileum (nine), and jejunum/ileum (four). Signs of peritoneal irritation were positive in 32 of 34 patients. There was free air in only six of 24 abdominal roentgenograms. Free peritoneal fluid without solid organ injury was detected in only four out of 13 patients with ultrasound. Peritoneal lavage was diagnostic in eight of nine patients. Time from admission to operating room averaged 24 +/- 4.1 (mean +/- standard deviation) hours. Eleven patients died after the operation mostly because of accompanying head injury. Only two of the deaths were the result of sepsis originating from the perforated bowel. There is an apparent delay in the diagnosis of traumatic HVP in this series. Signs of peritoneal irritation are the most consistent findings of HVP after blunt abdominal trauma in children. Persistence of abdominal signs indicates peritoneal lavage, which has a high diagnostic sensitivity for HVP compared to other diagnostic modalities.
Reimer, R A; Pelletier, X; Carabin, I G; Lyon, M R; Gahler, R J; Wood, S
2012-08-01
Short chain fatty acids (SCFA) are produced by the bacterial fermentation of dietary fibre and have been linked with intestinal health. The present study examined faecal SCFA concentrations in subjects consuming a novel soluble highly viscous polysaccharide (HVP) or control for 3 weeks. A total of 54 healthy adults participated in a randomised, double-blind, placebo-controlled study. Subjects were randomised to consume HVP or control (skim milk powder). A dose of 5 g day(-1) was consumed in the first week, followed by 10 g day(-1) in the second and third weeks (n = 27 per group). The primary outcome was SCFA concentrations in faecal samples collected at baseline (visit 1, V1), at 1 week (V2) and at 3 week (V3). The reduction in faecal acetate from V1 to V3 in control subjects was not observed in subjects consuming HVP. There were no differences in propionate, butyrate, valerate or caproate concentrations. There was a significant treatment effect (P = 0.03) for total SCFA, with higher concentrations observed in subjects consuming HVP versus control. HVP is a viscous functional fibre that may influence gut microbial fermentation. Further work is warranted to examine the fermentative properties of HVP and possible links with appetite regulation and reduced serum low-density lipoprotein cholesterol concentrations. © 2012 The Authors. Journal of Human Nutrition and Dietetics © 2012 The British Dietetic Association Ltd.
Herpesvirus papio 2 encodes a virion host shutoff function.
Bigger, John E; Martin, David W
2002-12-05
Infection of baboons with herpesvirus papio 2 (HVP-2) produces a disease that is similar to human infection with herpes simplex viruses (HSV). Molecular characterization of HVP-2 has demonstrated that the virion contains a factor which rapidly shuts off host cell protein synthesis after infection. Reduction of host cell protein synthesis occurs in parallel with the degradation of mRNA species. A homolog of the HSV virion host shutoff (vhs) gene was identified by Southern and DNA sequence analysis. The sequence of the HVP-2 vhs gene homolog had greater than 70% identity with the vhs genes of HSV 1 and 2. Disruption of the HVP-2 vhs open reading frame diminished the ability of the virus to shut off protein synthesis and degrade cellular mRNA, indicating that this gene was responsible for the vhs activity. The HVP-2 model system provides the opportunity to study the biological role of vhs in the context of a natural primate host. Further development of this system will provide a platform for proof-of-concept studies that will test the efficacy of vaccines that utilize vhs-deficient viruses.
Jadoul, A; Tanojo, H; Préat, V; Bouwstra, J A; Spies, F; Boddé, H E
1998-08-01
Application of high voltage pulses (HVP) to the skin has been shown to promote the transdermal drug delivery by a mechanism involving skin electroporation. The aim of this study was to detect potential changes in lipid phase and ultrastructure induced in human stratum corneum by various HVP protocols, using differential thermal analysis and freeze-fracture electron microscopy. Due to the time involved between the moment the electric field is switched off and the analysis, only "secondary" phenomena rather than primary events could be observed. A decrease in enthalpies for the phase transitions observed at 70 degrees C and 85 degrees C was detected by differential thermal analysis after HVP treatment. No changes in transition temperature could be seen. The freeze-fracture electron microscopy study revealed a dramatic perturbation of the lamellar ordering of the intercellular lipid after application of HVP. Most of the planes displayed rough surfaces. The lipid lamellae exhibited rounded off steps or a vanished stepwise order. There was no evidence for perturbation of the corneocytes content. In conclusion, the freeze-fracture electron microscopy and differential thermal analysis studies suggest that HVP application induces a general perturbation of the stratum corneum lipid ultrastructure.
Clemmesen, J O; Kondrup, J; Nielsen, L B; Larsen, F S; Ott, P
2001-04-01
In acute liver failure (ALF), urea production is severely impaired, and detoxification of ammonia by glutamine synthesis plays an important protective role. The aim of this study was to examine the effects of therapeutic high-volume plasmapheresis (HVP) on arterial concentrations and splanchnic exchange rates of ammonia, urea, and amino acids-in particular, glutamine. A quantity of 8 L of plasma was exchanged over the course of 7 h in 11 patients with ALF after development of hepatic encephalopathy grade III-IV. Splanchnic exchange rates of ammonia, urea, and amino acids were measured by use of liver vein catheterization. HVP removed ammonia and glutamine at a rate of 1 micromol/min and 27 micromol/min, respectively. Arterial ammonia decreased from 160 +/- 65 to 114 +/- 50 micromol/L (p HVP) were as follows: for ammonia, -93 +/- 101 versus -70 +/- 80 micromol/min (NS); urea-nitrogen, 0.08 +/- 1.64 versus -0.31 +/- 0.45 mmol/min (NS); alanine, -73 +/- 151 versus 12 +/- 83 micromol/min (p HVP in patients with ALF. The data suggest that this effect of HVP could be explained by increased hepatic urea synthesis and possibly by increased glutamine synthesis in muscle tissue.
Novel immobilizations of an adhesion peptide on the TiO2 surface: An XPS investigation
International Nuclear Information System (INIS)
Iucci, G.; Dettin, M.; Battocchio, C.; Gambaretto, R.; Bello, C. Di; Polzonetti, G.
2007-01-01
The covalent attachment of an adhesive peptide, reproducing the 351-359 sequence of human vitronectin, to oxidized titanium surfaces was investigated by XPS spectroscopy. The peptide enhances osteoblast adhesion to titanium, the most used biomaterial for implants and prostheses. Core level spectra of the TiO 2 surface and of the biomimetic surface were investigated. Novel selective covalent immobilization of (351-359) HVP was carried out by treatment of the TiO 2 surface with (3-aminopropyl) triethoxysilane, glutaric anhydride and a side chain protected peptide sequence presenting only a free terminal amino group, followed by side chain deprotection. An alternative strategy for covalent attachment consists in photoactivation of physisorbed (351-359) HVP directly on the TiO 2 surface; samples were incubated with HVP solution and subsequently irradiated with UV light. A comparison with the results previously obtained for non-selective HVP immobilization will be discussed
A novel adjuvant to the resident selection process: the hartman value profile.
Cone, Jeffrey D; Byrum, C Stephen; Payne, Wyatt G; Smith, David J
2012-01-01
The goal of resident selection is twofold: (1) select candidates who will be successful residents and eventually successful practitioners and (2) avoid selecting candidates who will be unsuccessful residents and/or eventually unsuccessful practitioners. Traditional tools used to select residents have well-known limitations. The Hartman Value Profile (HVP) is a proven adjuvant tool to predicting future performance in candidates for advanced positions in the corporate setting. No literature exists to indicate use of the HVP for resident selection. The HVP evaluates the structure and the dynamics of an individual value system. Given the potential impact, we implemented its use beginning in 2007 as an adjuvant tool to the traditional selection process. Experience gained from incorporating the HVP into the residency selection process suggests that it may add objectivity and refinement in predicting resident performance. Further evaluation is warranted with longer follow-up times.
Enhancing Pediatric Asthma Care and Nursing Education Through an Academic Practice Partnership.
McClure, Natasha; Lutenbacher, Melanie; O'Kelley, Ellen; Dietrich, Mary S
Home environmental assessments and interventions delivered via academic practice partnerships (APP) between clinics and schools of nursing may be a low or no cost delivery model of pediatric asthma care and professional education. Patients receive enhanced clinical resources that can improve self-management and healthcare utilization. Additionally, students can practice chronic disease management skills in actual patient encounters. To describe outcomes of the implementation of an APP between a school of nursing and a pediatric asthma specialty clinic (PASC) to deliver a home visit program (HVP). The HVP was designed to reduce emergency department visits and asthma related hospitalizations in PASC patients and provide clinical experiences for nursing students. PASC referred patients to the HVP based on their level of asthma control. Students provided an individualized number of home visits to 17 participants over a nine month period. A 12-month pre- and post-HVP comparison of emergency department visits and asthma related hospitalizations was conducted. Additional information was gathered from stakeholders via an online survey, and interviews with APP partners and HVP families. Children had fewer asthma related hospitalizations post HVP. Findings suggest a reduction in exposure to environmental triggers, improved patient and family management of asthma, and increased PASC knowledge of asthma triggers in the home and increased student knowledge and skills related to asthma management. Multiple clinical and educational benefits may be realized through the development of APPs as an infrastructure supporting targeted interventions in home visits to pediatric asthma patients and their families. Copyright © 2017 Elsevier Inc. All rights reserved.
Irreversible electroporation ablation area enhanced by synergistic high- and low-voltage pulses.
Directory of Open Access Journals (Sweden)
Chenguo Yao
Full Text Available Irreversible electroporation (IRE produced by a pulsed electric field can ablate tissue. In this study, we achieved an enhancement in ablation area by using a combination of short high-voltage pulses (HVPs to create a large electroporated area and long low-voltage pulses (LVPs to ablate the electroporated area. The experiments were conducted in potato tuber slices. Slices were ablated with an array of four pairs of parallel steel electrodes using one of the following four electric pulse protocols: HVP, LVP, synergistic HVP+LVP (SHLVP or LVP+HVP. Our results showed that the SHLVPs more effectively necrotized tissue than either the HVPs or LVPs, even when the SHLVP dose was the same as or lower than the HVP or LVP doses. The HVP and LVP order mattered and only HVPs+LVPs (SHLVPs treatments increased the size of the ablation zone because the HVPs created a large electroporated area that was more susceptible to the subsequent LVPs. Real-time temperature change monitoring confirmed that the tissue was non-thermally ablated by the electric pulses. Theoretical calculations of the synergistic effects of the SHLVPs on tissue ablation were performed. Our proposed SHLVP protocol provides options for tissue ablation and may be applied to optimize the current clinical IRE protocols.
Irreversible electroporation ablation area enhanced by synergistic high- and low-voltage pulses.
Yao, Chenguo; Lv, Yanpeng; Dong, Shoulong; Zhao, Yajun; Liu, Hongmei
2017-01-01
Irreversible electroporation (IRE) produced by a pulsed electric field can ablate tissue. In this study, we achieved an enhancement in ablation area by using a combination of short high-voltage pulses (HVPs) to create a large electroporated area and long low-voltage pulses (LVPs) to ablate the electroporated area. The experiments were conducted in potato tuber slices. Slices were ablated with an array of four pairs of parallel steel electrodes using one of the following four electric pulse protocols: HVP, LVP, synergistic HVP+LVP (SHLVP) or LVP+HVP. Our results showed that the SHLVPs more effectively necrotized tissue than either the HVPs or LVPs, even when the SHLVP dose was the same as or lower than the HVP or LVP doses. The HVP and LVP order mattered and only HVPs+LVPs (SHLVPs) treatments increased the size of the ablation zone because the HVPs created a large electroporated area that was more susceptible to the subsequent LVPs. Real-time temperature change monitoring confirmed that the tissue was non-thermally ablated by the electric pulses. Theoretical calculations of the synergistic effects of the SHLVPs on tissue ablation were performed. Our proposed SHLVP protocol provides options for tissue ablation and may be applied to optimize the current clinical IRE protocols.
Magnesium diboride coated bulk niobium: a new approach to higher acceleration gradient
Civale, Leonardo; Tan, Teng; Wolak, M.; Xi, Xiaoxing; Tajima, Tsuyoshi
Bulk niobium Superconducting Radio-Frequency cavities are a leading accelerator technology. Their performance is limited by the cavity loss and maximum acceleration gradient, which are negatively affected by vortex penetration into the superconductor when the peak magnetic field at the cavity wall surface exceeds the vortex penetration field (Hvp). It has been proposed that coating the inner wall of an SRF cavity with superconducting thin films increases Hvp. In this work, we utilized Nb ellipsoids to simulate an inverse SRF cavity and investigate the effect of coating it with magnesium diboride layer on the vortex penetration field. A significant enhancement of Hvp was observed. At 2.8 K, Hvp increased from 2100 Oe for an uncoated Nb ellipsoid to 2700 Oe for a Nb ellipsoid coated with 200 nm thick MgB2 thin film. This finding creates a new route towards achieving higher acceleration gradient in SRF cavity accelerator beyond the theoretical limit of bulk Nb.
Homozygous variegate porphyria presenting with developmental and language delay in childhood.
Pinder, V A E; Holden, S T; Deshpande, C; Siddiqui, A; Mellerio, J E; Wraige, E; Powell, A M
2013-10-01
Variegate porphyria is an autosomal dominant disorder that usually presents with photosensitivity and acute neurological crises in adulthood. It is caused by heterozygous mutations in the protoporphyrinogen oxidase gene (PPOX). A rarer variant, homozygous variegate porphyria (HVP), presents in childhood with recurrent skin blisters and scarring. More variable features of HVP are short stature, brachydactyly, nystagmus, epilepsy, developmental delay and mental retardation. We describe a child who presented with nystagmus, developmental delay and ataxia, combined with a photosensitive eruption. Analysis of porphyrins in plasma, urine and stool supported a clinical diagnosis of HVP. DNA from the patient showed that he is compound heterozygous for two novel missense mutations in the PPOX coding region: c.169G>C (p.Gly57Arg) and c.1259C>G (Pro420Arg). Interestingly, cranial magnetic resonance imaging showed an absence of myelin, a feature not previously reported in HVP, which expands the differential diagnosis of childhood hypomyelinating leucoencephalopathies. © 2013 British Association of Dermatologists.
The hadronic vacuum polarization contribution to the muon g - 2 from lattice QCD
Morte, M. Della; Francis, A.; Gülpers, V.; Herdoíza, G.; von Hippel, G.; Horch, H.; Jäger, B.; Meyer, H. B.; Nyffeler, A.; Wittig, H.
2017-10-01
We present a calculation of the hadronic vacuum polarization contribution to the muon anomalous magnetic moment, a μ hvp , in lattice QCD employing dynamical up and down quarks. We focus on controlling the infrared regime of the vacuum polarization function. To this end we employ several complementary approaches, including Padé fits, time moments and the time-momentum representation. We correct our results for finite-volume effects by combining the Gounaris-Sakurai parameterization of the timelike pion form factor with the Lüscher formalism. On a subset of our ensembles we have derived an upper bound on the magnitude of quark-disconnected diagrams and found that they decrease the estimate for a μ hvp by at most 2%. Our final result is {a}_{μ}^{hvp} = (654 ± {32}{^{-23}}^{+21}) ·10-10, where the first error is statistical, and the second denotes the combined systematic uncertainty. Based on our findings we discuss the prospects for determining a μ hvp with sub-percent precision.
Ryon, J J; Fixman, E D; Houchens, C; Zong, J; Lieberman, P M; Chang, Y N; Hayward, G S; Hayward, S D
1993-01-01
Herpesvirus papio (HVP) is a B-lymphotropic baboon virus with an estimated 40% homology to Epstein-Barr virus (EBV). We have cloned and sequenced ori-Lyt of herpesvirus papio and found a striking degree of nucleotide homology (89%) with ori-Lyt of EBV. Transcriptional elements form an integral part of EBV ori-Lyt. The promoter and enhancer domains of EBV ori-Lyt are conserved in herpesvirus papio. The EBV ori-Lyt promoter contains four binding sites for the EBV lytic cycle transactivator Zta, and the enhancer includes one Zta and two Rta response elements. All five of the Zta response elements and one of the Rta motifs are conserved in HVP ori-Lyt, and the HVP DS-L leftward promoter and the enhancer were activated in transient transfection assays by the EBV Zta and Rta transactivators. The EBV ori-Lyt enhancer contains a palindromic sequence, GGTCAGCTGACC, centered on a PvuII restriction site. This sequence, with a single base change, is also present in the HVP ori-Lyt enhancer. DNase I footprinting demonstrated that the PvuII sequence was bound by a protein present in a Raji nuclear extract. Mobility shift and competition assays using oligonucleotide probes identified this sequence as a binding site for the cellular transcription factor MLTF. Mutagenesis of the binding site indicated that MLTF contributes significantly to the constitutive activity of the ori-Lyt enhancer. The high degree of conservation of cis-acting signal sequences in HVP ori-Lyt was further emphasized by the finding that an HVP ori-Lyt-containing plasmid was replicated in Vero cells by a set of cotransfected EBV replication genes. The central domain of EBV ori-Lyt contains two related AT-rich palindromes, one of which is partially duplicated in the HVP sequence. The AT-rich palindromes are functionally important cis-acting motifs. Deletion of these palindromes severely diminished replication of an ori-Lyt target plasmid. Images PMID:8389916
Sand, L; Lundin, S; Rizell, M; Wiklund, J; Stenqvist, O; Houltz, E
2014-09-01
To reduce blood loss during liver surgery, a low central venous pressure (CVP) is recommended. Nitroglycerine (NG) with its rapid onset and offset can be used to reduce CVP. In this study, the effect of NG on portal and hepatic venous pressures (PVP and HVP) in different body positions was assessed. Thirteen patients undergoing liver resection were studied. Cardiac output (CO), mean arterial pressure (MAP) and CVP were measured. PVP and HVP were measured using tip manometer catheters at baseline (BL) in horizontal position; during NG infusion, targeting a MAP of 60 mmHg, with NG infusion and the patient placed in 10 head-down position. NG infusion reduced HVP from 9.7 ± 2.4 to 7.2 ± 2.4, PVP from 12.3 ± 2.2 to 9.7 ± 3.0 and CVP from 9.8 ± 1.9 to 7.2 ± 2.1 mmHg at BL. Head-down tilt during ongoing NG resulted in increases in HVP to 8.2 ± 2.1, PVP to 10.7 ± 3 and CVP to 11 ± 1.9 mmHg. CO at BL was 6.3 ± 1.1, which was reduced by NG to 5.8 ± 1.2. Head-down tilt together with NG infusion restored CO to 6.3 ± 1.0 l/min. NG infusion leads to parallel reductions in CVP, HVP and PVP at horizontal body position. Thus, CVP can be used to guide NG dosage and fluid administration at horizontal position. NG infusion can be used to reduce HVP. Head-down tilt can be used during NG infusion to improve both blood pressure and CO without substantial increase in liver venous pressure. In head-down tilt, CVP dissociates from HVP and PVP. © 2014 The Acta Anaesthesiologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.
Databases for neurogenetics: introduction, overview, and challenges.
Sobrido, María-Jesús; Cacheiro, Pilar; Carracedo, Angel; Bertram, Lars
2012-09-01
The importance for research and clinical utility of mutation databases, as well as the issues and difficulties entailed in their construction, is discussed within the Human Variome Project. While general principles and standards can apply to most human diseases, some specific questions arise when dealing with the nature of genetic neurological disorders. So far, publically accessible mutation databases exist for only about half of the genes causing neurogenetic disorders; and a considerable work is clearly still needed to optimize their content. The current landscape, main challenges, some potential solutions, and future perspectives on genetic databases for disorders of the nervous system are reviewed in this special issue of Human Mutation on neurogenetics. © 2012 Wiley Periodicals, Inc.
Brun, Paola; Scorzeto, Michele; Vassanelli, Stefano; Castagliuolo, Ignazio; Palù, Giorgio; Ghezzo, Francesca; Messina, Grazia M L; Iucci, Giovanna; Battaglia, Valentina; Sivolella, Stefano; Bagno, Andrea; Polzonetti, Giovanni; Marletta, Giovanni; Dettin, Monica
2013-04-01
The features of implant devices and the reactions of bone-derived cells to foreign surfaces determine implant success during osseointegration. In an attempt to better understand the mechanisms underlying osteoblasts attachment and spreading, in this study adhesive peptides containing the fibronectin sequence motif for integrin binding (Arg-Gly-Asp, RGD) or mapping the human vitronectin protein (HVP) were grafted on glass and titanium surfaces with or without chemically induced controlled immobilization. As shown by total internal reflection fluorescence microscopy, human osteoblasts develop adhesion patches only on specifically immobilized peptides. Indeed, cells quickly develop focal adhesions on RGD-grafted surfaces, while HVP peptide promotes filopodia, structures involved in cellular spreading. As indicated by immunocytochemistry and quantitative polymerase chain reaction, focal adhesions kinase activation is delayed on HVP peptides with respect to RGD while an osteogenic phenotypic response appears within 24h on osteoblasts cultured on both peptides. Cellular pathways underlying osteoblasts attachment are, however, different. As demonstrated by adhesion blocking assays, integrins are mainly involved in osteoblast adhesion to RGD peptide, while HVP selects osteoblasts for attachment through proteoglycan-mediated interactions. Thus an interfacial layer of an endosseous device grafted with specifically immobilized HVP peptide not only selects the attachment and supports differentiation of osteoblasts but also promotes cellular migration. Copyright © 2012 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Toczyski, D P; Steitz, J A
1993-01-01
EAP (EBER-associated protein) is an abundant, 15-kDa cellular RNA-binding protein which associates with certain herpesvirus small RNAs. We have raised polyclonal anti-EAP antibodies against a glutathione S-transferase-EAP fusion protein. Analysis of the RNA precipitated by these antibodies from Epstein-Barr virus (EBV)- or herpesvirus papio (HVP)-infected cells shows that > 95% of EBER 1 (EBV-encoded RNA 1) and the majority of HVP 1 (an HVP small RNA homologous to EBER 1) are associated with EAP. RNase protection experiments performed on native EBER 1 particles with affinity-purified anti-EAP antibodies demonstrate that EAP binds a stem-loop structure (stem-loop 3) of EBER 1. Since bacterially expressed glutathione S-transferase-EAP fusion protein binds EBER 1, we conclude that EAP binding is independent of any other cellular or viral protein. Detailed mutational analyses of stem-loop 3 suggest that EAP recognizes the majority of the nucleotides in this hairpin, interacting with both single-stranded and double-stranded regions in a sequence-specific manner. Binding studies utilizing EBER 1 deletion mutants suggest that there may also be a second, weaker EAP-binding site on stem-loop 4 of EBER 1. These data and the fact that stem-loop 3 represents the most highly conserved region between EBER 1 and HVP 1 suggest that EAP binding is a critical aspect of EBER 1 and HVP 1 function. Images PMID:8380232
Naturally transmitted herpesvirus papio-2 infection in a black and white colobus monkey.
Troan, Brigid V; Perelygina, Ludmila; Patrusheva, Irina; Wettere, Arnaud J van; Hilliard, Julia K; Loomis, Michael R; Voe, Ryan S De
2007-12-15
A 6.5-year-old female eastern black and white colobus monkey (Colobus guereza) was evaluated after acute onset of ataxia and inappetence. The monkey was ataxic and lethargic, but no other abnormalities were detected via physical examination, radiography, or clinicopathologic analyses. During the next 2 days, the monkey's clinical condition deteriorated, and its WBC count decreased dramatically. Cytologic examination of a CSF sample revealed marked lymphohistiocytic inflammation. Despite supportive care, the monkey became apneic; after 20 hours of mechanical ventilation, fatal cardiac arrest occurred. At necropsy, numerous petechiae were detected within the white matter tracts of the brain; microscopic lesions of multifocal necrosis and hemorrhage with intranuclear inclusions identified in the brain and adrenal glands were consistent with an acute herpesvirus infection. A specific diagnosis of herpesvirus papio-2 (HVP-2) infection was made on the basis of results of serologic testing; PCR assay of tissue specimens; live virus isolation from the lungs; and immunohistochemical identification of the virus within brain, spinal cord, and adrenal gland lesions. Via phylogenetic tree analysis, the colobus HVP-2 isolate was grouped with neuroinvasive strains of the virus. The virus was most likely transmitted to the colobus monkey through toys shared with a nearby colony of baboons (the natural host of HVP-2). To the authors' knowledge, this is the first reported case of natural transmission of HVP-2 to a nonhost species. Infection with HVP-2 should be a differential diagnosis for acute encephalopathy in primate monkeys and humans, particularly following exposure to baboons.
Role of shear stress in nitric oxide-dependent modulation of renal angiotensin II vasoconstriction.
Endlich, K; Muller, C; Barthelmebs, M; Helwig, J J
1999-08-01
1. Renal vasoconstriction in response to angiotensin II (ANGII) is known to be modulated by nitric oxide (NO). Since shear stress stimulates the release of a variety of vasoactive compounds from endothelial cells, we studied the impact of shear stress on the haemodynamic effect of ANGII in isolated perfused kidneys of rats under control conditions and during NO synthase inhibition with L-NAME (100 microM). 2. Kidneys were perfused in the presence of cyclo-oxygenase inhibitor (10 microM indomethacin) with Tyrode's solution of relative viscosity zeta=1 (low viscosity perfusate, LVP) or, in order to augment shear stress, with Tyrode's solution containing 7% Ficoll 70 of relative viscosity zeta=2 (high viscosity perfusate, HVP). 3. Vascular conductance was 3.5+/-0.4 fold larger in HVP as compared with LVP kidneys, associated with an augmentation of overall wall shear stress by 37+/-5%. During NO inhibition, vascular conductance was only 2.5+/-0.2 fold elevated in HVP vs LVP kidneys, demonstrating shear stress-induced vasodilatation by NO and non-NO/non-prostanoid compound(s). 4. ANGII (10 - 100 pM) constricted the vasculature in LVP kidneys, but was without effect in HVP kidneys. During NO inhibition, in contrast, ANGII vasoconstriction was potentiated in HVP as compared with LVP kidneys. 5. The potentiation of ANGII vasoconstriction during NO inhibition has been shown to be mediated by endothelium-derived P450 metabolites and to be sensitive to AT2 receptor blockade in our earlier studies. Accordingly, in HVP kidneys, increasing concentrations of the AT2 receptor antagonist PD123319 (5 and 500 nM) gradually abolished the potentiation of ANGII vasoconstriction during NO inhibition, but did not affect vasoconstriction in response to ANGII in LVP kidneys. 6. Our results demonstrate, that augmentation of shear stress by increasing perfusate viscosity induces vasodilatation in the rat kidney, which is partially mediated by NO. Elevated levels of shear stress attenuate
Tyler, Shaun D.; Severini, Alberto
2006-01-01
We have sequenced the entire genome of herpesvirus papio 2 (HVP-2; Cercopithecine herpesvirus 16) strain X313, a baboon herpesvirus with close homology to other primate alphaherpesviruses, such as SA8, monkey B virus, and herpes simplex virus (HSV) type 1 and type 2. The genome of HVP-2 is 156,487 bp in length, with an overall GC content of 76.5%. The genome organization is identical to that of the other members of the genus Simplexvirus, with a long and a short unique region, each bordered by inverted repeats which end with an “a” sequence. All of the open reading frames detected in this genome were homologous and colinear with those of SA8 and B virus. The HSV gene RL1 (γ134.5; neurovirulence factor) is not present in HVP-2, as is the case for SA8 and B virus. The HVP-2 genome is 85% homologous to its closest relative, SA8. However, segment-by-segment bootstrap analysis of the genome revealed at least two regions that display closer homology to the corresponding sequences of B virus. The first region comprises the UL41 to UL44 genes, and the second region is located within the UL36 gene. We hypothesize that this localized and defined shift in homology is due to recombination events between an SA8-like progenitor of HVP-2 and a herpesvirus species more closely related to the B virus. Since some of the genes involved in these putative recombination events are determinants of virulence, a comparative analysis of their function may provide insight into the pathogenic mechanism of simplexviruses. PMID:16414998
Tyler, Shaun D; Severini, Alberto
2006-02-01
We have sequenced the entire genome of herpesvirus papio 2 (HVP-2; Cercopithecine herpesvirus 16) strain X313, a baboon herpesvirus with close homology to other primate alphaherpesviruses, such as SA8, monkey B virus, and herpes simplex virus (HSV) type 1 and type 2. The genome of HVP-2 is 156,487 bp in length, with an overall GC content of 76.5%. The genome organization is identical to that of the other members of the genus Simplexvirus, with a long and a short unique region, each bordered by inverted repeats which end with an "a" sequence. All of the open reading frames detected in this genome were homologous and colinear with those of SA8 and B virus. The HSV gene RL1 (gamma(1)34.5; neurovirulence factor) is not present in HVP-2, as is the case for SA8 and B virus. The HVP-2 genome is 85% homologous to its closest relative, SA8. However, segment-by-segment bootstrap analysis of the genome revealed at least two regions that display closer homology to the corresponding sequences of B virus. The first region comprises the UL41 to UL44 genes, and the second region is located within the UL36 gene. We hypothesize that this localized and defined shift in homology is due to recombination events between an SA8-like progenitor of HVP-2 and a herpesvirus species more closely related to the B virus. Since some of the genes involved in these putative recombination events are determinants of virulence, a comparative analysis of their function may provide insight into the pathogenic mechanism of simplexviruses.
Four-flavour leading hadronic contribution to the muon anomalous magnetic moment
International Nuclear Information System (INIS)
Burger, Florian; Hotzel, Grit; Jansen, Karl; Renner, Dru B.
2013-11-01
We present a four-flavour lattice calculation of the leading-order hadronic vacuum polarisation contribution to the anomalous magnetic moment of the muon, a hvp μ , arising from quark-connected Feynman graphs. It is based on ensembles featuring N f =2+1+1 dynamical twisted mass fermions generated by the European Twisted Mass Collaboration (ETMC). Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass. We employ three lattice spacings to examine lattice artefacts and several different volumes to check for finite-size effects. Including the complete first two generations of quarks allows for a direct comparison with phenomenological determinations of a hvp μ . Our final result involving an estimate of the systematic uncertainty a hvp μ =6.74(21)(18) x 10 -8 shows a good overall agreement with these computations.
Four-flavour leading-order hadronic contribution to the muon anomalous magnetic moment
International Nuclear Information System (INIS)
Burger, Florian; Feng, Xu; Hotzel, Grit; Jansen, Karl; Petschlies, Marcus; Renner, Dru B.
2014-01-01
We present a four-flavour lattice calculation of the leading-order hadronic vacuum polarisation contribution to the anomalous magnetic moment of the muon, a μ hvp , arising from quark-connected Feynman graphs. It is based on ensembles featuring N f =2+1+1 dynamical twisted mass fermions generated by the European Twisted Mass Collaboration (ETMC). Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass. We employ three lattice spacings to examine lattice artefacts and several different volumes to check for finite-size effects. Incorporating the complete first two generations of quarks allows for a direct comparison with phenomenological determinations of a μ hvp . Our final result including an estimate of the systematic uncertainty a μ hvp =6.74(21)(18)⋅10 −8 shows a good overall agreement with these computations
Four-flavour leading-order hadronic contribution to the muon anomalous magnetic moment
Energy Technology Data Exchange (ETDEWEB)
Burger, Florian [Humboldt-Universität zu Berlin, Institut für Physik,Newtonstr. 15, D-12489 Berlin (Germany); Feng, Xu [High Energy Accelerator Research Organization (KEK),Tsukuba 305-0801 (Japan); Hotzel, Grit [Humboldt-Universität zu Berlin, Institut für Physik,Newtonstr. 15, D-12489 Berlin (Germany); Jansen, Karl [NIC, DESY,Platanenallee 6, D-15738 Zeuthen (Germany); Department of Physics, University of Cyprus,P.O.Box 20537, 1678 Nicosia (Cyprus); Petschlies, Marcus [The Cyprus Institute,P.O.Box 27456, 1645 Nicosia (Cyprus); Renner, Dru B. [Jefferson Lab,12000 Jefferson Avenue, Newport News, VA 23606 (United States); Collaboration: The ETM Collaboration
2014-02-24
We present a four-flavour lattice calculation of the leading-order hadronic vacuum polarisation contribution to the anomalous magnetic moment of the muon, a{sub μ}{sup hvp}, arising from quark-connected Feynman graphs. It is based on ensembles featuring N{sub f}=2+1+1 dynamical twisted mass fermions generated by the European Twisted Mass Collaboration (ETMC). Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass. We employ three lattice spacings to examine lattice artefacts and several different volumes to check for finite-size effects. Incorporating the complete first two generations of quarks allows for a direct comparison with phenomenological determinations of a{sub μ}{sup hvp}. Our final result including an estimate of the systematic uncertainty a{sub μ}{sup hvp}=6.74(21)(18)⋅10{sup −8} shows a good overall agreement with these computations.
Four-flavour leading hadronic contribution to the muon anomalous magnetic moment
Energy Technology Data Exchange (ETDEWEB)
Burger, Florian; Hotzel, Grit [Humboldt-Universitaet, Berlin (Germany). Inst. fuer Physik; Feng, Xu [KEK National High Energy Physics, Tsukuba (Japan); Jansen, Karl [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Cyprus Univ. Nicosia (Cyprus). Dept. of Physics; Petschlies, Marcus [The Cyprus Institute, Nicosia (Cyprus); Renner, Dru B. [Jefferson Lab, Newport News, VA (United States)
2013-11-15
We present a four-flavour lattice calculation of the leading-order hadronic vacuum polarisation contribution to the anomalous magnetic moment of the muon, a{sup hvp}{sub {mu}}, arising from quark-connected Feynman graphs. It is based on ensembles featuring N{sub f}=2+1+1 dynamical twisted mass fermions generated by the European Twisted Mass Collaboration (ETMC). Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass. We employ three lattice spacings to examine lattice artefacts and several different volumes to check for finite-size effects. Including the complete first two generations of quarks allows for a direct comparison with phenomenological determinations of a{sup hvp}{sub {mu}}. Our final result involving an estimate of the systematic uncertainty a{sup hvp}{sub {mu}}=6.74(21)(18) x 10{sup -8} shows a good overall agreement with these computations.
Fuentes-Pananá, E M; Swaminathan, S; Ling, P D
1999-01-01
The Epstein-Barr virus (EBV) EBNA2 protein is a transcriptional activator that controls viral latent gene expression and is essential for EBV-driven B-cell immortalization. EBNA2 is expressed from the viral C promoter (Cp) and regulates its own expression by activating Cp through interaction with the cellular DNA binding protein CBF1. Through regulation of Cp and EBNA2 expression, EBV controls the pattern of latent protein expression and the type of latency established. To gain further insight into the important regulatory elements that modulate Cp usage, we isolated and sequenced the Cp regions corresponding to nucleotides 10251 to 11479 of the EBV genome (-1079 to +144 relative to the transcription initiation site) from the EBV-like lymphocryptoviruses found in baboons (herpesvirus papio; HVP) and Rhesus macaques (RhEBV). Sequence comparison of the approximately 1,230-bp Cp regions from these primate viruses revealed that EBV and HVP Cp sequences are 64% conserved, EBV and RhEBV Cp sequences are 66% conserved, and HVP and RhEBV Cp sequences are 65% conserved relative to each other. Approximately 50% of the residues are conserved among all three sequences, yet all three viruses have retained response elements for glucocorticoids, two positionally conserved CCAAT boxes, and positionally conserved TATA boxes. The putative EBNA2 100-bp enhancers within these promoters contain 54 conserved residues, and the binding sites for CBF1 and CBF2 are well conserved. Cp usage in the HVP- and RhEBV-transformed cell lines was detected by S1 nuclease protection analysis. Transient-transfection analysis showed that promoters of both HVP and RhEBV are responsive to EBNA2 and that they bind CBF1 and CBF2 in gel mobility shift assays. These results suggest that similar mechanisms for regulation of latent gene expression are conserved among the EBV-related lymphocryptoviruses found in nonhuman primates.
Ventilator caregiver education through the use of high-fidelity pediatric simulators: a pilot study.
Tofil, Nancy M; Rutledge, Chrystal; Zinkan, J Lynn; Youngblood, Amber Q; Stone, Julie; Peterson, Dawn Taylor; Slayton, Donna; Makris, Chris; Magruder, Terri; White, Marjorie Lee
2013-11-01
Introduction. Home ventilator programs (HVP) have been developed to train parents of critically ill children. Simulators are used in health care, but not often for parents. We added simulation to our HVP and assessed parents' response. Methods. In July 2008, the HVP at Children's of Alabama added simulation to parent training. Debriefing was provided after the training session to reinforce correct skills and critical thinking. Follow-up surveys were completed after training. Results. Fifteen families participated. All parents were confident in changing tracheostomies, knowing signs of breathing difficulties, and responding to alarms. 71% strongly agree that simulation resulted in feeling better prepared to care for their child. 86% felt simulation improved their confidence in taking care of their child. Conclusion. Simulators provide a crucial transition between learned skills and application. This novel use of simulation-based education improves parents' confidence in emergencies and may lead to shortened training resulting in cost savings.
Ceapa, Corina; Davids, Mark; Ritari, Jarmo; Lambert, Jolanda; Wels, Michiel; Douillard, François P; Smokvina, Tamara; de Vos, Willem M; Knol, Jan; Kleerebezem, Michiel
2016-07-02
Lactobacillus rhamnosus is a diverse Gram-positive species with strains isolated from different ecological niches. Here, we report the genome sequence analysis of 40 diverse strains of L. rhamnosus and their genomic comparison, with a focus on the variable genome. Genomic comparison of 40 L. rhamnosus strains discriminated the conserved genes (core genome) and regions of plasticity involving frequent rearrangements and horizontal transfer (variome). The L. rhamnosus core genome encompasses 2,164 genes, out of 4,711 genes in total (the pan-genome). The accessory genome is dominated by genes encoding carbohydrate transport and metabolism, extracellular polysaccharides (EPS) biosynthesis, bacteriocin production, pili production, the cas system, and the associated clustered regularly interspaced short palindromic repeat (CRISPR) loci, and more than 100 transporter functions and mobile genetic elements like phages, plasmid genes, and transposons. A clade distribution based on amino acid differences between core (shared) proteins matched with the clade distribution obtained from the presence-absence of variable genes. The phylogenetic and variome tree overlap indicated that frequent events of gene acquisition and loss dominated the evolutionary segregation of the strains within this species, which is paralleled by evolutionary diversification of core gene functions. The CRISPR-Cas system could have contributed to this evolutionary segregation. Lactobacillus rhamnosus strains contain the genetic and metabolic machinery with strain-specific gene functions required to adapt to a large range of environments. A remarkable congruency of the evolutionary relatedness of the strains' core and variome functions, possibly favoring interspecies genetic exchanges, underlines the importance of gene-acquisition and loss within the L. rhamnosus strain diversification. © The Author(s) 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Nicolau, A E; Merlan, V; Dinescu, G; Crăciun, M; Kitkani, A; Beuran, M
2012-01-01
Blunt hollow viscus perforations (HVP) due to abdominal contusions (AC), although rare, are difficult to diagnose early and are associated with a high mortality. Our paper analyses retrospectively data from patients operated for HVP between January 2005 and January 2009, the efficiency of different diagnostic tools, mortality and prognostic factors for death. There were 62 patients operated for HVP, 14 of which had isolated abdominal contusion and 48 were poly trauma patients. There were 9 women and 53 men, the mean age was 41.5 years (SD: +17,9), the mean ISS was 32.94 (SD: +15,94), 23 patients had associated solid viscus injuries (SVI). Clinical examination was irelevant for 16 of the 62 patients, abdominal Xray was false negative for 30 out of 35 patients and abdominal ultrasound was false negative for 16 out of 60 patients. Abdominal CT was initially false negative for 7 out of 38 patients: for 4 of them the abdominal CT was repeated and was positive for HVP, for 3 patients a diagnostic laparoscopy was performed. Direct signs for HVP on abdominal CT were present for 3 out of 38 patients. Diagnostic laparoscopy was performed for 7 patients with suspicion for HVP, and was positive for 6 of them and false negative for a patient with a duodenal perforation. Single organ perforations were present in 55 cases, multi organ perforations were present in 7 cases. There were 15 deaths (15.2%), most of them caused by haemodynamic instability (3 out of 6 patients) and associated lesions: SOL for 9 out of 23 cases, pelvic fracture (PF) for 6 out of 14 patients, craniocerebral trauma (CCT) for 12 out of 33 patients.Multivariate analysis showed that the prognostic factors for death were ISS value (p = 0,023) and associated CCT (odds ratio = 4,95; p = 0,017). The following factors were not confirmed as prognostic factors for death: age, haemodynamic instability, associated SVI, thoracic trauma (TT), pelvic fractures (PF), limbs fractures (LF) and admission-operation interval
Genualdi, Susan; Nyman, Patricia; DeJager, Lowri
2017-01-01
Acid hydrolyzed vegetable protein (aHVP) is used for flavoring a wide variety of foods and also in the production of nonfermented soy sauce. During the production of aHVP, chloropropanols including 3-monochloropropane-1,2-diol (3-MCPD) and 1,3 dichloropropane-2-ol (1,3-DCP) can be formed through the reaction of the hydrochloric acid catalyst and residual fat and the reaction of 3-MCPD with acetic acid, respectively. 3-MCPD is a carcinogen, and 1,3-DCP has been classified as a genotoxic carcin...
Sand, L; Rizell, M; Houltz, E; Karlsen, K; Wiklund, J; Odenstedt Hergès, H; Stenqvist, O; Lundin, S
2011-10-01
It has been suggested that blood loss during liver resection may be reduced if central venous pressure (CVP) is kept at a low level. This can be achieved by changing patient position but it is not known how position changes affect portal (PVP) and hepatic (HVP) venous pressures. The aim of the study was to assess if changes in body position result in clinically significant changes in these pressures. We studied 10 patients undergoing liver resection. Mean arterial pressure (MAP) and CVP were measured using fluid-filled catheters, PVP and HVP with tip manometers. Measurements were performed in the horizontal, head up and head down tilt position with two positive end expiratory pressure (PEEP) levels. A 10° head down tilt at PEEP 5 cm H(2) O significantly increased CVP (11 ± 3 to 15 ± 3 mmHg) and MAP (72 ± 8 to 76 ± 8 mmHg) while head up tilt at PEEP 5 cm H(2) O decreased CVP (11 ± 3 to 6 ± 4 mmHg) and MAP (72 ± 8 to 63 ± 7 mmHg) with minimal changes in transhepatic venous pressures. Increasing PEEP from 5 to 10 resulted in small increases, around 1 mmHg in CVP, PVP and HVP. There was no significant correlation between changes in CVP vs. PVP and HVP during head up tilt and only a weak correlation between CVP and HVP by head down tilt. Changes of body position resulted in marked changes in CVP but not in HVPs. Head down or head up tilt to reduce venous pressures in the liver may therefore not be effective measures to reduce blood loss during liver surgery. 2011 The Authors Acta Anaesthesiologica Scandinavica, 2011 The Acta Anaesthesiologica Scandinavica Foundation.
Ling, P D; Ryon, J J; Hayward, S D
1993-01-01
EBNA-2 contributes to the establishment of Epstein-Barr virus (EBV) latency in B cells and to the resultant alterations in B-cell growth pattern by up-regulating expression from specific viral and cellular promoters. We have taken a comparative approach toward characterizing functional domains within EBNA-2. To this end, we have cloned and sequenced the EBNA-2 gene from the closely related baboon virus herpesvirus papio (HVP). All human EBV isolates have either a type A or type B EBNA-2 gene. However, the HVP EBNA-2 gene falls into neither the type A category nor the type B category, suggesting that the separation into these two subtypes may have been a recent evolutionary event. Comparison of the predicted amino acid sequences indicates 37% amino acid identity with EBV type A EBNA-2 and 35% amino acid identity with type B EBNA-2. To define the domains of EBNA-2 required for transcriptional activation, the DNA binding domain of the GAL4 protein was fused to overlapping segments of EBV EBNA-2. This approach identified a 40-amino-acid (40-aa) EBNA-2 activation domain located between aa 437 and 477. Transactivation ability was completely lost when the amino-terminal boundary of this domain was moved to aa 441, indicating that the motif at aa 437 to 440, Pro-Ile-Leu-Phe, contains residues critical for function. The aa 437 boundary identified in these experiments coincides precisely with a block of conserved sequences in HVP EBNA-2, and the comparable carboxy-terminal region of HVP EBNA-2 also functioned as a strong transcriptional activation domain when fused to the Gal4(1-147) protein. The EBV and HVP EBNA-2 activation domains share a mixed proline-rich, negatively charged character with a striking conservation of positionally equivalent hydrophobic residues. The importance of the individual amino acids making up the Pro-Ile-Leu-Phe motif was examined by mutagenesis. Any alteration of these residues was found to reduce transactivation efficiency, with changes at the
Hebner, Christy; Lasanen, Julie; Battle, Scott; Aiyar, Ashok
2003-07-05
Epstein-Barr virus (EBV) and the closely related Herpesvirus papio (HVP) are stably replicated as episomes in proliferating latently infected cells. Maintenance and partitioning of these viral plasmids requires a viral sequence in cis, termed the family of repeats (FR), that is bound by a viral protein, Epstein-Barr nuclear antigen 1 (EBNA1). Upon binding FR, EBNA1 maintains viral genomes in proliferating cells and activates transcription from viral promoters required for immortalization. FR from either virus encodes multiple binding sites for the viral maintenance protein, EBNA1, with the FR from the prototypic B95-8 strain of EBV containing 20 binding sites, and FR from HVP containing 8 binding sites. In addition to differences in the number of EBNA1-binding sites, adjacent binding sites in the EBV FR are typically separated by 14 base pairs (bp), but are separated by 10 bp in HVP. We tested whether the number of binding sites, as well as the distance between adjacent binding sites, affects the function of EBNA1 in transcription activation or plasmid maintenance. Our results indicate that EBNA1 activates transcription more efficiently when adjacent binding sites are separated by 10 bp, the spacing observed in HVP. In contrast, using two separate assays, we demonstrate that plasmid maintenance is greatly augmented when adjacent EBNA1-binding sites are separated by 14 bp, and therefore, presumably lie on the same face of the DNA double helix. These results provide indication that the functions of EBNA1 in transcription activation and plasmid maintenance are separable.
International Nuclear Information System (INIS)
Hebner, Christy; Lasanen, Julie; Battle, Scott; Aiyar, Ashok
2003-01-01
Epstein-Barr virus (EBV) and the closely related Herpesvirus papio (HVP) are stably replicated as episomes in proliferating latently infected cells. Maintenance and partitioning of these viral plasmids requires a viral sequence in cis, termed the family of repeats (FR), that is bound by a viral protein, Epstein-Barr nuclear antigen 1 (EBNA1). Upon binding FR, EBNA1 maintains viral genomes in proliferating cells and activates transcription from viral promoters required for immortalization. FR from either virus encodes multiple binding sites for the viral maintenance protein, EBNA1, with the FR from the prototypic B95-8 strain of EBV containing 20 binding sites, and FR from HVP containing 8 binding sites. In addition to differences in the number of EBNA1-binding sites, adjacent binding sites in the EBV FR are typically separated by 14 base pairs (bp), but are separated by 10 bp in HVP. We tested whether the number of binding sites, as well as the distance between adjacent binding sites, affects the function of EBNA1 in transcription activation or plasmid maintenance. Our results indicate that EBNA1 activates transcription more efficiently when adjacent binding sites are separated by 10 bp, the spacing observed in HVP. In contrast, using two separate assays, we demonstrate that plasmid maintenance is greatly augmented when adjacent EBNA1-binding sites are separated by 14 bp, and therefore, presumably lie on the same face of the DNA double helix. These results provide indication that the functions of EBNA1 in transcription activation and plasmid maintenance are separable
Blum, T; Boyle, P A; Izubuchi, T; Jin, L; Jüttner, A; Lehner, C; Maltman, K; Marinkovic, M; Portelli, A; Spraggs, M
2016-06-10
We report the first lattice QCD calculation of the hadronic vacuum polarization (HVP) disconnected contribution to the muon anomalous magnetic moment at physical pion mass. The calculation uses a refined noise-reduction technique that enables the control of statistical uncertainties at the desired level with modest computational effort. Measurements were performed on the 48^{3}×96 physical-pion-mass lattice generated by the RBC and UKQCD Collaborations. We find the leading-order hadronic vacuum polarization a_{μ}^{HVP(LO)disc}=-9.6(3.3)(2.3)×10^{-10}, where the first error is statistical and the second systematic.
Blum, T.; Boyle, P. A.; Izubuchi, T.; Jin, L.; Jüttner, A.; Lehner, C.; Maltman, K.; Marinkovic, M.; Portelli, A.; Spraggs, M.; Rbc; Ukqcd Collaborations
2016-06-01
We report the first lattice QCD calculation of the hadronic vacuum polarization (HVP) disconnected contribution to the muon anomalous magnetic moment at physical pion mass. The calculation uses a refined noise-reduction technique that enables the control of statistical uncertainties at the desired level with modest computational effort. Measurements were performed on the 483×96 physical-pion-mass lattice generated by the RBC and UKQCD Collaborations. We find the leading-order hadronic vacuum polarization aμHVP (LO )disc=-9.6 (3.3 )(2.3 )×10-10 , where the first error is statistical and the second systematic.
Chakraborty, B.; Davies, C. T. H.; Detar, C.; El-Khadra, A. X.; Gámiz, E.; Gottlieb, Steven; Hatton, D.; Koponen, J.; Kronfeld, A. S.; Laiho, J.; Lepage, G. P.; Liu, Yuzhi; MacKenzie, P. B.; McNeile, C.; Neil, E. T.; Simone, J. N.; Sugar, R.; Toussaint, D.; van de Water, R. S.; Vaquero, A.; Fermilab Lattice, Hpqcd,; Milc Collaborations
2018-04-01
All lattice-QCD calculations of the hadronic-vacuum-polarization contribution to the muon's anomalous magnetic moment to date have been performed with degenerate up- and down-quark masses. Here we calculate directly the strong-isospin-breaking correction to aμHVP for the first time with physical values of mu and md and dynamical u , d , s , and c quarks, thereby removing this important source of systematic uncertainty. We obtain a relative shift to be applied to lattice-QCD results obtained with degenerate light-quark masses of δ aμHVP ,mu≠md=+1.5 (7 )% , in agreement with estimates from phenomenology.
Horvath, Monica; Levy, Janet; L'Engle, Pete; Carlson, Boyd; Ahmad, Asif; Ferranti, Jeffrey
2011-05-26
Internet portal technologies that provide access to portions of electronic health records have the potential to revolutionize patients' involvement in their care. However, relatively few descriptions of the demographic characteristics of portal enrollees or of the effects of portal technology on quality outcomes exist. This study examined data from patients who attended one of seven Duke Medicine clinics and who were offered the option of enrolling in and using the Duke Medicine HealthView portal (HVP). The HVP allows patients to manage details of their appointment scheduling and provides automated email appointment reminders in addition to the telephone and mail reminders that all patients receive. Our objective was to test whether portal enrollment with an email reminder functionality is significantly related to decreases in rates of appointment "no-shows," which are known to impair clinic operational efficiency. Appointment activity during a 1-year period was examined for all patients attending one of seven Duke Medicine clinics. Patients were categorized as portal enrollees or as nonusers either by their status at time of appointment or at the end of the 1-year period. Demographic characteristics and no-show rates among these groups were compared. A binomial logistic regression model was constructed to measure the adjusted impact of HVP enrollment on no-show rates, given confounding factors. To demonstrate the effect of HVP use over time, monthly no-show rates were calculated for patient appointment keeping and contrasted between preportal and postportal deployment periods. Across seven clinics, 58,942 patients, 15.7% (9239/58,942) of whom were portal enrollees, scheduled 198,199 appointments with an overall no-show rate of 9.9% (19,668/198,199). We found that HVP enrollees were significantly more likely to be female, white, and privately insured compared with nonusers. Bivariate no-show rate differences between portal enrollment groups varied widely according
Survival in pediatric lung transplantation: The effect of center volume and expertise.
Khan, Muhammad S; Zhang, Wei; Taylor, Rachel A; Dean McKenzie, E; Mallory, George B; Schecter, Marc G; Morales, David L S; Heinle, Jeffrey S; Adachi, Iki
2015-08-01
Institutional operative volume has been shown to impact outcomes of various procedures including lung transplantation (LTx). We sought to determine whether this holds true with pediatric LTx by comparing outcomes of adult centers (with larger overall volume) to those of pediatric centers (with smaller volume but more pediatric-specific experience). A retrospective analysis of the Organ Procurement and Transplant Network data was performed. Centers were categorized as either adult (LTx volume predominantly in adult patients), high-volume pediatric (HVP, ≥4 LTxs/year), or low-volume pediatric (LVP, HVP 3 [5%], LVP 8 [13%]). Although adult centers had larger overall LTx volume, their pediatric experiences were severely limited (median 1/year). In younger children, HVP centers were significantly better than LVP centers for patient survival (half-life: 7.3 vs 2.9 years, p = 0.002). Similarly, in older children and adolescents, HVP centers were significantly better than adult centers for patient survival (half-life: 4.6 vs 2.5 years, p = 0.001). Of note, even LVP centers tended to have longer patient survival than adult centers (p = 0.064). Multivariable analysis identified adult centers as an independent risk factor for graft failure (hazard ratio: 1.5, p < 0.001) as with LVP (hazard ratio: 1.3, p = 0.0078). Despite larger overall clinical volume, outcomes among pediatric LTx recipients in adult centers are not superior to those of pediatric centers. Not only center volume but pediatric-specific experience has an impact on outcomes in pediatric LTx. Copyright © 2015 International Society for Heart and Lung Transplantation. Published by Elsevier Inc. All rights reserved.
Hayashi, K; Teramoto, N; Akagi, T
2002-10-01
Animal models of human EBV-associated diseases are essential to elucidate the pathogenesis of EBV-associated diseases. Here we review those previous models using EBV or EBV-like herpesviruses and describe the details on our two newly-developed rabbit models of lymphoproliferative diseases (LPD) induced by simian EBV-like viruses. The first is Cynomolgus-EBV-induced T-cell lymphomas in rabbits inoculated intravenously (77-90%) and orally (82-89%) during 2-5 months. EBV-DNA was detected in peripheral blood by PCR from 2 days after oral inoculation, while anti-EBV-VCA IgG was raised 3 weeks later. Rabbit lymphomas and their cell lines contained EBV-DNA and expressed EBV-encoded RNA-1 (EBER-1). Rabbit lymphoma cell lines, most of which have specific chromosomal abnormality, showed tumorigenicity in nude mice. The second is the first animal model for EBV-infected T-cell LPD with virus-associated hemophagocytic syndrome (VAHS), using rabbits infected with an EBV-like herpesvirus, Herpesvirus papio (HVP). Rabbits inoculated intravenously with HVP-producing cells showed increased anti-EBV-VCA-IgG titers, and most (85%) subsequently died of fatal LPD and VAHS, with bleeding and hepatosplenomegaly, during 22-105 days. Peroral spray of cell-free HVP induced viral infection with seroconversion in 3 out of 5 rabbits, with 2 of the 3 infected rabbits dying of LPD with VAHS. Atypical T lymphocytes containing HVP-DNA and expressing EBER-1 were observed in many organs. Hemophagocytic histiocytosis was observed in the lymph nodes, spleen, bone marrow, and thymus. These rabbit models are also useful and inexpensive alternative experimental model systems for studying the biology and pathogenesis of EBV, and prophylactic and therapeutic regimens.
Odendaal, Willem; van Niekerk, Ashley; Jordaan, Esme; Seedat, Mohamed
2009-01-01
The continued high mortality and morbidity rates for unintentional childhood injuries remain a public health concern. This article reports on the influence of a home visitation programme (HVP) on household hazards associated with unintentional childhood injuries in a South African low-income setting. A randomised controlled trial (n=211 households) was conducted in a South African informal settlement. Community members were recruited and trained as paraprofessional visitors. Four intervention visits were conducted over 3 months, focusing on child development, and the prevention of burn, poison, and fall injuries. The HVP, a multi-component intervention, included educational inputs, provision of safety devices, and an implicit enforcement strategy. The intervention effect (IE) was measured with a standardised risk assessment index that compared post-intervention scores for intervention and control households. A significant reduction was observed in the hazards associated with electrical and paraffin appliances, as well as in hazards related to poisoning. Non-significant changes were observed for burn safety household practices and fall injury hazards. This study confirmed that a multi-component HVP effectively reduced household hazards associated with electrical and paraffin appliances and poisoning among children in a low-income South African setting.
Leading-order hadronic contributions to aμ and αQED from Nf=2+1+1 twisted mass fermions
International Nuclear Information System (INIS)
Feng, Xu; Hotzel, Grit; Renner, Dru B.
2012-11-01
We present the first four-flavour lattice calculation of the leading-order hadronic vacuum-polarisation contribution to the anomalous magnetic moment of the muon, a hvp μ , and the hadronic running of the QED coupling constant, Δα hvp QED (Q 2 ). In the heavy sector a mixed-action setup is employed. The bare quark masses are determined from matching the K- and D-meson masses to their physical values. Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass by utilising a recently proposed improved method. We demonstrate that this method also works in the four-flavour case.
Genualdi, Susan; Nyman, Patricia; DeJager, Lowri
2017-01-01
Acid hydrolyzed vegetable protein (aHVP) is used for flavoring a wide variety of foods and also in the production of nonfermented soy sauce. During the production of aHVP, chloropropanols including 3-monochloropropane-1,2-diol (3-MCPD) and 1,3 dichloropropane-2-ol (1,3-DCP) can be formed through the reaction of the hydrochloric acid catalyst and residual fat and the reaction of 3-MCPD with acetic acid, respectively. 3-MCPD is a carcinogen, and 1,3-DCP has been classified as a genotoxic carcinogen. The European Union (EU) has set a maximum concentration of 0.02 mg/kg of 3-MCPD in aHVP, and the Food and Drug Administration (FDA) set a guidance limit of 1 mg/kg of 3-MCPD in aHVP. 1,3-DCP is not an approved food additive, and the Joint FAO/WHO Expert Committee on Food Additives (JEFCA) has set a limit at 0.005 mg/kg, which is close to the estimated method detection limit. Currently there are few analytical methods for the simultaneous determination of 3-MCPD and 1,3-DCP without derivatization due to differences in their physical chemical properties and reactivity. A new method was developed using QuEChERS (quick, easy, cheap, effective, rugged, and safe) with direct analysis of the extract without derivatization using gas chromatography–triple quadrupole mass spectrometry (GC-QQQ). Additionally, a market sampling of 60 soy sauce samples was performed in 2015 to determine if concentrations have changed since the FDA limit was set in 2008. The sampling results were compared between the new QuEChERS method and a method using phenylboronic acid (PBA) as a derivatizing agent for 3-MCPD analysis. The concentrations of 3-MCPD detected in soy sauce samples collected in 2015 (3-MCPD below current regulatory limits PMID:28064506
Genualdi, Susan; Nyman, Patricia; DeJager, Lowri
2017-02-01
Acid hydrolyzed vegetable protein (aHVP) is used for flavoring a wide variety of foods and also in the production of nonfermented soy sauce. During the production of aHVP, chloropropanols including 3-monochloropropane-1,2-diol (3-MCPD) and 1,3 dichloropropane-2-ol (1,3-DCP) can be formed through the reaction of the hydrochloric acid catalyst and residual fat and the reaction of 3-MCPD with acetic acid, respectively. 3-MCPD is a carcinogen, and 1,3-DCP has been classified as a genotoxic carcinogen. The European Union (EU) has set a maximum concentration of 0.02 mg/kg of 3-MCPD in aHVP, and the Food and Drug Administration (FDA) set a guidance limit of 1 mg/kg of 3-MCPD in aHVP. 1,3-DCP is not an approved food additive, and the Joint FAO/WHO Expert Committee on Food Additives (JEFCA) has set a limit at 0.005 mg/kg, which is close to the estimated method detection limit. Currently there are few analytical methods for the simultaneous determination of 3-MCPD and 1,3-DCP without derivatization due to differences in their physical chemical properties and reactivity. A new method was developed using QuEChERS (quick, easy, cheap, effective, rugged, and safe) with direct analysis of the extract without derivatization using gas chromatography-triple quadrupole mass spectrometry (GC-QQQ). Additionally, a market sampling of 60 soy sauce samples was performed in 2015 to determine if concentrations have changed since the FDA limit was set in 2008. The sampling results were compared between the new QuEChERS method and a method using phenylboronic acid (PBA) as a derivatizing agent for 3-MCPD analysis. The concentrations of 3-MCPD detected in soy sauce samples collected in 2015 (3-MCPD below current regulatory limits.
Energy Technology Data Exchange (ETDEWEB)
Feng, Xu [High Energy Accelerator Research Organization (KEK), Tsukuba, Ibaraki (Japan); Hotzel, Grit [Humboldt-Universitaet, Berlin (Germany). Inst. fuer Physik; Jansen, Karl [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Petschlies, Marcus [The Cyprus Institute, Nicosia (Cyprus); Renner, Dru B. [Jefferson Lab, Newport News, VA (United States)
2012-11-15
We present the first four-flavour lattice calculation of the leading-order hadronic vacuum-polarisation contribution to the anomalous magnetic moment of the muon, a{sup hvp}{sub {mu}}, and the hadronic running of the QED coupling constant, {Delta}{alpha}{sup hvp}{sub QED}(Q{sup 2}). In the heavy sector a mixed-action setup is employed. The bare quark masses are determined from matching the K- and D-meson masses to their physical values. Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass by utilising a recently proposed improved method. We demonstrate that this method also works in the four-flavour case.
Application of chiral resonance Lagrangian theories to the muon g-2
International Nuclear Information System (INIS)
Jegerlehner, Fred
2013-12-01
We think that phenomenological resonance Lagrangian models, constrained by global fits from low energy hadron reaction data, can help to improve muon g-2 predictions. The main issue are those contributions which cannot be calculated by perturbative means: the hadronic vacuum polarization (HVP) effects and the hadronic light-by-light (HLbL) scattering contribution. I review recent progress in the evaluation of the HVP contribution within the broken Hidden Local Symmetry (HLS) framework, worked out in collaboration with M. Benayoun, P. David and L. Del-Buono. Our HLS driven estimate reads a μ LO had = (688.60±4.24) . 10 -10 and we find a μ the = (11659177.65±5.76) . 10 -10 .
Energy Technology Data Exchange (ETDEWEB)
Xu Feng, Grit Hotzel, Karl Jansen, Marcus Petschlies, Dru B. Renner
2012-12-01
We present the first four-flavour lattice calculation of the leading-order hadronic vacuum polarisation contribution to the anomalous magnetic moment of the muon, a{sub {mu}}{sup hvp}, and the hadronic running of the QED coupling constant, {Delta}{alpha}{sup hvp}{sub QED}(Q{sup 2}). In the heavy sector a mixed-action setup is employed. The bare quark masses are determined from matching the K- and D-meson masses to their physical values. Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass by utilising a recently proposed improved method. We demonstrate that this method also works in the four-flavour case.
Energy Technology Data Exchange (ETDEWEB)
Feng, Xu [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Hotzel, Grit [Humboldt-Universitaet zu Berlin, Institut fuer Physik, Berlin (Germany); Jansen, Karl [NIC, DESY, Zeuthen (Germany); Petschlies, Marcus [The Cyprus Institute, Nicosia (Cyprus); Renner, Dru [Jefferson Lab, Newport News (United States)
2013-07-01
We present the first four-flavour lattice calculation of the leading-order hadronic vacuum-polarisation contribution to the anomalous magnetic moment of the muon, a{sub μ}{sup hvp}, and the hadronic running of the QED coupling constant, Δ α{sub QED}{sup hvp} (Q{sup 2}). In the heavy sector a mixed-action setup is employed. The bare quark masses are determined from matching the K- and D-meson masses to their physical values. Several light quark masses are used in order to yield a controlled extrapolation to the physical pion mass by utilising a recently proposed improved method. We demonstrate that this method also works in the four-flavour case.
Hsieh, Wen-Chuan; Chang, Yao; Hsu, Mei-Chi; Lan, Bau-Shin; Hsiao, Guan-Chung; Chuang, Huai-Chia; Su, Ih-Jen
2007-05-01
Hemophagocytic syndrome (HPS) is a fatal complication frequently associated with viral infections. In childhood HPS, Epstein-Barr virus (EBV) is the major causative agent, and red blood cells (RBCs) are predominantly phagocytosed by macrophages. To investigate the mechanism of RBC phagocytosis triggered by EBV infection, we adopted a rabbit model of EBV-associated HPS previously established by using Herpesvirus papio (HVP). The kinetics of virus-host interaction was studied. Using flow cytometry, we detected the emergence of antibody-coated RBCs, as well as anti-platelet antibodies, at peak virus load period at weeks 3 to 4 after HVP injection, and the titers increased thereafter. The presence of anti-RBCs preceded RBC phagocytosis in tissues and predicted the full-blown development of HPS. The anti-RBC antibodies showed cross-reactivity with Paul-Bunnell heterophile antibodies. Preabsorption of the HVP-infected serum with control RBCs removed the majority of anti-RBC activities and remarkably reduced RBC phagocytosis. The RBC phagocytosis was specifically mediated via an Fc fragment of antibodies in the presence of macrophage activation. Therefore, the emergence of anti-RBC antibodies and the presence of macrophage activation are both essential in the development of HPS. Our observations in this animal model provide a potential mechanism for hemophagocytosis in EBV infection.
O'Donohue, John; Ng, Chaan; Catnach, Susan; Farrant, Patricia; Williams, Roger
2004-02-01
To investigate the clinical utility and the intra-observer and inter-observer variability of Doppler ultrasound assessment of the hepatic and portal vessels along with measurement of spleen size in the diagnosis of chronic liver disease and cirrhosis. Ultrasound measurements of portal vein diameter (PVD), portal vein velocity (PVV), hepatic arterial resistance index (HARI), hepatic vein profile (HVP), and spleen size were obtained in 49 controls and 45 patients with liver disease (23 with primary biliary cirrhosis, 22 with hepatitis C) by two experienced observers, who each performed three blinded measurements of each variable. Control values were derived from normal hospital workers. Percutaneous liver biopsies in 41 of the patients showed cirrhosis (14 patients), moderate/severe fibrosis (13 patients), and early disease (14 patients). Seventy-one percent of cirrhotic patients had splenomegaly (> 13.6 cm). The spleen size was significantly larger in cirrhotics (16.0 cm) than in non-cirrhotics (13.0 cm, P HVP was abnormal in 76.9% of cirrhotics, 57.7% of non-cirrhotics and 2.1% of controls (P HVP are useful predictors of chronic liver disease and cirrhosis, and both can be measured reliably and reproducibly. However, Doppler measurements of PVV, PVD and HARI are not useful in distinguishing patients with chronic liver disease from normal controls.
DEFF Research Database (Denmark)
Kohonen-Corish, Maija R J; Macrae, Finlay; Genuardi, Maurizio
2011-01-01
Integration and Implementation Meeting at UNESCO in Paris, to review the progress of this pilot program. A wide range of topics were covered, including issues relating to genotype-phenotype data submission to the InSiGHT Colon Cancer Gene Variant Databases (chromium.liacs.nl/LOVD2/colon_cancer/home.php...
Sun, Fei; Wu, Q.; Wu, Y. L.; Zhao, H.; Yi, C. J.; Tian, Y. C.; Liu, H. W.; Shi, Y. G.; Ding, H.; Dai, X.; Richard, P.; Zhao, Jimin
2017-06-01
We report an ultrafast lattice dynamics investigation of the topological Dirac semimetal C d3A s2 . A coherent phonon beating among three evenly spaced A1 g optical phonon modes (of frequencies 1.80, 1.96, and 2.11 THz, respectively) is unambiguously observed. The two side modes originate from the counter helixes composing Cd vacancies. Significantly, such helix vacancy-induced phonon (HVP) modes experience prominent extra waning in their ultrafast dynamics as temperature increases, which is immune to the central mode. Above 200 K, the HVP becomes inactive, which may potentially affect the topological properties. Our results in the lattice degree of freedom suggest the indispensable role of temperature in considering topological properties of such quantum materials.
Hadronic contribution to the muon g-2: A Dyson-Schwinger perspective
Goecke, T.; Fischer, C. S.; Williams, R.
2012-04-01
We summarize our results for hadronic contributions to the anomalous magnetic moment of the muon (aμ), the one from hadronic vacuum-polarization (HVP) and the light-by-light scattering contribution (LBL), obtained from the Dyson-Schwinger equations (DSEs) of QCD. In the case of HVP we find good agreement with model independent determinations from dispersion relations for aμHV P as well as for the Adler function with deviations well below the ten percent level. From this we conclude that the DSE approach should be capable of describing aμLBL with similar accuracy. We also present results for LBL using a resonance expansion of the quark-anti-quark T-matrix. Our preliminary value is aμLBL=(217±91)×10-11.
Hadronic vacuum polarization in true muonium
Lamm, Henry
2017-01-01
In order to reduce the theoretical uncertainty in the prediction, the leading-order hadronic vacuum polarization contribution to the hyperfine splitting of true muonium is reevaluated in two ways. A more complex pionic form factor and better estimates of the perturbative QCD contributions are used to study the model dependence of the previous calculation. The second, more accurate method directly integrates the Drell ratio R (s ) to obtain C1 ,HVP=-0.04874 (9 ) . This corresponds to an energy shift in the hyperfine splitting (HFS) of Δ EHFS,HVP μ=-8202 (16 ) MHz and represents a factor-of-50 reduction in the theoretical uncertainty from hadronic sources. We also compute the contribution in positronium, which is too small at present to detect.
Application of chiral resonance Lagrangian theories to the muon g-2
Energy Technology Data Exchange (ETDEWEB)
Jegerlehner, Fred [Humboldt-Universitaet, Berlin (Germany). Inst. fuer Physik; Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)
2013-12-15
We think that phenomenological resonance Lagrangian models, constrained by global fits from low energy hadron reaction data, can help to improve muon g-2 predictions. The main issue are those contributions which cannot be calculated by perturbative means: the hadronic vacuum polarization (HVP) effects and the hadronic light-by-light (HLbL) scattering contribution. I review recent progress in the evaluation of the HVP contribution within the broken Hidden Local Symmetry (HLS) framework, worked out in collaboration with M. Benayoun, P. David and L. Del-Buono. Our HLS driven estimate reads a{sub {mu}}{sup LO} {sup had} = (688.60{+-}4.24) . 10{sup -10} and we find a{sub {mu}}{sup the} = (11659177.65{+-}5.76) . 10{sup -10}.
Human Splicing Finder: an online bioinformatics tool to predict splicing signals.
Desmet, François-Olivier; Hamroun, Dalil; Lalande, Marine; Collod-Béroud, Gwenaëlle; Claustres, Mireille; Béroud, Christophe
2009-05-01
Thousands of mutations are identified yearly. Although many directly affect protein expression, an increasing proportion of mutations is now believed to influence mRNA splicing. They mostly affect existing splice sites, but synonymous, non-synonymous or nonsense mutations can also create or disrupt splice sites or auxiliary cis-splicing sequences. To facilitate the analysis of the different mutations, we designed Human Splicing Finder (HSF), a tool to predict the effects of mutations on splicing signals or to identify splicing motifs in any human sequence. It contains all available matrices for auxiliary sequence prediction as well as new ones for binding sites of the 9G8 and Tra2-beta Serine-Arginine proteins and the hnRNP A1 ribonucleoprotein. We also developed new Position Weight Matrices to assess the strength of 5' and 3' splice sites and branch points. We evaluated HSF efficiency using a set of 83 intronic and 35 exonic mutations known to result in splicing defects. We showed that the mutation effect was correctly predicted in almost all cases. HSF could thus represent a valuable resource for research, diagnostic and therapeutic (e.g. therapeutic exon skipping) purposes as well as for global studies, such as the GEN2PHEN European Project or the Human Variome Project.
Caprari, Patrizia; Tarzia, Anna; Mojoli, Giorgio; Cianciulli, Paolo; Mannella, Emilio; Martorana, Maria Cristina
2009-04-01
The implantation of a prosthetic heart valve (HVP) in patients with hereditary spherocytosis (HS) and hereditary elliptocytosis (HE) is rare, and the changes in the structure and deformability of erythrocytes that follow implantation in these patients have been poorly described. In the present study, the erythrocytes in HS and HE patients with mechanical HVP were compared to the erythrocytes in patients with only congenital membrane defects, in terms of biochemical modifications and rheological behaviour. Integral and cytoskeletal erythrocyte membrane proteins were studied, and blood viscosity (shear rate/shear stress ratio), aggregation ratio [eta(1 s(-1))/eta(200 s(-1))], and red cell visco-elasticity were determined. Valve replacement with a mechanical prosthesis worsened anaemia and resulted in a change in haemolysis, from sub-clinical to evident. The rheological investigation of erythrocytes from HS patients confirmed the characteristic increased viscosity and aggregation ratio and the decreased deformability. The rheological behaviour of erythrocytes from patients with HVP showed a decrease in viscosity and an increase in elastic modulus. In these patients, the prosthesis seems to have induced traumatic damage to the erythrocyte membrane, leading to fragmentation and lysis, which in turn modified rheological parameters. The biochemical and rheological investigation allowed us to understand the clinical and haematological pictures of the patients and to describe the role played by different factors in haemolytic anaemia.
Hydrolyzed Vegetable Protein Containing Products Recalls
U.S. Department of Health & Human Services — This list includes products subject to recall in the United States since February 2010 related to hydrolyzed vegetable protein (HVP) paste and powder distributed by...
Bristow, Robert E; Chang, Jenny; Ziogas, Argyrios; Randall, Leslie M; Anton-Culver, Hoda
2014-02-01
To characterize the impact of hospital and physician ovarian cancer case volume on survival for advanced-stage disease and investigate socio-demographic variables associated with access to high-volume providers. Consecutive patients with stage IIIC/IV epithelial ovarian cancer (1/1/96-12/31/06) were identified from the California Cancer Registry. Disease-specific survival analysis was performed using Cox-proportional hazards model. Multivariate logistic regression analyses were used to evaluate for differences in access to high-volume hospitals (HVH) (≥20 cases/year), high-volume physicians (HVP) (≥10 cases/year), and cross-tabulations of high- or low-volume hospital (LVH) and physician (LVP) according to socio-demographic variables. A total of 11,865 patients were identified. The median ovarian cancer-specific survival for all patients was 28.2 months, and on multivariate analysis the HVH/HVP provider combination (HR = 1.00) was associated with superior ovarian cancer-specific survival compared to LVH/LVP (HR = 1.31, 95%CI = 1.16-1.49). Overall, 2119 patients (17.9%) were cared for at HVHs, and 1791 patients (15.1%) were treated by HVPs. Only 4.3% of patients received care from HVH/HVP, while 53.1% of patients were treated by LVH/LVP. Both race and socio-demographic characteristics were independently associated with an increased likelihood of being cared for by the LVH/LVP combination and included: Hispanic race (OR = 1.72, 95%CI = 1.22-2.42), Asian/Pacific Islander race (OR = 1.57, 95%CI = 1.07-2.32), Medicaid insurance (OR = 2.51, 95%CI = 1.46-4.30), and low socioeconomic status (OR = 2.84, 95%CI = 1.90-4.23). Among patients with advanced-stage ovarian cancer, the provider combination of HVH/HVP is an independent predictor of improved disease-specific survival. Access to high-volume ovarian cancer providers is limited, and barriers are more pronounced for patients with low socioeconomic status, Medicaid insurance, and racial minorities. Copyright © 2013
Comparisons in the Recovery Response From Resistance Exercise Between Young and Middle-Aged Men.
Gordon, Joseph A; Hoffman, Jay R; Arroyo, Eliott; Varanoske, Alyssa N; Coker, Nicholas A; Gepner, Yftach; Wells, Adam J; Stout, Jeffrey R; Fukuda, David H
2017-12-01
Gordon, JA III, Hoffman, JR, Arroyo, E, Varanoske, AN, Coker, NA, Gepner, Y, Wells, AJ, Stout, JR, and Fukuda, DH. Comparisons in the recovery response from resistance exercise between young and middle-aged men. J Strength Cond Res 31(12): 3454-3462, 2017-The purpose of this study was to compare the effects of a bout of high-volume isokinetic resistance exercise protocol (HVP) on lower-body strength and markers of inflammation and muscle damage during recovery between young and middle-aged adult men. Nineteen recreationally trained men were classified as either a young adult (YA: 21.8 ± 2.0 years; 90.7 ± 11.6 kg) or a middle-aged adult (MA: 47.0 ± 4.4 years; 96.0 ± 21.5 kg) group. The HVP consisted of 8 sets of 10 repetitions, with 1 minute of rest between each set, performed on an isokinetic dynamometer at 60°·s. Maximal voluntary isometric contractions and isokinetic peak torque (PKT) and average torque (AVGT) (measured at 240° and 60°·s, respectively) were assessed at baseline (BL), immediately post (IP), 120 minutes, 24, and 48 hours after HVP. Blood was obtained at BL, IP, 30, 60, 120 minute, 24, and 48 hours after HVP to assess muscle damage and inflammation. All performance data were analyzed using repeated measures analysis of covariance, whereas all inflammatory and muscle damage markers were analyzed using a 2-way (time × group) repeated measures analysis of variance. Results revealed no between-group differences for PKT, AVGT, or rate of torque development at 200 ms (RTD200). No between-group differences in myoglobin, creatine kinase, C-reactive protein, or interleukin-6 were observed. Although BL differences in muscle performance were observed between YA and MA, no between-group differences were noted in performance recovery measures from high-volume isokinetic exercise in recreationally trained men. These results also indicate that the inflammatory and muscle damage response from high-volume isokinetic exercise is similar between
Wu, Hongchen; Anders, André
2008-08-01
A long-probe technique was utilized to record the expansion and retreat of the dynamic sheath around a spherical substrate immersed in pulsed cathode arc metal plasma. Positively biased, long cylindrical probes were placed on the side and downstream of a negatively pulsed biased stainless steel sphere of 1 in. (25.4 mm) diameter. The amplitude and width of the negative high voltage pulses (HVPs) were 2 kV, 5 kV, 10 kV, and 2 µs, 4 µs, 10 µs, respectively. The variation of the probe (electron) current during the HVP is a direct measure for the sheath expansion and retreat. Maximum sheath sizes were determined for the different parameters of the HVP. The expected rarefaction zone behind the biased sphere (wake) due to the fast plasma flow was clearly established and quantified.
Expanding the phenome and variome of skeletal dysplasia.
Maddirevula, Sateesh; Alsahli, Saud; Alhabeeb, Lamees; Patel, Nisha; Alzahrani, Fatema; Shamseldin, Hanan E; Anazi, Shams; Ewida, Nour; Alsaif, Hessa S; Mohamed, Jawahir Y; Alazami, Anas M; Ibrahim, Niema; Abdulwahab, Firdous; Hashem, Mais; Abouelhoda, Mohamed; Monies, Dorota; Al Tassan, Nada; Alshammari, Muneera; Alsagheir, Afaf; Seidahmed, Mohammed Zain; Sogati, Samira; Aglan, Mona S; Hamad, Muddathir H; Salih, Mustafa A; Hamed, Ahlam A; Alhashmi, Nadia; Nabil, Amira; Alfadli, Fatima; Abdel-Salam, Ghada M H; Alkuraya, Hisham; Peitee, Winnie Ong; Keng, W T; Qasem, Abdullah; Mushiba, Aziza M; Zaki, Maha S; Fassad, Mahmoud R; Alfadhel, Majid; Alexander, Saji; Sabr, Yasser; Temtamy, Samia; Ekbote, Alka V; Ismail, Samira; Hosny, Gamal Ahmed; Otaify, Ghada A; Amr, Khalda; Al Tala, Saeed; Khan, Arif O; Rizk, Tamer; Alaqeel, Aida; Alsiddiky, Abdulmonem; Singh, Ankur; Kapoor, Seema; Alhashem, Amal; Faqeih, Eissa; Shaheen, Ranad; Alkuraya, Fowzan S
2018-04-05
PurposeTo describe our experience with a large cohort (411 patients from 288 families) of various forms of skeletal dysplasia who were molecularly characterized.MethodsDetailed phenotyping and next-generation sequencing (panel and exome).ResultsOur analysis revealed 224 pathogenic/likely pathogenic variants (54 (24%) of which are novel) in 123 genes with established or tentative links to skeletal dysplasia. In addition, we propose 5 genes as candidate disease genes with suggestive biological links (WNT3A, SUCO, RIN1, DIP2C, and PAN2). Phenotypically, we note that our cohort spans 36 established phenotypic categories by the International Skeletal Dysplasia Nosology, as well as 18 novel skeletal dysplasia phenotypes that could not be classified under these categories, e.g., the novel C3orf17-related skeletal dysplasia. We also describe novel phenotypic aspects of well-known disease genes, e.g., PGAP3-related Toriello-Carey syndrome-like phenotype. We note a strong founder effect for many genes in our cohort, which allowed us to calculate a minimum disease burden for the autosomal recessive forms of skeletal dysplasia in our population (7.16E-04), which is much higher than the global average.ConclusionBy expanding the phenotypic, allelic, and locus heterogeneity of skeletal dysplasia in humans, we hope our study will improve the diagnostic rate of patients with these conditions.GENETICS in MEDICINE advance online publication, 5 April 2018; doi:10.1038/gim.2018.50.
A BHLS model based moment analysis of muon g-2, and its use for lattice QCD evaluations of ahadμ
International Nuclear Information System (INIS)
Benayoun, M.; DelBuono, L.
2016-05-01
We present an up-to-date analysis of muon g-2 evaluations in terms of Mellin-Barnes moments as they might be useful for lattice QCD calculations of a μ . The moments up to 4th order are evaluated directly in terms of e + e - -annihilation data and improved within the Hidden Local Symmetry (HLS) Model, supplied with appropriate symmetry breaking mechanisms. The model provides a reliable Effective Lagrangian (BHLS) estimate of the two-body channels plus the πππ channel up to 1.05 GeV, just including the φ resonance. The HLS piece accounts for 80% of the contribution to a μ . The missing pieces are evaluated in the standard way directly in terms of the data. We find that the moment expansion converges well in terms of a few moments. The two types of moments which show up in the Mellin-Barnes representation are calculated in terms of hadronic cross-section data in the timelike region and in terms of the hadronic vacuum polarization (HVP) function in the spacelike region which is accessible to lattice QCD (LQCD). In the Euclidean the first type of moments are the usual Taylor coefficients of the HVP and we show that the second type of moments may be obtained as integrals over the appropriately Taylor truncated HVP function. Specific results for the isovector part of a had μ are determined by means of HLS model predictions in close relation to τ-decay spectra.
International Nuclear Information System (INIS)
Wu Hongchen; Anders, Andre
2008-01-01
A long-probe technique was utilized to record the expansion and retreat of the dynamic sheath around a spherical substrate immersed in pulsed cathode arc metal plasma. Positively biased, long cylindrical probes were placed on the side and downstream of a negatively pulsed biased stainless steel sphere of 1 in. (25.4 mm) diameter. The amplitude and width of the negative high voltage pulses (HVPs) were 2 kV, 5 kV, 10 kV, and 2 μs, 4 μs, 10 μs, respectively. The variation of the probe (electron) current during the HVP is a direct measure for the sheath expansion and retreat. Maximum sheath sizes were determined for the different parameters of the HVP. The expected rarefaction zone behind the biased sphere (wake) due to the fast plasma flow was clearly established and quantified.
Shanmugavadivu, P.; Eliahim Jeevaraj, P. S.
2014-06-01
The Adaptive Iterated Functions Systems (AIFS) Filter presented in this paper has an outstanding potential to attenuate the fixed-value impulse noise in images. This filter has two distinct phases namely noise detection and noise correction which uses Measure of Statistics and Iterated Function Systems (IFS) respectively. The performance of AIFS filter is assessed by three metrics namely, Peak Signal-to-Noise Ratio (PSNR), Mean Structural Similarity Index Matrix (MSSIM) and Human Visual Perception (HVP). The quantitative measures PSNR and MSSIM endorse the merit of this filter in terms of degree of noise suppression and details/edge preservation respectively, in comparison with the high performing filters reported in the recent literature. The qualitative measure HVP confirms the noise suppression ability of the devised filter. This computationally simple noise filter broadly finds application wherein the images are highly degraded by fixed-value impulse noise.
Connected, disconnected and strange quark contributions to HVP
Energy Technology Data Exchange (ETDEWEB)
Bijnens, Johan; Relefors, Johan [Department of Astronomy and Theoretical Physics, Lund University,Sölvegatan 14A, SE 223-62 Lund (Sweden)
2016-11-14
We calculate all neutral vector two-point functions in Chiral Perturbation Theory (ChPT) to two-loop order and use these to estimate the ratio of disconnected to connected contributions as well as contributions involving the strange quark. We extend the ratio of −1/10 derived earlier in two flavour ChPT at one-loop order to a large part of the higher order contributions and discuss corrections to it. Our final estimate of the ratio disconnected to connected is negative and a few % in magnitude.
Connected, disconnected and strange quark contributions to HVP
Bijnens, Johan; Relefors, Johan
2016-11-01
We calculate all neutral vector two-point functions in Chiral Perturbation Theory (ChPT) to two-loop order and use these to estimate the ratio of disconnected to connected contributions as well as contributions involving the strange quark. We extend the ratio of -1/10 derived earlier in two flavour ChPT at one-loop order to a large part of the higher order contributions and discuss corrections to it. Our final estimate of the ratio disconnected to connected is negative and a few % in magnitude.
Connected, disconnected and strange quark contributions to HVP
International Nuclear Information System (INIS)
Bijnens, Johan; Relefors, Johan
2016-01-01
We calculate all neutral vector two-point functions in Chiral Perturbation Theory (ChPT) to two-loop order and use these to estimate the ratio of disconnected to connected contributions as well as contributions involving the strange quark. We extend the ratio of −1/10 derived earlier in two flavour ChPT at one-loop order to a large part of the higher order contributions and discuss corrections to it. Our final estimate of the ratio disconnected to connected is negative and a few % in magnitude.
Towards the physical point hadronic vacuum polarisation from Moebius DWF
Marinkovic, Marina; Del Debbio, Luigi; Juettner, Andreas; Maltman, Kim; Portelli, Antonin
2015-01-01
We present steps towards the computation of the leading-order hadronic contribution to the muon anomalous magnetic moment on RBC/UKQCD physical point DWF ensembles. We discuss several methods for controlling and reducing uncertainties associated to the determination of the HVP form factor.
Wu, Yi-Fang G; Cadwallader, Keith R
2002-05-08
Defatted soybean meal was converted into enzyme-hydrolyzed vegetable protein (E-HVP) using the proteolytic enzyme Flavorzyme. Total free amino acids increased by 40-fold after enzyme hydrolysis, with leucine being the most abundant, followed by phenylalanine, lysine, glutamine/glutamic acid, and alanine. Volatile components from a meatlike process flavoring made from E-HVP were isolated by direct solvent extraction (DSE)-high vacuum transfer (HVT), dynamic headspace sampling and static headspace sampling and analyzed by gas chromatography (GC)-mass spectrometry and GC-olfactometry. Aroma extract dilution analysis was used to establish a flavor dilution chromatogram of the DSE-HVT extract. Results of these complementary techniques indicated the importance of odorants of high (hydrogen sulfide and methanethiol), intermediate (2-methyl-3-furanthiol, 3-mercapto-2-pentanone, 2-furanmethanethiol, and 3-(methylthiol)propanal) and low volatility (maltol and Furaneol) in the overall aroma of the meatlike process flavoring.
Electromagnetic corrections to the hadronic vacuum polarization of the photon within QEDL and QEDM
Bussone, Andrea; Della Morte, Michele; Janowski, Tadeusz
2018-03-01
We compute the leading QED corrections to the hadronic vacuum polarization (HVP) of the photon, relevant for the determination of leptonic anomalous magnetic moments, al. We work in the electroquenched approximation and use dynamical QCD configurations generated by the CLS initiative with two degenerate flavors of nonperturbatively O(a)-improved Wilson fermions. We consider QEDL and QEDM to deal with the finite-volume zero modes. We compare results for the Wilson loops with exact analytical determinations. In addition we make sure that the volumes and photon masses used in QEDM are such that the correct dispersion relation is reproduced by the energy levels extracted from the charged pions two-point functions. Finally we compare results for pion masses and the HVP between QEDL and QEDM. For the vacuum polarization, corrections with respect to the pure QCD case, at fixed pion masses, turn out to be at the percent level.
Effects on in vitro and in vivo angiogenesis induced by small peptides carrying adhesion sequences.
Conconi, Maria Teresa; Ghezzo, Francesca; Dettin, Monica; Urbani, Luca; Grandi, Claudio; Guidolin, Diego; Nico, Beatrice; Di Bello, Carlo; Ribatti, Domenico; Parnigotto, Pier Paolo
2010-07-01
It is well known that tumor growth is strictly dependent on neo-vessel formation inside the tumor mass and that cell adhesion is required to allow EC proliferation and migration inside the tumor. In this work, we have evaluated the in vitro and in vivo effects on angiogenesis of some peptides, originally designed to promote cell adhesion on biomaterials, containing RGD motif mediating cell adhesion via integrin receptors [RGD, GRGDSPK, and (GRGDSP)(4)K] or the heparin-binding sequence of human vitronectin that interacts with HSPGs [HVP(351-359)]. Cell adhesion, proliferation, migration, and capillary-like tube formation in Matrigel were determined on HUVECs, whereas the effects on in vivo angiogenesis were evaluated using the CAM assay. (GRGDSP)(4)K linear sequence inhibited cell adhesion, decreased cell proliferation, migration and morphogenesis in Matrigel, and induced anti-angiogenic responses on CAM at higher degree than that determined after incubation with RGD or GRGDSPK. Moreover, it counteracted both in vitro and in vivo the pro-angiogenic effects induced by the Fibroblast growth factor (FGF-2). On the other hand, HVP was not able to affect cell adhesion and appeared less effective than (GRGDSP)(4)K. Our data indicate that the activity of RGD-containing peptides is related to their adhesive properties, and their effects are modulated by the number of cell adhesion motifs and the aminoacidic residues next to these sequences. The anti-angiogenic properties of (GRGDSP)(4)K seem to depend on its interaction with integrins, whereas the effects of HVP may be partially due to an impairment of HSPGs/FGF-2.
Occurrence of chloropropanols in soy sauce and other foods in China between 2002 and 2004.
Fu, Wu Sheng; Zhao, Yunfeng; Zhang, Gong; Zhang, Lei; Li, Jing Guang; Tang, Chang Dong; Miao, Hong; Ma, Jin Bo; Zhang, Qi; Wu, Yong Ning
2007-08-01
A survey of chloropropanols in soy sauce and some selected foods in China is reported. Thirty-seven traditionally brewed soy sauce samples contained 3-MCPD below the EC maximum limit (ML) of 0.02 mg kg(-1). All soy sauce samples (629) from retailers contained levels of 3-MCPD ranging between HVP). This indicates that the necessary processing changes have been made to decrease levels of chloropropanols in soy sauce. 2-Monochloropropane-1,3-diol (2-MCPD), 1,3-dichloro-2-propanol (1,3-DCP) and 2,3-dichloro-1-propanol (2,3-DCP) were detected in 48.1 19.1 and 3.78% of the soy sauce samples, respectively; the highest levels being 20.3, 8.26 and 0.50 mg kg(-1), respectively. A good linear correlation was found between the amount of 3-MCPD and 2-MCPD, with the level of 3-MCPD being generally higher than that of other chloropropanols for the same soy sauce. Acid HVP contained 3-MCPD at a level of 0.010-117.7 mg kg(-1) (on a liquid basis) and 80% of samples contained levels exceeding 1.0 mg kg(-1). In some other foods investigated, relatively high levels of 3-MCPD were found in soy sauce powder, oyster sauce, beef products, instant noodle spices and health foods, ranging from 0.029 to 13.64 mg kg(-1). It is concluded that abnormal levels of 3-MCPD in soy sauce or other foods produced in China may result from acid hydrolysis or the addition of the contaminated acid HVP.
Energy Technology Data Exchange (ETDEWEB)
Benayoun, M.; DelBuono, L. [Paris VI et Paris VII Univs. (France). LPNHE; David, P. [Paris VI et Paris VII Univs. (France). LPNHE; Paris-Diderot Univ. (France). LIED; Jegerlehner, F. [Humboldt-Universitaet, Berlin (Germany). Inst. fuer Physik; Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)
2016-05-15
We present an up-to-date analysis of muon g-2 evaluations in terms of Mellin-Barnes moments as they might be useful for lattice QCD calculations of a{sub μ}. The moments up to 4th order are evaluated directly in terms of e{sup +}e{sup -}-annihilation data and improved within the Hidden Local Symmetry (HLS) Model, supplied with appropriate symmetry breaking mechanisms. The model provides a reliable Effective Lagrangian (BHLS) estimate of the two-body channels plus the πππ channel up to 1.05 GeV, just including the φ resonance. The HLS piece accounts for 80% of the contribution to a{sub μ}. The missing pieces are evaluated in the standard way directly in terms of the data. We find that the moment expansion converges well in terms of a few moments. The two types of moments which show up in the Mellin-Barnes representation are calculated in terms of hadronic cross-section data in the timelike region and in terms of the hadronic vacuum polarization (HVP) function in the spacelike region which is accessible to lattice QCD (LQCD). In the Euclidean the first type of moments are the usual Taylor coefficients of the HVP and we show that the second type of moments may be obtained as integrals over the appropriately Taylor truncated HVP function. Specific results for the isovector part of a{sup had}{sub μ} are determined by means of HLS model predictions in close relation to τ-decay spectra.
of the photon within QEDL and QEDM
Directory of Open Access Journals (Sweden)
Bussone Andrea
2018-01-01
Full Text Available We compute the leading QED corrections to the hadronic vacuum polarization (HVP of the photon, relevant for the determination of leptonic anomalous magnetic moments, al. We work in the electroquenched approximation and use dynamical QCD configurations generated by the CLS initiative with two degenerate flavors of nonperturbatively O(a-improved Wilson fermions. We consider QEDL and QEDM to deal with the finite-volume zero modes. We compare results for the Wilson loops with exact analytical determinations. In addition we make sure that the volumes and photon masses used in QEDM are such that the correct dispersion relation is reproduced by the energy levels extracted from the charged pions two-point functions. Finally we compare results for pion masses and the HVP between QEDL and QEDM. For the vacuum polarization, corrections with respect to the pure QCD case, at fixed pion masses, turn out to be at the percent level.
Educational Evaluation and the Hartman Value Profile.
Byrum, Stephen C.
1979-01-01
A tool consisting of 2 sets of 18 statements and requiring 20 minutes for administration, the Hartman Value Profile evaluates progress and maturity in areas not readily adaptable to more objective means of evaluation. Firsthand experiences with the HVP have indicated successful evaluations of postsecondary student thinking. (JC)
U.S. EPA, Pesticide Product Label, AGWAY BETASAN 12.5G, 11/29/1979
2011-04-21
... i"'n"'rtl'll' ',',l,-jIf)I,,'; N;If""""' 1"'"11'" Mflll1,f'''''V t:vl't."." M,II'If'''''V Pm,. M~,'I,. f'nvt" f'hvp,.n'·jll" It,. !"I;ml r" raf"l'v"""d,;l rlnd ;'WI,,.t I'. 1 W."lllrlfl, .... 71111111' ...
Project report - an overview of the project and experiences with project management
DEFF Research Database (Denmark)
Jørgensen, Michael Søgaard; Mikkelsen, Bent Egberg
1996-01-01
A collection of the project planning and the experiences with project management from the Catering 2000 project.As appendieces articles etc. from journals, newspapers etc. about the project.......A collection of the project planning and the experiences with project management from the Catering 2000 project.As appendieces articles etc. from journals, newspapers etc. about the project....
Mahmood, Farida; Chiles, Robert E; Fang, Ying; Green, Emily N; Reisen, William K
2006-06-01
The vector competence of Culex tarsalis Coquillett for the BFS 1703 strain of western equine encephalomyelitis virus (WEEV) changed significantly as a function of time after infection, mosquito genotype, and infectious virus dose. After ingesting a high virus dose (5 log10 plaque-forming units [PFU]/0.1 ml), female of the susceptible high virus producer (HVP) strain rapidly amplified the virus, developed a disseminated infection, and efficiently transmitted WEEV by 4 days postinfection (dpi). The quantity of virus expectorated peaked at 4 dpi (mean 3.4 log10 PFU), and the percentage of females transmitting per os peaked at 7 dpi (80%); both measures of transmission subsequently decreased to low levels throughout the remainder of infected life. HVP females imbibing a low virus dose (3 log10 PFU/0.1 ml) were infected less frequently and took longer to amplify virus to levels recorded for the high virus dose group and did not transmit virus efficiently, thereby indicating midgut infection and escape barriers were dose and time dependent. These data emphasized the importance of elevated avian viremias in Cx. tarsalis vector competence. Females from the WEEV-resistant (WR) strain and two wild-type strains from Kern and Riverside counties were significantly less susceptible to infection at both high and low doses than was the HVP strain. Overall, females with a high virus titer more frequently had a disseminated infection, but there did not seem to be a distinct threshold demarcating this relationship. In marked contrast, all infected females transmitting virus had body titers >4.3 log10 PFU, and most had titers >4.8 log10 PFU. These data indicated that not all females with a disseminated infection transmitted virus because of the presence of one or more salivary gland barriers.
Wisén, E; Svennerholm, K; Bown, L S; Houltz, E; Rizell, M; Lundin, S; Ricksten, S-E
2018-03-26
Various methods are used to reduce venous blood pressure in the hepato-splanchnic circulation, and hence minimise blood loss during liver surgery. Previous studies show that combination of vasopressin and nitroglycerin reduces portal pressure and flow in patients with portal hypertension, and in this study we investigated this combination in patients with normal portal pressure. In all, 13 patients were studied. Measurements were made twice to confirm baseline (C1 and BL), during vasopressin infusion 4.8 U/h (V), and during vasopressin infusion combined with nitroglycerin infusion (V + N). Portal venous pressure (PVP), hepatic venous pressure (HVP), central haemodynamics and arterial and venous blood gases were obtained at each measuring point, and portal (splanchnic) and hepato-splanchnic blood flow changes were calculated. Vasopressin alone did not affect PVP, whereas HVP increased slightly. In combination with nitroglycerin, PVP decreased from 10.1 ± 1.6 to 8.9 ± 1.3 mmHg (P HVP decreased from 7.9 ± 1.9 to 6.2 ± 1.3 mmHg (P = 0.001). Vasopressin reduced portal blood flow by 47 ± 19% and hepatic venous flow by 11 ± 18%, respectively. Addition of nitroglycerin further reduced portal- and hepatic flow by 55 ± 13% and 30 ± 13%, respectively. Vasopressin alone had minor effects on central haemodynamics, whereas addition of nitroglycerin reduced cardiac index (3.2 ± 0.7 to 2.7 ± 0.5; P < 0.0001). The arterial-portal vein lactate gradient was unaffected. The combination of vasopressin and nitroglycerin decreases portal pressure and hepato-splanchnic blood flow, and could be a potential treatment to reduce bleeding in liver resection surgery. © 2018 The Acta Anaesthesiologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.
Dalbiès-Tran, Rozenn; Stigger-Rosser, Evelyn; Dotson, Travis; Sample, Clare E.
2001-01-01
Epstein-Barr virus (EBV) nuclear antigen 3A (EBNA-3A) is essential for virus-mediated immortalization of B lymphocytes in vitro and is believed to regulate transcription of cellular and/or viral genes. One known mechanism of regulation is through its interaction with the cellular transcription factor Jκ. This interaction downregulates transcription mediated by EBNA-2 and Jκ. To identify the amino acids that play a role in this interaction, we have generated mutant EBNA-3A proteins. A mutant EBNA-3A protein in which alanine residues were substituted for amino acids 199, 200, and 202 no longer downregulated transcription. Surprisingly, this mutant protein remained able to coimmunoprecipitate with Jκ. Using a reporter gene assay based on the recruitment of Jκ by various regions spanning EBNA-3A, we have shown that this mutation abolished binding of Jκ to the N-proximal region (amino acids 125 to 222) and that no other region of EBNA-3A alone was sufficient to mediate an association with Jκ. To determine the biological significance of the interaction of EBNA-3A with Jκ, we have studied its conservation in the simian lymphocryptovirus herpesvirus papio (HVP) by cloning HVP-3A, the homolog of EBNA-3A encoded by this virus. This 903-amino-acid protein exhibited 37% identity with its EBV counterpart, mainly within the amino-terminal half. HVP-3A also interacted with Jκ through a region located between amino acids 127 and 223 and also repressed transcription mediated through EBNA-2 and Jκ. The evolutionary conservation of this function, in proteins that have otherwise significantly diverged, argues strongly for an important biological role in virus-mediated immortalization of B lymphocytes. PMID:11119577
High tidal volume ventilation in infant mice.
Cannizzaro, Vincenzo; Zosky, Graeme R; Hantos, Zoltán; Turner, Debra J; Sly, Peter D
2008-06-30
Infant mice were ventilated with either high tidal volume (V(T)) with zero end-expiratory pressure (HVZ), high V(T) with positive end-expiratory pressure (PEEP) (HVP), or low V(T) with PEEP. Thoracic gas volume (TGV) was determined plethysmographically and low-frequency forced oscillations were used to measure the input impedance of the respiratory system. Inflammatory cells, total protein, and cytokines in bronchoalveolar lavage fluid (BALF) and interleukin-6 (IL-6) in serum were measured as markers of pulmonary and systemic inflammatory response, respectively. Coefficients of tissue damping and tissue elastance increased in all ventilated mice, with the largest rise seen in the HVZ group where TGV rapidly decreased. BALF protein levels increased in the HVP group, whereas serum IL-6 rose in the HVZ group. PEEP keeps the lungs open, but provides high volumes to the entire lungs and induces lung injury. Compared to studies in adult and non-neonatal rodents, infant mice demonstrate a different response to similar ventilation strategies underscoring the need for age-specific animal models.
Directory of Open Access Journals (Sweden)
H. T. R. Kurmasha
2017-12-01
Full Text Available An Edge-based image quality measure (IQM technique for the assessment of histogram equalization (HE-based contrast enhancement techniques has been proposed that outperforms the Absolute Mean Brightness Error (AMBE and Entropy which are the most commonly used IQMs to evaluate Histogram Equalization based techniques, and also the two prominent fidelity-based IQMs which are Multi-Scale Structural Similarity (MSSIM and Information Fidelity Criterion-based (IFC measures. The statistical evaluation results show that the Edge-based IQM, which was designed for detecting noise artifacts distortion, has a Person Correlation Coefficient (PCC > 0.86 while the others have poor or fair correlation to human opinion, considering the Human Visual Perception (HVP. Based on HVP, this paper propose an enhancement to classic Edge-based IQM by taking into account the brightness saturation distortion which is the most prominent distortion in HE-based contrast enhancement techniques. It is tested and found to have significantly well correlation (PCC > 0.87, Spearman rank order correlation coefficient (SROCC > 0.92, Root Mean Squared Error (RMSE < 0.1054, and Outlier Ratio (OR = 0%.
Development of embedded real-time and high-speed vision platform
Ouyang, Zhenxing; Dong, Yimin; Yang, Hua
2015-12-01
Currently, high-speed vision platforms are widely used in many applications, such as robotics and automation industry. However, a personal computer (PC) whose over-large size is not suitable and applicable in compact systems is an indispensable component for human-computer interaction in traditional high-speed vision platforms. Therefore, this paper develops an embedded real-time and high-speed vision platform, ER-HVP Vision which is able to work completely out of PC. In this new platform, an embedded CPU-based board is designed as substitution for PC and a DSP and FPGA board is developed for implementing image parallel algorithms in FPGA and image sequential algorithms in DSP. Hence, the capability of ER-HVP Vision with size of 320mm x 250mm x 87mm can be presented in more compact condition. Experimental results are also given to indicate that the real-time detection and counting of the moving target at a frame rate of 200 fps at 512 x 512 pixels under the operation of this newly developed vision platform are feasible.
One project`s waste is another project`s resource
Energy Technology Data Exchange (ETDEWEB)
Short, J.
1997-02-01
The author describes the efforts being made toward pollution prevention within the DOE complex, as a way to reduce overall project costs, in addition to decreasing the amount of waste to be handled. Pollution prevention is a concept which is trying to be ingrained into project planning. Part of the program involves the concept that ultimately the responsibility for waste comes back to the generator. Parts of the program involve efforts to reuse materials and equipment on new projects, to recycle wastes to generate offsetting revenue, and to increase awareness, accountability and incentives so as to stimulate action on this plan. Summaries of examples are presented in tables.
Project Success in IT Project Management
Siddiqui, Farhan Ahmed
2010-01-01
The rate of failed and challenged Information Technology (IT) projects is too high according to the CHAOS Studies by the Standish Group and the literature on project management (Standish Group, 2008). The CHAOS Studies define project success as meeting the triple constraints of scope, time, and cost. The criteria for project success need to be agreed by all parties before the start of the project and constantly reviewed as the project progresses. Assessing critical success factors is another ...
Vague project start makes project success of outsourced software development projects uncertain
Savolainen, Paula
2010-01-01
peer-reviewed A definition of a project success includes at least three criteria: 1) meeting planning goals, 2) customer benefits, and 3) supplier benefits. This study aims to point out the importance of the definition of the project start, the project start date, and what work should be included in the project effort in order to ensure the supplier's benefits. The ambiguity of the project start risks the profitability of the project and therefore makes project success at least from suppli...
Project management: a case of fixed price IS/IT projects. Analysis of projects by project scopes
Directory of Open Access Journals (Sweden)
Miroslav Kral
2012-10-01
Full Text Available The paper provides an overview of major issues of IS / IT projects. Attention will be focused on projects that are implemented under a contract for a specified amount of work and fixed price. The main purpose of the paper is to analyse the project parameters in terms of the types of projects, and to confirm, or refuse, a hypothesis related to this. There is some evidence from the portfolio of projects that have been implemented by the international companies providing IT services. Regarding the localisation, CEE region was selected for our research. The outputs of the paper should be a contribution to managing IS/IT projects in IT service delivery organizations and for the support of innovative thinking about project management generally.
Bosch-Rekveldt, M.G.C.
2011-01-01
Engineering projects become increasingly more complex and project complexity is assumed to be one of the causes for projects being delivered late and over budget. However, what this project complexity actually comprised of was unclear. To improve the overall project performance, this study focuses
Spent Nuclear Fuel project, project management plan
International Nuclear Information System (INIS)
Fuquay, B.J.
1995-01-01
The Hanford Spent Nuclear Fuel Project has been established to safely store spent nuclear fuel at the Hanford Site. This Project Management Plan sets forth the management basis for the Spent Nuclear Fuel Project. The plan applies to all fabrication and construction projects, operation of the Spent Nuclear Fuel Project facilities, and necessary engineering and management functions within the scope of the project
Managing projects using a project management approach
Directory of Open Access Journals (Sweden)
Marko D. Andrejić
2011-04-01
Full Text Available Modern management theory treats all complex tasks and duties like projects and make these projects possible to be managed by a particular organizational-management concept in order to achieve a goal effectively. A large number of jobs and tasks performed in the system of defense or for defense purposes have the characteristics of projects. Project management is both a skill and a science of monitoring human, material, financial, energy and other resources to achieve required objectives within the given limits: deadlines, time, budget, possibility of realization and the satisfaction of the interests of all project participants. Project management is a traditional area of applied (or functional management focused on managing complex and uncertain situations with defined goals. Introduction In conditions of rapid change and high uncertainty, only adaptive organizations survive, i. e. those that are able not only to react quickly to changes but also to proactively take advantage of changes. Development of project management The biggest influence on the development of the area had complex jobs within the engineering profession. In parallel with the traditional approach new approaches began to develop, while the traditional one still remained in use. Contrary to the traditional engineering approach, a dynamic model first developed in order to respond to demands for greater control of costs. Project management Project management is a skill and knowledge of human and material resources to achieve set objectives within prescribed limits: deadlines, time, budget, possibility of realization, and the satisfaction of all participants in the project. In order to realize a project effectively, it is necessary to manage it rationally. Planning and project management A project plan is a document that allows all team members insight on where to go, when to start and when to arrive, what is necessary to be done in order to achieve the project objectives and what
Beukers, Margot W
2011-02-01
Thirty-four project managers of life-science research projects were interviewed to investigate the characteristics of their projects, the challenges they faced and their training requirements. A set of ten discriminating parameters were identified based on four project categories: contract research, development, discovery and call-based projects--projects set up to address research questions defined in a call for proposals. The major challenges these project managers are faced with relate to project members, leadership without authority and a lack of commitment from the respective organization. Two-thirds of the project managers indicated that they would be interested in receiving additional training, mostly on people-oriented, soft skills. The training programs that are currently on offer, however, do not meet their needs. Copyright © 2010 Elsevier Ltd. All rights reserved.
Impact of Project Leadership Facets on Project Outcome
Directory of Open Access Journals (Sweden)
Arslan Ayub
2015-08-01
Full Text Available The study analyzes the role of project leadership facets on effective project outcome. Numerous such initiatives have already been taken on project outcome/performance in the context of apposite leadership styles or project management. However, the current study is unique in the milieu of project outcome that it introduces a new leadership approach, which throws light on the significance of variant leadership facets on project outcome. The study uses explanatory approach; primary data is collected from project management professionals working in different project organizations. The study uses structural equation model (SEM technique to test the hypothesis. The study found a positive relationship between project leadership facets and project outcome.
Modeling a color-rendering operator for high dynamic range images using a cone-response function
Choi, Ho-Hyoung; Kim, Gi-Seok; Yun, Byoung-Ju
2015-09-01
Tone-mapping operators are the typical algorithms designed to produce visibility and the overall impression of brightness, contrast, and color of high dynamic range (HDR) images on low dynamic range (LDR) display devices. Although several new tone-mapping operators have been proposed in recent years, the results of these operators have not matched those of the psychophysical experiments based on the human visual system. A color-rendering model that is a combination of tone-mapping and cone-response functions using an XYZ tristimulus color space is presented. In the proposed method, the tone-mapping operator produces visibility and the overall impression of brightness, contrast, and color in HDR images when mapped onto relatively LDR devices. The tone-mapping resultant image is obtained using chromatic and achromatic colors to avoid well-known color distortions shown in the conventional methods. The resulting image is then processed with a cone-response function wherein emphasis is placed on human visual perception (HVP). The proposed method covers the mismatch between the actual scene and the rendered image based on HVP. The experimental results show that the proposed method yields an improved color-rendering performance compared to conventional methods.
Directory of Open Access Journals (Sweden)
M. Arpah
2000-04-01
Full Text Available The aim of this research was to study the variation of shelf-life values, obtained in quantifying shelf-life of biscuits among models of accelerated storage studies (ASS from unidirectional Fick’S law. Shelf-life of biscuits is defined as the length of time of a packaged biscuits can be stored before the onset quality change appears.Four models: Heiss-Eichner (1971, Labuza (1983, Rudolph (1986 and Half Value Period or HVP model (Syarief, 1986 were evaluated. These models shared a common basic principle that they were all derived and developed from unidirectional Fick’s law. Therefore, each parameter of individual model can be compared to the athers. A semi empirical approach using reaction kinetics through Arrhenius plot was used as a real shelf-life values.Quantification resulted in two categories of shelf-life values, First those which higher than expected value and second, were lower than expected. Parameter evaluation of components of Heiss-Eichner and Labuza models clearly shown less in number than components of Rudolph and HVP models. This led to a conclusion that the more sophisticated models gave higher shelf-life values as compared to the Arhenius model.
Project management in practice : Evaluating a case project through project management theories
Uusitalo, Jenni
2013-01-01
The purpose of this thesis was to evaluate a case project and to study whether it was carried out in a correct manner; meaning that did the case project follow the project management models. In addition, part of the study was to determine what could have been improved in the management of the case project. The case project was about creating and launching a communication channel based on a social media service, on a blog platform called Tumblr, for Team Finland in Spain network. The network p...
|Vus| determination from inclusive strange tau decay and lattice HVP
Directory of Open Access Journals (Sweden)
Boyle Peter
2018-01-01
Full Text Available We propose and apply a novel approach to determining |Vus| which uses inclusive strange hadronic tau decay data and hadronic vacuum polarization functions (HVPs computed on the lattice. The experimental and lattice data are related through dispersion relations which employ a class of weight functions having poles at space-like momentum. Implementing this approach using lattice data generated by the RBC/UKQCD collaboration, we show examples of weight functions which strongly suppress spectral integral contributions from the region where experimental data either have large uncertainties or do not exist while at the same time allowing accurate determinations of relevant lattice HVPs. Our result for |Vus| is in good agreement with determinations from K physics and 3-family CKM unitarity. The advantages of the new approach over the conventional sum rule analysis will be discussed.
Isospin Breaking Corrections to the HVP with Domain Wall Fermions
Boyle, Peter; Guelpers, Vera; Harrison, James; Juettner, Andreas; Lehner, Christoph; Portelli, Antonin; Sachrajda, Christopher
2018-03-01
We present results for the QED and strong isospin breaking corrections to the hadronic vacuum polarization using Nf = 2 + 1 Domain Wall fermions. QED is included in an electro-quenched setup using two different methods, a stochastic and a perturbative approach. Results and statistical errors from both methods are directly compared with each other.
|Vus| determination from inclusive strange tau decay and lattice HVP
Boyle, Peter; Hudspith, Renwick James; Izubuchi, Taku; Jüttner, Andreas; Lehner, Christoph; Lewis, Randy; Maltman, Kim; Ohki, Hiroshi; Portelli, Antonin; Spraggs, Matthew
2018-03-01
We propose and apply a novel approach to determining |Vus| which uses inclusive strange hadronic tau decay data and hadronic vacuum polarization functions (HVPs) computed on the lattice. The experimental and lattice data are related through dispersion relations which employ a class of weight functions having poles at space-like momentum. Implementing this approach using lattice data generated by the RBC/UKQCD collaboration, we show examples of weight functions which strongly suppress spectral integral contributions from the region where experimental data either have large uncertainties or do not exist while at the same time allowing accurate determinations of relevant lattice HVPs. Our result for |Vus| is in good agreement with determinations from K physics and 3-family CKM unitarity. The advantages of the new approach over the conventional sum rule analysis will be discussed.
From project management to project leadership
Braun, F.; Avital, M.
2010-01-01
It is virtually a truism that good leadership practices can help project managers with attaining the desired project outcome. However, a better understanding of which leadership practices enable project managers to be more effective warrants further investigation. Subsequently, in this study, we
Ace Project as a Project Management Tool
Cline, Melinda; Guynes, Carl S.; Simard, Karine
2010-01-01
The primary challenge of project management is to achieve the project goals and objectives while adhering to project constraints--usually scope, quality, time and budget. The secondary challenge is to optimize the allocation and integration of resources necessary to meet pre-defined objectives. Project management software provides an active…
International Nuclear Information System (INIS)
Feng Cunfang; Guan Wei; Wang Yinghai
2013-01-01
We investigate different types of projective (projective-anticipating, projective and projective-lag) synchronization in unidirectionally nonlinearly coupled time-delayed chaotic systems with variable time delays. Based on the Krasovskii–Lyapunov approach, we find both the existence and sufficient stability conditions, using a general class of time-delayed chaotic systems related to optical bistable or hybrid optical bistable devices. Our method has the advantage that it requires only one nonlinearly coupled term to achieve different types of projective synchronization in time-delayed chaotic systems with variable time delays. Compared with other existing works, our result provides an easy way to achieve projective-anticipating, projective and projective-lag synchronization. Numerical simulations of the Ikeda system are given to demonstrate the validity of the proposed method. (paper)
Oviedo, Marco V Neira; Romoser, William S; James, Calvin Bl; Mahmood, Farida; Reisen, William K
2011-04-18
BACKGROUND: Vector competence describes the efficiency with which vector arthropods become infected with and transmit pathogens and depends on interactions between pathogen and arthropod genetics as well as environmental factors. For arbovirus transmission, the female mosquito ingests viremic blood, the virus infects and replicates in midgut cells, escapes from the midgut, and disseminates to other tissues, including the salivary glands. Virus-laden saliva is then injected into a new host. For transmission to occur, the virus must overcome several "barriers", including barriers to midgut infection and/or escape and salivary infection and/or escape. By examining the spatial/temporal infection dynamics of Culex tarsalis strains infected with western equine encephalomyelitis virus (WEEV), we identified tissue tropisms and potential tissue barriers, and evaluated the effects of viral dose and time postingestion. METHODS: Using immunostained paraffin sections, WEEV antigens were tracked in four Cx. tarsalis strains: two recently colonized California field strains - Coachella Valley, Riverside County (COAV) and Kern National Wildlife Refuge (KNWR); and two laboratory strains selected for WEEV susceptibility (high viremia producer, HVP), and WEEV resistance (WR). RESULTS AND CONCLUSIONS: Tissues susceptible to WEEV infection included midgut epithelium, neural ganglia, trachea, chorionated eggs, and salivary glands. Neuroendocrine cells in the retrocerebral complex were occasionally infected, indicating the potential for behavioral effects. The HVP and COAV strains vigorously supported viral growth, whereas the WR and KNWR strains were less competent. Consistent with earlier studies, WEEV resistance appeared to be related to a dose-dependent midgut infection barrier, and a midgut escape barrier. The midgut escape barrier was not dependent upon the ingested viral dose. Consistent with midgut infection modulation, disseminated infections were less common in the WR and KNWR
Project Success in Agile Development Software Projects
Farlik, John T.
2016-01-01
Project success has multiple definitions in the scholarly literature. Research has shown that some scholars and practitioners define project success as the completion of a project within schedule and within budget. Others consider a successful project as one in which the customer is satisfied with the product. This quantitative study was conducted…
An IS Project Management Course Project
Frank, Ronald L.
2010-01-01
Information Systems curricula should provide project management (PM) theory, current practice, and hands-on experience. The schedule usually does not allow time in Analysis and Design courses for development oriented project management instruction other than a short introduction. Similarly, networking courses usually don't put project management…
Evaluation of Project Achievements in VOMARE -project
Kokkarinen, Eeva
2011-01-01
The purpose of the thesis is to study the achievements of VOMARE –project from the Finnish Lifeboat Institutions perspective. The organisation is a roof organisation for voluntary maritime rescue operation in Finland. The Finnish Lifeboat Institution is a lead partner in VOMARE –project which is EU funded project and the aim of the project is to start voluntary rescue operations in Estonia. The theoretical part of the work is divided into two main categories; project management and planni...
Leading global projects for professional and accidental project leaders
Moran, Robert T
2008-01-01
This book is a must-read for anyone responsible for projects and initiatives that span functional and geographical divides. Authors Moran and Youngdahl bring extensive experience and learning from industry practice to present a clear and straightforward treatment of the leadership skills and knowledge required to lead projects that are global in nature. They have written the first book of its kind to address the three essential skills of global project leaders - strategic project management, project leadership, and cross-cultural leadership. The authors argue that global project leadership is an essential skill in our project-based world and that we are all either intentional or accidental project leaders. Intentional project leaders pursue formal project management education and even certification whereas accidental project leaders find themselves leading global projects and initiatives as a result of a special assignment or promotion. Moran and Youndahl have found that the vast majority of global projects ...
Prioritising Project Scope Definition Elements in Public Building Projects
Directory of Open Access Journals (Sweden)
Mohammed K Fageha
2014-09-01
Full Text Available A complete definition of the scope of a project upfront during early stages ensures smooth and successful implementation during the project execution. This research identifies and prioritises project scope definition elements for public buildings in Saudi Arabia. Elements that could significantly contribute to complete project scope definition package at pre-project planning stage are identified and their interrelationship determined and prioritised. Using the Project Definition Rating Index (PDRI as a basis, the study uses analytical network process (ANP technique based on data obtained from project managers who have been involved in public sector projects in Saudi Arabia. Data collection and analysis was conducted in three steps. The first step involved identification of scope definition elements while the second involved an investigation into interrelationships among the elements. In the third step, ANP was used to determine the weight of the elements’ importance in terms of contribution to project scope definition completeness. Finally, Pareto analysis was used to prioritise and assess the distribution pattern of the elements. The outcome from this research is the prioritisation of project scope definition elements for public building projects in Saudi Arabia. The prioritised list developed indicates the importance of project scope definition elements. It should help project management teams identify elements to consider when evaluating project scope definition for completeness at the pre-project planning stage. Keywords: Project scope definition, pre-project planning, prioritising, public building projects, Saudi Arabia, Analytical Network Process (ANP
The application of project management in construction projects ...
African Journals Online (AJOL)
Project management is critical for successful project development. A crucial responsibility of the project manager is ensuring that the client is certified and the scope of work is of high quality, within the agreed budget and time frame. In some way, project financing is completed from the time of project conception. Indeed ...
Perspectives on projects, project success and team work
Thompson, Karen
2015-01-01
This paper brings together perspectives on projects, project success and team work as a background to two graphical tools for considering project success and individual capabilities for working in a project team.
Project Management Yinyang: Coupling project success and client satisfaction
Directory of Open Access Journals (Sweden)
Greg Stewart Usher
2017-06-01
Full Text Available Our research applies paradox theory to a project management construct to help project management researchers and practitioners understand the tensions that can exist between project success and client satisfaction. Our research highlights that although project success and client satisfaction are both present within a project management construct, they also belong to different functional systems. Project success and client satisfaction have different systemic-discourses and use different language games to convey information. These distinctions can create latent and sometimes salient tensions within the project management construct that project managers must understand, embrace, and work with. We have used a Grounded Theory (GT methodology to explore the lived experience of project managers, and from this have identified a phenomenon which we have termed project management yinyang. Project management yinyang is the state that exists when both project success and Client satisfaction are tightly coupled within the project management construct. Project management yinyang highlights that these two phenomena cannot be viewed as separate elements because the ‘seed’ of each exists within the other. And to truly achieve one, you must also achieve the other. Our findings indicate that in order to create project management yinyang the project manager must embrace a paradoxical yet holistic philosophy. They must understand the complementarity, interdependency, and structural coupling that exists between the positivist and interpretivist paradigms within the project management construct. They must understand how satisfaction (Yin and success (Yang are created through focus. Furthermore, they must understand how project management yinyang is separate from, but borne from, the convergence of the other two elements.
Quality Assurance Project Plan for Citizen Science Projects
The Quality Assurance Project Plan is necessary for every project that collects or uses environmental data. It documents the project planning process and serves as a blueprint for how your project will run.
DEFF Research Database (Denmark)
Pilkington, Alan; Chai, Kah-Hin; Le, Yang
2015-01-01
This paper identifies the true coverage of PM theory through a bibliometric analysis of the International Journal of Project Management from 1996-2012. We identify six persistent research themes: project time management, project risk management, programme management, large-scale project management......, project success/failure and practitioner development. These differ from those presented in review and editorial articles in the literature. In addition, topics missing from the PM BOK: knowledge management project-based organization and project portfolio management have become more popular topics...
International Nuclear Information System (INIS)
Cowan, A.
1998-01-01
Project financing was defined ('where a lender to a specific project has recourse only to the cash flow and assets of that project for repayment and security respectively') and its attributes were described. Project financing was said to be particularly well suited to power, pipeline, mining, telecommunications, petro-chemicals, road construction, and oil and gas projects, i.e. large infrastructure projects that are difficult to fund on-balance sheet, where the risk profile of a project does not fit the corporation's risk appetite, or where higher leverage is required. Sources of project financing were identified. The need to analyze and mitigate risks, and being aware that lenders always take a conservative view and gravitate towards the lowest common denominator, were considered the key to success in obtaining project financing funds. TransAlta Corporation's project financing experiences were used to illustrate the potential of this source of financing
National Research Council Canada - National Science Library
Patton, Nanette; Shechet, Allan
2007-01-01
.... This article discusses conventional roles and responsibilities of the project sponsor and then discusses strategies a project manager can employ to define boundaries to reduce role confusion and promote partnership to facilitate project success.
The CHPRC Columbia River Protection Project Quality Assurance Project Plan
International Nuclear Information System (INIS)
Fix, N.J.
2008-01-01
Pacific Northwest National Laboratory researchers are working on the CHPRC Columbia River Protection Project (hereafter referred to as the Columbia River Project). This is a follow-on project, funded by CH2M Hill Plateau Remediation Company, LLC (CHPRC), to the Fluor Hanford, Inc. Columbia River Protection Project. The work scope consists of a number of CHPRC funded, related projects that are managed under a master project (project number 55109). All contract releases associated with the Fluor Hanford Columbia River Project (Fluor Hanford, Inc. Contract 27647) and the CHPRC Columbia River Project (Contract 36402) will be collected under this master project. Each project within the master project is authorized by a CHPRC contract release that contains the project-specific statement of work. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by the Columbia River Project staff
The CHPRC Columbia River Protection Project Quality Assurance Project Plan
Energy Technology Data Exchange (ETDEWEB)
Fix, N. J.
2008-11-30
Pacific Northwest National Laboratory researchers are working on the CHPRC Columbia River Protection Project (hereafter referred to as the Columbia River Project). This is a follow-on project, funded by CH2M Hill Plateau Remediation Company, LLC (CHPRC), to the Fluor Hanford, Inc. Columbia River Protection Project. The work scope consists of a number of CHPRC funded, related projects that are managed under a master project (project number 55109). All contract releases associated with the Fluor Hanford Columbia River Project (Fluor Hanford, Inc. Contract 27647) and the CHPRC Columbia River Project (Contract 36402) will be collected under this master project. Each project within the master project is authorized by a CHPRC contract release that contains the project-specific statement of work. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by the Columbia River Project staff.
Project structure plan requirements for the deconstruction projects
International Nuclear Information System (INIS)
Petrasch, Peter; Schmitt, Christian; Stapf, Meike
2011-01-01
The deconstruction of nuclear facilities requires due to the particular conditions and the size of the project a special project planning. The authors analyze the possible requirements to be fulfilled by a project structure plan for nuclear facilities, including personnel resources, organization structure, budget questions, operation and project oriented measures, possibility of modifications and supplements. Further topics include controlling and project realization procedures, documentation, third party activities (authorities, consultants, surveyors), logistics and transport, and radiation protection issues. Several questions remain for plants-specific planning, including the integration of the plant personnel, administrative work, project management, economic and financial issues, radioactive waste management issues.
Adapting Project Management Practices to Research-Based Projects
Bahr, P.; Baker, T.; Corbin, B.; Keith, L.; Loerch, L.; Mullenax, C.; Myers, R.; Rhodes, B.; Skytland, N.
2007-01-01
From dealing with the inherent uncertainties in outcomes of scientific research to the lack of applicability of current NASA Procedural Requirements guidance documentation, research-based projects present challenges that require unique application of classical project management techniques. If additionally challenged by the creation of a new program transitioning from basic to applied research in a technical environment often unfamiliar with the cost and schedule constraints addressed by project management practices, such projects can find themselves struggling throughout their life cycles. Finally, supplying deliverables to a prime vehicle customer, also in the formative stage, adds further complexity to the development and management of research-based projects. The Biomedical Research and Countermeasures Projects Branch at NASA Johnson Space Center encompasses several diverse applied research-based or research-enabling projects within the newly-formed Human Research Program. This presentation will provide a brief overview of the organizational structure and environment in which these projects operate and how the projects coordinate to address and manage technical requirements. We will identify several of the challenges (cost, technical, schedule, and personnel) encountered by projects across the Branch, present case reports of actions taken and techniques implemented to deal with these challenges, and then close the session with an open forum discussion of remaining challenges and potential mitigations.
Organization of BSc and MSc projects in project families
DEFF Research Database (Denmark)
Ottosen, Lisbeth M.; Goltermann, Per; Jensen, Pernille Erland
2014-01-01
This work reports organization of student thesis projects in project families, with the benefit to both teaching and learning. The project organization went from student projects broadly distributed on topics related to different research issues and individual supervision to project families with...
DEFF Research Database (Denmark)
Geraldi, Joana; Söderlund, Jonas
2018-01-01
Project organising is a growing field of scholarly inquiry and management practice. In recent years, two important developments have influenced this field: (1) the study and practice of projects have extended their level of analysis from mainly focussing on individual projects to focussing on micro......, and of the explanations of project practices they could offer. To discuss avenues for future research on projects and project practice, this paper suggests the notion of project studies to better grasp the status of our field. We combine these two sets of ideas to analyse the status and future options for advancing...... project research: (1) levels of analysis; and (2) type of research. Analysing recent developments within project studies, we observe the emergence of what we refer to as type 3 research, which reconciles the need for theoretical development and engagement with practice. Type 3 research suggests pragmatic...
Jaspers, F.P.H.; Ende, van den J.C.M.; Borgh, van der W.; Yin, Jie
2008-01-01
Studies about how the organization of new product (and new service) development projects (NPD) projects influences project performance typically investigate this in Single-firm projects, i.e. projects with high ownership integration. However, NPD projects are often performed by two or more
Research Project Evaluation-Learnings from the PATHWAYS Project Experience.
Galas, Aleksander; Pilat, Aleksandra; Leonardi, Matilde; Tobiasz-Adamczyk, Beata
2018-05-25
Every research project faces challenges regarding how to achieve its goals in a timely and effective manner. The purpose of this paper is to present a project evaluation methodology gathered during the implementation of the Participation to Healthy Workplaces and Inclusive Strategies in the Work Sector (the EU PATHWAYS Project). The PATHWAYS project involved multiple countries and multi-cultural aspects of re/integrating chronically ill patients into labor markets in different countries. This paper describes key project's evaluation issues including: (1) purposes, (2) advisability, (3) tools, (4) implementation, and (5) possible benefits and presents the advantages of a continuous monitoring. Project evaluation tool to assess structure and resources, process, management and communication, achievements, and outcomes. The project used a mixed evaluation approach and included Strengths (S), Weaknesses (W), Opportunities (O), and Threats (SWOT) analysis. A methodology for longitudinal EU projects' evaluation is described. The evaluation process allowed to highlight strengths and weaknesses and highlighted good coordination and communication between project partners as well as some key issues such as: the need for a shared glossary covering areas investigated by the project, problematic issues related to the involvement of stakeholders from outside the project, and issues with timing. Numerical SWOT analysis showed improvement in project performance over time. The proportion of participating project partners in the evaluation varied from 100% to 83.3%. There is a need for the implementation of a structured evaluation process in multidisciplinary projects involving different stakeholders in diverse socio-environmental and political conditions. Based on the PATHWAYS experience, a clear monitoring methodology is suggested as essential in every multidisciplinary research projects.
International Nuclear Information System (INIS)
Alvarez, M.U.
1990-01-01
This paper presents the basic concepts and components of the project financing of large industrial facilities. Diagrams of a simple partnership structure and a simple leveraged lease structure are included. Finally, a Hypothetical Project is described with basic issues identified for discussion purposes. The topics of the paper include non-recourse financing, principal advantages and objectives, disadvantages, project financing participants and agreements, feasibility studies, organization of the project company, principal agreements in a project financing, insurance, and an examination of a hypothetical project
School Science Review, 1978
1978-01-01
Presents sixteen project notes developed by pupils of Chipping Norton School and Bristol Grammar School, in the United Kingdom. These Projects include eight biology A-level projects and eight Chemistry A-level projects. (HM)
Project Management and the Project Manager: A Strategy for ...
African Journals Online (AJOL)
International Journal of Development and Management Review ... collapse, project failure, project abandonment, project cost and time overruns, etc. ... component parts that constitute project management in the building construction industry.
Locale-Specific Categorization of IT Projects for Proper Project Management
Directory of Open Access Journals (Sweden)
Muhammad Nasir
2015-12-01
Full Text Available In this paper we aim to show that not only are the project management techniques important for small-scale projects, but following proper project management techniques is one of the most important requirements. However, there come slight variations in implementing project management techniques in small projects as compared with larger projects. Therefore, proper categorization of projects holds the key to success in many situations. Our paper will show that categorization of a project as small-scale or large-scale should always be locale specific. In this regards, we develop a criteria and evaluate how the projects are categorized as small-scale and large-scale in different parts of the world with focus on IT projects. This research concludes that some methods cannot be used for projects of different scales.
Managing Projects for Change: Contextualised Project Management
Tynan, Belinda; Adlington, Rachael; Stewart, Cherry; Vale, Deborah; Sims, Rod; Shanahan, Peter
2010-01-01
This paper will detail three projects which focussed on enhancing online learning at a large Australian distance education University within a School of Business, School of Health and School of Education. Each project had special funding and took quite distinctive project management approaches, which reflect the desire to embed innovation and…
Improving Project Portfolio Management (PPM) for Improvement Projects
DEFF Research Database (Denmark)
Pries-Heje, Jan; Jakobsen, Peter M.; Korsaa, Morten
2017-01-01
Project Portfolio Management (PPM) focus on the integration and alignment of projects with the business operation in order to achieve most value and cost-efficiency for the investment in projects. PPM is often a challenge and especially so for improvement projects where PPM is considerably...... of evaluating a portfolio of improvement projects and combine this evaluation with the effect they have on the CMMI maturity level. Further, the paper demonstrates how the combination of a strong senior management requirement for improved maturity and the focus on getting the most value out of PPM made...
Project planning and project management of Baseball II-T
International Nuclear Information System (INIS)
Kozman, T.A.; Chargin, A.K.
1975-01-01
The details of the project planning and project management work done on the Baseball II-T experiment are reviewed. The LLL Baseball program is a plasma confinement experiment accomplished with a superconducting magnet in the shape of a baseball seam. Both project planning and project management made use of the Critical Path Management (CPM) computer code. The computer code, input, and results from the project planning and project management runs, and the cost and effectiveness of this method of systems planning are discussed
Energy Technology Data Exchange (ETDEWEB)
Burritt, James G.; Berkey, Edgar [Longenecker and Associates, Las Vegas, NV 89135 (United States)
2012-07-01
Managing complex projects requires a capable, effective project manager to be in place, who is assisted by a team of competent assistants in various relevant disciplines. This team of assistants is known as the Integrated Project Team (IPT). he IPT is composed of a multidisciplinary group of people who are collectively responsible for delivering a defined project outcome and who plan, execute, and implement over the entire life-cycle of a project, which can be a facility being constructed or a system being acquired. An ideal IPT includes empowered representatives from all functional areas involved with a project-such as engineering design, technology, manufacturing, test and evaluation, contracts, legal, logistics, and especially, the customer. Effective IPTs are an essential element of scope, cost, and schedule control for any complex, large construction project, whether funded by DOE or another organization. By recently assessing a number of major, on-going DOE waste management projects, the characteristics of high performing IPTs have been defined as well as the reasons for potential IPT failure. Project managers should use IPTs to plan and execute projects, but the IPTs must be properly constituted and the members capable and empowered. For them to be effective, the project manager must select the right team, and provide them with the training and guidance for them to be effective. IPT members must treat their IPT assignment as a primary duty, not some ancillary function. All team members must have an understanding of the factors associated with successful IPTs, and the reasons that some IPTs fail. Integrated Project Teams should be used by both government and industry. (authors)
Hsieh, Wen-Chuan; Lan, Bau-Shin; Chen, Yi-Ling; Chang, Yao; Chuang, Huai-Chia; Su, Ih-Jen
2010-01-01
Virus-associated haemophagocytic syndrome (VAHS) is a fatal complication of viral infections, such as Epstein-Barr virus and H5N1 influenza, that results from macrophage activation and pro inflammatory cytokine injuries. The high comorbidity and mortality of current therapy urgently demands an ideal agent based on VAHS pathogenesis. Peroxisome proliferator activated receptor (PPAR) agonists, regulators of metabolic syndrome, can exhibit immunomodulatory effects on macrophage activation and cytokine secretion. In this study, we adopted rosiglitazone, a PPAR-gamma agonist, for VAHS control in a Herpesvirus papio (HVP)-infected rabbit model. Various doses of rosiglitazone were orally administered to rabbits on day 7 or day 20 after intravenous challenge with 5 x 10(7) copies of HVP. The rabbits that received 4 mg/day rosiglitazone had significantly increased survival when treated at an early stage of infection (P<0.01), whereas a higher dose (8 mg/day) was required at the advanced stage of the disease (P<0.05). All rosiglitazone-treated rabbits had significantly improved laboratory parameters and plasma tumour necrosis factor-alpha levels. Importantly, rosiglitazone could also inhibit viral replication in vitro and in vivo. PPAR agonists could represent a potentially new agent for the therapy of VAHS.
Hessel, L
2009-08-01
Cervical cancer and other diseases related to human papillomavirus (HPV) represent a global public health problem. Safe and effective vaccines are now available and already used in many industrialized countries. Immunization offers the best hope for protecting the population against a disease that is the second most deadly cancer in the developing world and the first most deadly in Africa. The World Health Organization currently recommends introduction of HVP vaccination in developing countries. Widespread vaccination could be beneficial in numerous domains other than primary prevention of cervical cancer. Efforts to overcome the numerous obstacles and speed up implementation of HVP vaccination programs are now underway in many areas ranging from related scientific issues such as epidemiology and clinical research to administrative concerns such as healthcare economics, vaccination guidelines, public acceptation, program funding, and universal access. Vaccine manufacturers have committed themselves to working in partnership with national and international organizations to ensure access to HPV vaccine for all countries regardless of economic level, Although numerous issues must be resolved to optimize the use of HPV vaccines and ensure synergistic integration of vaccination, screening and treatment, current initiatives and efforts should allow introduction of HPV vaccination in developing countries in a not too distant future.
The more frequent types of human papillomavirus in Cuban samples of cervix cancer
International Nuclear Information System (INIS)
Rios Hernandez, Maria de los Angeles; Hernandez Menendez, Maite; Aguilar Vela de Oro, Francisco Orlando
2010-01-01
Cervix cancer (UCC) is considered a sexually transmitted disease due to factors involved in its appearance and development and this infection is recognized as the main etiological agent of this entity. In Cuba this type of tumor is placed in 2nd category in incidence and in 4th place in mortality among the malignant disease affecting the female sex. The objective of present study is to determine the types of human virus papilloma (HVP) present in samples of cervix tumors in Cuban women, as well as to describe the behavior of different risk factors associated with this disease. Forty five samples of cervix cancer were analyzed and the presence of 20 types of HVP was determined by polymerase chain reaction with specific primers founding in them a 91,1% of positivity. Genotype 16 was the more prevalent, followed by the 18, 45, 31, 39, 51, 56, 59, PAP23A. The low risk type 6 and 11 weren't founded in samples. Promiscuity was the more interesting risk factor in our study. Knowledge of the viral types present in cervix cancer in our patients is very important when we approach the development and the use of prophylactic and therapeutical vaccines
Environmental Science: 49 Science Fair Projects. Science Fair Projects Series.
Bonnet, Robert L.; Keen, G. Daniel
This book contains 49 science fair projects designed for 6th to 9th grade students. Projects are organized by the topics of soil, ecology (projects in habitat and life cycles), pests and controls (projects in weeds and insects), recycling (projects in resources and conservation), waste products (projects in decomposition), microscopic organisms,…
International Nuclear Information System (INIS)
Anon.
1990-01-01
This part specifies the activities and project tasks of each project broken down according to types of financing, listing the current projects Lw 1 through 3 funded by long-term provisions (budget), the current projects LB 1 and 2, LG 1 through 5, LK1, LM1, and LU 1 through 6 financed from special funds, and the planned projects ZG 1 through 4 and ZU 1, also financed from special funds. (DG) [de
Project Communication in Functions, Process and Project-Oriented Industiral Companies
Samáková, Jana; Koltnerová, Kristína; Rybanský, Rudolf
2012-12-01
The article is focused on the project communication management. Industrial enterprises, which use project management must constantly search the new ways for improving. One of the possibilities is the change of management from a functional oriented to the projectoriented or process-oriented. Process-oriented and project-oriented companies have better project communication management during the all project life cycle. Communication in the project is a very important factor. According to the arguments of several authors, one of the biggest problem is that threaten the success of the project is just the communication. In each project is an important pillar - and that is communication. Only on the base of communication can the project move forward and achieve the target.
Research Project Evaluation—Learnings from the PATHWAYS Project Experience
Directory of Open Access Journals (Sweden)
Aleksander Galas
2018-05-01
Full Text Available Background: Every research project faces challenges regarding how to achieve its goals in a timely and effective manner. The purpose of this paper is to present a project evaluation methodology gathered during the implementation of the Participation to Healthy Workplaces and Inclusive Strategies in the Work Sector (the EU PATHWAYS Project. The PATHWAYS project involved multiple countries and multi-cultural aspects of re/integrating chronically ill patients into labor markets in different countries. This paper describes key project’s evaluation issues including: (1 purposes, (2 advisability, (3 tools, (4 implementation, and (5 possible benefits and presents the advantages of a continuous monitoring. Methods: Project evaluation tool to assess structure and resources, process, management and communication, achievements, and outcomes. The project used a mixed evaluation approach and included Strengths (S, Weaknesses (W, Opportunities (O, and Threats (SWOT analysis. Results: A methodology for longitudinal EU projects’ evaluation is described. The evaluation process allowed to highlight strengths and weaknesses and highlighted good coordination and communication between project partners as well as some key issues such as: the need for a shared glossary covering areas investigated by the project, problematic issues related to the involvement of stakeholders from outside the project, and issues with timing. Numerical SWOT analysis showed improvement in project performance over time. The proportion of participating project partners in the evaluation varied from 100% to 83.3%. Conclusions: There is a need for the implementation of a structured evaluation process in multidisciplinary projects involving different stakeholders in diverse socio-environmental and political conditions. Based on the PATHWAYS experience, a clear monitoring methodology is suggested as essential in every multidisciplinary research projects.
BODIES OF KNOWLEDGE IN PROJECT MANAGEMENT AND PROJECT QUALITY MANAGEMENT
Tamara Gvozdenovic; Mirjana Miljanovic; Aleksandar Jegdic; Zeljko Crnogorcic
2008-01-01
One of the main trends is standardization of project management. Some of the most important bodies of knowledge in project management, which were created by professional associations for project management are given in this paper. The main of the project management, apart from minimization of time, resources and costs, is to finish the project in the required quality, i.e. it is very important during the whole process of project management to provide realizing the project without any deviatio...
BODIES OF KNOWLEDGE IN PROJECT MANAGEMENT AND PROJECT QUALITY MANAGEMENT
Directory of Open Access Journals (Sweden)
Tamara Gvozdenovic
2008-03-01
Full Text Available One of the main trends is standardization of project management. Some of the most important bodies of knowledge in project management, which were created by professional associations for project management are given in this paper. The main of the project management, apart from minimization of time, resources and costs, is to finish the project in the required quality, i.e. it is very important during the whole process of project management to provide realizing the project without any deviations from the previously set quality standards. Basic processes of project quality management are: quality planning, quality assurance and quality control.
40 CFR 258.41 - Project XL Bioreactor Landfill Projects.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Project XL Bioreactor Landfill... WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Design Criteria § 258.41 Project XL Bioreactor Landfill Projects. (a) Buncombe County, North Carolina Project XL Bioreactor Landfill Requirements...
DEFF Research Database (Denmark)
Svejvig, Per; Commisso, Trine Hald
2012-01-01
that the best practice knowledge has not permeated sufficiently to the practice. Furthermore, the appropriate application of information and communication technology (ICT) remains a big challenge, and finally project managers are not sufficiently trained in organizing and conducting virtual projects....... The overall implications for research and practice are to acknowledge virtual project management as very different to traditional project management and to address this difference.......Virtual projects are common with global competition, market development, and not least the financial crisis forcing organizations to reduce their costs drastically. Organizations therefore have to place high importance on ways to carry out virtual projects and consider appropriate practices...
Energy Technology Data Exchange (ETDEWEB)
1983-01-01
Papers were presented on the following: project evaluation; case studies - minerals; finance; applied finance; legal; manpower/industrial relations; and new technologies. Those papers on the coal industry were: mine planning for coal project development; the planning and management of a lignite exploration contract in Thailand; development of the West Cliff extended project; Ulan: a resource development; Saxonvale mine development a case study in project planning and project management; the role of marketing in the development of a new coal project; technical support for coal marketing; infrastructure development for the Ulan project; underground mine project developments; the bucketwheel excavator at Goonyella - a case study; tax aspects of mining development projects; cost of capital mining development projects; and trends in development project finance. 16 papers were abstracted separately.
DEFF Research Database (Denmark)
Tryggestad, Kjell; Justesen, Lise; Mouritsen, Jan
2013-01-01
Purpose – The purpose of this paper is to explore how animals can become stakeholders in interaction with project management technologies and what happens with project temporalities when new and surprising stakeholders become part of a project and a recognized matter of concern to be taken...... into account. Design/methodology/approach – The paper is based on a qualitative case study of a project in the building industry. The authors use actor-network theory (ANT) to analyze the emergence of animal stakeholders, stakes and temporalities. Findings – The study shows how project temporalities can...... multiply in interaction with project management technologies and how conventional linear conceptions of project time may be contested with the emergence of new non-human stakeholders and temporalities. Research limitations/implications – The study draws on ANT to show how animals can become stakeholders...
High-volume plasma exchange in patients with acute liver failure
DEFF Research Database (Denmark)
Larsen, Fin Stolze; Schmidt, Lars Ebbe; Bernsmeier, Christine
2016-01-01
% confidence interval (CI), 0.36-0.86; p=0.0083). HVP prior to transplantation did not improve survival compared with patients who received SMT alone (CI 0.37 to 3.98; p=0.75). The incidence of severe adverse events was similar in the two groups. Systemic inflammatory response syndrome (SIRS) and sequential...... organ failure assessment (SOFA) scores fell in the treated group compared to control group, over the study period (p
Understanding Applications of Project Planning and Scheduling in Construction Projects
AlNasseri, Hammad Abdullah
2015-01-01
Construction project life-cycle processes must be managed in a more effective and predictable way to meet project stakeholders’ needs. However, there is increasing concern about whether know-how effectively improves understanding of underlying theories of project management processes for construction organizations and their project managers. Project planning and scheduling are considered as key and challenging tools in controlling and monitoring project performance, but many worldwide constru...
DEFF Research Database (Denmark)
Project Management Theory Meets Practice contains the proceedings from the 1st Danish Project Management Research Conference (DAPMARC 2015), held in Copenhagen, Denmark, on May 21st, 2015.......Project Management Theory Meets Practice contains the proceedings from the 1st Danish Project Management Research Conference (DAPMARC 2015), held in Copenhagen, Denmark, on May 21st, 2015....
DEFF Research Database (Denmark)
Munk-Madsen, Andreas; Andersen, Peter Bøgh
2006-01-01
project managers should not only be concerned with project plans, but also with project stories. In this paper we explore some basic principles for transforming project plans into appealing stories. We discuss what may happen to stories once they are released into public space. And we illustrate how......Plans and stories are two different ways of communicating about projects. Project plans are formalized descriptions, primarily supporting coordination. Project stories are accounts whose primary function is emotional appeal. Project stories influence the projects’ chances of success. Therefore...... the possibilities of telling favorable stories may have repercussions on the project planning....
Experiences of project developers around CDM projects in South Africa
International Nuclear Information System (INIS)
Thurner, Thomas W.; Varughese, Arun
2013-01-01
Project developers in South Africa are puzzled with the long process of evaluating and registering their CDM projects. In addition to other obstacles, we find that South African big businesses are rather reluctant to engage in any new business activities such as CDM projects and municipalities often lack the necessary flexibility. This offers opportunities for small-scale project developers who spot the opportunities and find creative solutions to overcome these difficulties. - Highlights: • First paper analysing the experience of small project developers in South Africa. • Project developers in South Africa are puzzled with the long process. • South African big businesses are reluctant to engage in CDM projects. • Small-scale project developers spot opportunities and find creative solutions to overcome difficulties. • Also, we saw learning processes of South African administration in support of CDM projects
MATCHING CONFIGURATIONS PROJECTS OF COOPERATIVE MILK COLLECTION PROJECT ENVIRONMENT
Directory of Open Access Journals (Sweden)
Анатолій Миколайович ТРИГУБА
2017-03-01
Full Text Available The condition analysis of dairy farming is done and the reasons for its degradation are revealed. The need of technologically integrated production systems projects, harvesting, and processing of milk are substantiated. A scientific methodology and the method of project design of milk provision cooperative coordination in the community of the project environment, which are based on systematic-evaluative approach and simulation are proposed. The criterion for the definition of rational parameters of objects configuration for milk provision cooperative projects in the community system is the maximum value of their product. The monetary functioning assessment of the configuration object of cooperative milk provision projects in the community is done. On the basis of the proposed method, we performed the coordination of project configuration of milk provision cooperative with the project environment of territory Zabolotsi community in Brody district of Lviv region.
Marmel, Elaine
2010-01-01
A comprehensive reference on the latest version of the leading enterprise project management software: Microsoft Project 2010. Microsoft Project allows users to manage business activities effectively by sharing project information, performing modeling and scenario analyses, standardizizing reporting processes, and more. This soup-to-nuts reference covers both the professional and standard versions of the latest iteration of Microsoft Project, as well as Project Server, so that you can efficiently manage your business projects. Veteran author Elaine Marmel begins with an overview of project man
DEFF Research Database (Denmark)
Munk-Madsen, Andreas
2005-01-01
"Project" is a key concept in IS management. The word is frequently used in textbooks and standards. Yet we seldom find a precise definition of the concept. This paper discusses how to define the concept of a project. The proposed definition covers both heavily formalized projects and informally...... organized, agile projects. Based on the proposed definition popular existing definitions are discussed....
Project Management Methods in Projects Co-financed by EU Funds
Kostalova, Jana; Tetrevova, Libena; Patak, Michal
2017-01-01
This paper deals with the management of projects co-financed by European Union funds (structural funds and the Cohesion Fund) in the Czech Republic (EU projects). The authors aimed to analyze and assess the scope of familiarity with basic project management methods and their application within the implementation of EU projects in the Czech Republic in the Programming Period 2007–2013. Based on a questionnaire survey of EU project organisers, the authors evaluate their attitudes to project man...
The impact of project marketing on the projects finality
Directory of Open Access Journals (Sweden)
Oxana SAVCIUC
2015-06-01
Full Text Available In the last years we assist at the level of the Republic of Moldova and also at international level at a trend to offer financial support with a special focus on project-based funding. Once with the appearance and development of the project concept, other related concepts are being developed such as project management or newly, we can also speak about the projects marketing. Until recently, the product marketing was intensely discussed; concepts such as services marketing appeared afterwards, but also the specific marketing for various branches, such as agromarketing, political marketing, etc. Given that fact that the projects are a product / service itself, at the moment, more and more often projects marketing is discussed.
Alagba, Tonye J.
Oil and gas drilling projects are the primary means by which oil companies recover large volumes of commercially available hydrocarbons from deep reservoirs. These types of projects are complex in nature, involving management of multiple stakeholder interfaces, multidisciplinary personnel, complex contractor relationships, and turbulent environmental and market conditions, necessitating the application of proven project management best practices and critical success factors (CSFs) to achieve success. Although there is some practitioner oriented literature on project management CSFs for drilling projects, none of these is based on empirical evidence, from research. In addition, the literature has reported alarming rates of oil and gas drilling project failure, which is attributable not to technical factors, but to failure of project management. The aim of this quantitative correlational study therefore, was to discover an empirically verified list of project management CSFs, which consistent application leads to successful implementation of oil and gas drilling projects. The study collected survey data online, from a random sample of 127 oil and gas drilling personnel who were members of LinkedIn's online community "Drilling Supervisors, Managers, and Engineers". The results of the study indicated that 10 project management factors are individually related to project success of oil and gas drilling projects. These 10 CSFs are namely; Project mission, Top management support, Project schedule/plan, Client consultation, Personnel, Technical tasks, Client acceptance, Monitoring and feedback, Communication, and Troubleshooting. In addition, the study found that the relationships between the 10 CSFs and drilling project success is unaffected by participant and project demographics---role of project personnel, and project location. The significance of these findings are both practical, and theoretical. Practically, application of an empirically verified CSFs list to oil
Northeast Atlantic Igneous Province volcanic margin development
Mjelde, R.; Breivik, A. J.; Faleide, J. I.
2009-04-01
Early Eocene continental breakup in the NE Atlantic Volcanic Province (NAIP) was associated with voluminous extrusive and intrusive magmatism, and initial seafloor spreading produced anomalously thick oceanic crust. Recent publications based on crustal-scale wide-angle seismic data show that there is a positive correlation between igneous crustal thickness (H) and average P-wave velocity (Vp) on all investigated margins in the NAIP. Vp can be used as a proxy for crustal composition, which can be related to the mode of mantle melting. A positive H-Vp correlation indicates that excessive mantle melting the first few million years after breakup was driven by an initial increased temperature that cools off as seafloor spreading develops, consistent with a mantle plume model. Variations in mantle composition can explain excess magmatism, but will generate a negative H-Vp correlation. Active mantle convection may increase the flux of mantle rocks through the melting zone above the rate of passive corner flow, which can also produce excessive magmatism. This would produce little H-Vp correlation, and place the curve lower than the passive flow melting curve in the diagram. We have compiled earlier published results with our own analyses of published and unpublished data from different groups to look for systematic variations in the mantle melting mode along the NAIP margins. Earlier studies (Holbrook et al., 2002, White et al, 2008) on the southeast Greenland conjugate system, indicate that the thick igneous crust of the southern NAIP (SE Greenland ? Hatton Bank) was dominated by increased mantle temperature only, while magmatism closer to the southern side of and including the Greenland-Iceland-Færøy Ridge (GIFR) was created by combined temperature increase and active mantle convection. Recent publications (Breivik et al., 2008, White et al, 2008) north of the GIFR for the Norway Basin segment, indicate temperature dominated magmatism between the Jan Mayen Fracture
Williamson, David J.
2011-01-01
The specific problem addressed in this study was the low success rate of information technology (IT) projects in the U.S. Due to the abstract nature and inherent complexity of software development, IT projects are among the most complex projects encountered. Most existing schools of project management theory are based on the rational systems…
A Framework for Project Governance in Major Public IT projects
DEFF Research Database (Denmark)
Harboe, Peter Georg; Riis, Eva
2016-01-01
such a framework. It was developed from the literature on major and mega-projects, both public and private, that concern infrastructure, engineering and IT. The proposed framework for project governance comprises six major elements: governance structure, management approach, stakeholders, value, systems......The rising number of major public IT projects is mirrored by a growing research interest in the management of such projects. Both can benefit from a more complete understanding of project governance that should lead to a practical framework for project governance. The present paper proposes...... integration and complexity. Empirical research has identified a number of characteristics for these project governance elements. In the second part of the paper the framework was tested in a case study of the Danish smart card Rejsekort project. The framework was found to be robust, and that in this case...
A Framework for Project Governance in Major Public IT projects
DEFF Research Database (Denmark)
Riis, Eva; Harboe, Peter Georg
2016-01-01
integration and complexity. Empirical research has identified a number of characteristics for these project governance elements. In the second part of the paper the framework was tested in a case study of the Danish smart card Rejsekort project. The framework was found to be robust, and that in this case......The rising number of major public IT projects is mirrored by a growing research interest in the management of such projects. Both can benefit from a more complete understanding of project governance that should lead to a practical framework for project governance. The present paper proposes...... such a framework. It was developed from the literature on major and mega-projects, both public and private, that concern infrastructure, engineering and IT. The proposed framework for project governance comprises six major elements: governance structure, management approach, stakeholders, value, systems...
Trevino Project: a fast-track approach for a small construction project
International Nuclear Information System (INIS)
Schick, C.J.; Lynn, N.S.
1982-01-01
The approach to a construction project can vary according to the size, location, and degree of difficulty associated with the project. This paper deals with one approach that can be taken to a small construction project, the fast-track approach. A small construction project can be defined as a project having less than $20 million capital cost or a project with a low degree of difficulty. This approach is very applicable to in-situ leaching uranium projects, small precious metal operations, etc. The approach to the small project is that of fast-tracking the project in order to minimize the time over which capital expenditure occurs and also to reduce the indirect costs of field expense, construction supplies, construction equipment, etc. In order to fast-track a project it is necessary to do a very precise job on the preliminary phases of the project such as preliminary engineering, plant site location, environmental permits, etc. 2 figures, 2 tables
PROJECT - RESOURCE MANAGEMENT OF INNOVATIONS IN EDUCATION: ANTHROPOLOGICAL PROJECTION
Directory of Open Access Journals (Sweden)
Galina Aleksandrovna Ignat’eva
2015-08-01
Full Text Available The purpose of the research was to denote a way to solve the problem of education mana-gement ΄s insufficient efficiency considered from the point of view of education opportunities to influence on the formation of mechanisms for sustainable development of society as a whole and its educational component. The concept «project-resource management of innovation in education» regarded on the basis of the anthropological project-transforming paradigm. Conceptually-categorical context presented by conceptual cluster composed of coordinated concepts «project», «resource», «educational reality», «organizational-resource potential», «project commonality». In the theoretical part of the study on the basis of analysis of the normative and exploratory approaches to educational innovations organization and management it was established the search approach ΄s leading role in the methodological substantiation of project-resource management. The study have indicated that in the presence of variable models of innovation management in education, corresponding to various predictive models of continuing education post-industrial society, project-resource management is an universal mechanism for the transition from separate innovation΄s precedents to the an authentic reality of innovative education. In the technological part of the study the main concern was to submit the project-resource management by the management goal’s system, each of which includes the specific management actions, projected results and the organizational forms. The project-resource management ΄s professional – activity context of the study showed evolution of managerial positions: an effective performer – an effective leader – strategist, implemented during the transition from directly directive management to the project management and further to the project-resource management. Based on the findings identified the key factors of initiatively-problem projects
PACTEL OECD project planning (PACO). PACTEL OECD project planning
Energy Technology Data Exchange (ETDEWEB)
Kouhia, V.; Purhonen, H. [Lappeenranta University of Technology (Finland)
2004-07-01
OECD launched the SETH project to investigate issues relevant for accident prevention and management and to ensure the existence of integral thermal hydraulic test facilities. The facilities included in the SETH project are PKL from Germany and PANDA from Switzerland. At the early stages of the SETH project an idea was raised to exploit the PACTEL facility in a similar OECD project. Without any external funding the analytical work in the required extent would not be possible within Lappeenranta University of Technology, the party responsible of operating PACTEL. This fact directed the PACO project proposal to be conducted for the SAFIR programme. The aim of the PACO project is to prepare a project proposal to OECD of a PACTEL related project. To attain this objective some preliminary analyses have to be performed to ensure the relevancy of the proposed topic. The low power situation, i.e. midloop state was chosen to be the topic in the PACO studies and project planning basis. The plan is to use PACTEL to examine vertical steam generator behaviour during the midloop operation and the following loss of residual heat removal system transient. Such a possibility is acknowledged with special alterations to PACTEL. The APROS code version 5.04.07 was selected as a tool for the preanalyses. The virtual simulation of the chosen experimental situation would give a preconception on the phenomena to be expected and the progression of the transient. Originally the PACO project was planned to continue only for a few months, ending up with the project proposal to OECD during the summer time 2004. During the pre-calculation process it became obvious that the time expected was not enough to establish good pre-calculation results. The reasons for this relates to time used to learn and adapt the use of the chosen code, improvements and corrections in modelling as well as the code ability to manage the special conditions defined for the project topic. Another aspect on completing a
Project manager attributes influencing project success in the South ...
African Journals Online (AJOL)
success criteria for building projects in Ghana and concluded that the “current and ... qualifications, profession, leadership style and project team ... and expectations of project management competence between ... 1.d. Sense of teamwork ...
Markić, Lucija; Mandušić, Dubravka; Grbavac, Vitomir
2005-01-01
Microsoft Project je alat čije su prednosti u svakodnevnom radu nezamjenjive. Pomoću Microsoft Projecta omogućeno je upravljanje resursima, stvaranje izvještaja o projektima u vremenu, te analize različitih scenarija. Pojavljuje u tri verzije: Microsoft Project Professional, Microsoft Project Server i Microsoft Project Server Client Access Licenses. Upravo je trend da suvremeni poslovni ljudi zadatke povjeravaju Microsoft Projectu jer on znatno povećava produktivnost rada. Te prednos...
Project stakeholder management
Eskerod, Pernille
2013-01-01
Carrying out a project as planned is not a guarantee for success. Projects may fail because project management does not take the requirements, wishes and concerns of stakeholders sufficiently into account. Projects can only be successful though contributions from stakeholders. And in the end, it is the stakeholders that evaluate whether they find that the project is a success. To manage stakeholders effectively, you need to know your stakeholders, their behaviours and attitudes towards the project. In Project Stakeholder Management, the authors give guidance on how to adopt an analytical and s
DEFF Research Database (Denmark)
Svejvig, Per; Gerstrøm, Anna; Frederiksen, Signe Hedeboe
The Half Double mission: Project Half Double has a clear mission. We want to succeed in finding a project methodology that can increase the success rate of our projects while increasing the development speed of new products and services. We are convinced that by doing so we can strengthen...... the competitiveness of Denmark and play an important role in the battle for jobs and future welfare. The overall goal is to deliver “Projects in half the time with double the impact” where projects in half the time should be understood as half the time to impact (benefit realization, effect is achieved......) and not as half the time for project execution. The Half Double project journey: It all began in May 2013 when we asked ourselves: How do we create a new and radical project paradigm that can create successful projects? Today we are a movement of hundreds of passionate project people, and it grows larger...
Suralkar, Sunita; Joshi, Nilambari; Meshram, B B
2013-01-01
This paper describes about the need for Web project management, fundamentals of project management for web projects: what it is, why projects go wrong, and what's different about web projects. We also discuss Cost Estimation Techniques based on Size Metrics. Though Web project development is similar to traditional software development applications, the special characteristics of Web Application development requires adaption of many software engineering approaches or even development of comple...
Project Documentation as a Risk for Public Projects
Directory of Open Access Journals (Sweden)
Vladěna Štěpánková
2015-08-01
Full Text Available Purpose of the article: The paper presents the different methodologies used for creating documentation and focuses on public projects and their requirements for this documentation. Since documentation is also incorporated in the overall planning of the project and its duration is estimated using expert qualified estimate, can any change in this documentation lead to project delays, or increase its cost as a result of consuming administration, and therefore the documentation is seen as a risk, which may threaten the project as a public contract by which a company trying to achieve and obtains it, and generally any project. Methodology/methods: There are used methods of obtaining information in this paper. These are mainly structured interviews in combination with a brainstorming, furthermore also been used questionnaire for companies dealing with public procurement. As a data processing program was used MS Excel and basic statistical methods based on regression analysis. Scientific aim: The article deals with the construction market in the Czech Republic and examines the impact of changes in project documentation of public projects on their turnover. Findings: In this paper we summarize the advantages and disadvantages of having project documentation. In the case of public contracts and changes in legislation it is necessary to focus on creating documentation in advance, follow the new requirements and try to reach them in the shortest possible time. Conclusions: The paper concludes with recommendations on how to proceed, if these changes and how to reduce costs, which may cause the risk of documentation.
Energy Technology Data Exchange (ETDEWEB)
Smith, Rhett [Schweitzer Engineering Laboratories, Inc., Pullman, WA (United States); Campbell, Jack [CenterPoint Energy Houston Electric, TX (United States); Hadley, Mark [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-12-30
The Watchdog Project completed 100% of the project Statement of Project Objective (SOPO). The Watchdog project was a very aggressive project looking to accomplish commercialization of technology that had never been commercialized, as a result it took six years to complete not the original three that were planned. No additional federal funds were requested from the original proposal and SEL contributed the additional cost share required to complete the project. The result of the Watchdog Project is the world’s first industrial rated Software Defined Network (SDN) switch commercially available. This technology achieved the SOPOO and DOE Roadmap goals to have strong network access control, improve reliability and network performance, and give the asset owner the ability to minimize attack surface before and during an attack. The Watchdog project is an alliance between CenterPoint Energy Houston Electric, Pacific Northwest National Laboratories (PNNL), and Schweitzer Engineering Laboratories, Inc. (SEL). SEL is the world’s leader in microprocessor-based electronic equipment for protecting electric power systems. PNNL performs basic and applied research to deliver energy, environmental, and national security for our nation. CenterPoint Energy is the third largest publicly traded natural gas delivery company in the U.S and third largest combined electricity and natural gas delivery company. The Watchdog Project efforts were combined with the SDN Project efforts to produce the entire SDN system solution for the critical infrastructure. The Watchdog project addresses Topic Area of Interest 5: Secure Communications, for the DEFOA- 0000359 by protecting the control system local area network itself and the communications coming from and going to the electronic devices on the local network. Local area networks usually are not routed and have little or no filtering capabilities. Combine this with the fact control system protocols are designed with inherent trust the control
Influence of organizational and project cultures on project success
Directory of Open Access Journals (Sweden)
Berdykulova G. M.
2017-10-01
Full Text Available the article is dedicated to studying the influence of organizational and project cultures on effective project management of the company by knowledge systematization and the comparative analysis of world companies’ practice that allowed to reveal the main factors and criteria of projects success and negative influence of organizational culture on the project; key aspects of corporate culture and cultural integration under the conditions of globalization.
Pac-Rim LNG project : final project report specifications
International Nuclear Information System (INIS)
1996-01-01
PAC-RIM LNG Inc. has submitted a proposal to the British Columbia Environmental Assessment Office, to develop a liquefied natural gas project which would purchase pipeline quality natural gas from sources in northeast British Columbia and Alberta and transport it via a dedicated pipeline system to a LNG processing plant on tidewater on the Pacific coast. The project would include storage and processing facilities and a marine loading terminal. This document sets out the final project report specifications prepared by the Project Committee on the basis of input received from the public, First Nations and federal, provincial and local governments
Does Lean & Agile Project Management Help Coping with Project Complexity?
Jalali Sohi, A.; Hertogh, M.J.C.M.; Bosch-Rekveldt, M.G.C.; Blom, R.; Serpell, A.; Ferrada, X.
2016-01-01
Still, projects in the construction sector are delivered with time delays and cost overruns. One of the reasons for poor performance was assigned to project complexity. A combination of lean construction and agile project management are hypothesized as a possible solution to cope with project
Regragui, Asmaa; Lakhdar, Hind; Abderrahman Alaoui Belabbas, Moulay; Amrani, Meryem; Gamra, Lamia; Alaoui Belabbas, Mohamed
2004-05-01
Sarcomatoïd carcinoma is a rare tumor of the esophagus, characterized macroscopically by a polypoid aspect and histologically by the association of spindle cell carcinoma with sarcomatous pleomorphic component. We report here a case of esophagus sarcomatoïd carcinoma. Diagnosis was based on immunohistochemical analysis of tIssue samples. Human papillomavirus (HVP) detection by PCR amplification of DNA extracted from tumoral tIssue was negative, ruling out the role of HPV infection in this tumor.
CERN. Geneva
2003-01-01
This lecture will focus on the following issues: - The current state of the art in Project Management, especially the integration of Project Management with general management activities, and the integrated view of resources allocation. - Overview of the project life cycle, the phases and the deliverables - Necessity and limits of planning in a research environment - Organizational aspects of the projects the roles of the stakeholders - How to get the resources when they are needed - Risk Management in Projects - Earned value - How to keep a project on track (schedule and budget) - Management of the suppliers - Closing of the project
Jonasson, Haukur Ingi
2013-01-01
How relevant is ethics to project management? The book - which aims to demystify the field of ethics for project managers and managers in general - takes both a critical and a practical look at project management in terms of success criteria, and ethical opportunities and risks. The goal is to help the reader to use ethical theory to further identify opportunities and risks within their projects and thereby to advance more directly along the path of mature and sustainable managerial practice.
Integrated project support environments the ASPECT project
Brown, Alan W
1991-01-01
A major part of software engineering developments involve the use of computing tools which facilitate the management, maintenance, security, and building of long-scale software engineer projects. Consequently, there have been a proliferation of CASE tools and IPSES. This book looks at IPSES in general and the ASPECT project in particular, providing design and implementation details, as well as locating ASPECT in IPSE developments.Survey of integrated project support environments for more efficient software engineering**Description of a large scale IPSE--ASPECT**Evaluation of formal methods in
1980-01-01
The ASEAN Population Expert Group met in Manila and was followed by a meeting of the ASEAN heads of population programs, during the period November 5-10, 1979. Heads of population programs from Indonesia, Malaysia, Singapore, Thailand, and the Philippines attended. The meetings were held to review progress-to-date on phase 1 projects and to consider the development of an expanded population program. 5 projects funded by UNFPA are reviewed in tabular form with the project, the sponsoring country, date of implementation, data analysis, and date of completion. Suggestions were made for improving and extending these projects and it was also suggested that all projects being developed and proposed should include a section on use of research. 7 new projects were proposed as phase 2 projects. The 1st, sponsored by Malaysia, deals with women in development; project 2, lead by Thailand, will investigate population movement and its effect on development; project 3, led by the Philippines, will develop and strengthen national population information systems and networks in ASEAN countries; project 4, led by Indonesia, is directed towards institutional development and exchanges of personnel; project 5, led by the Philippines, will examine population and development dynamics and the man/resources balance; project 6, led by Thailand, will develop ASEAN social indicators; and project 7, led by Indonesia and Malaysia, will make a comprehensive analysis of existing medical/health care and family planning systems. It was recommended that an executive director of the proposed ASEAN population coordination unit should be appointed to expedite the recommendations of the meeting related to preparation and submission of phase 2 project proposals.
DEFF Research Database (Denmark)
Svejvig, Per; Ehlers, Michael; Adland, Karoline Thorp
activities carried out within the framework of the projects. The formal part of Project Half Double was initiated in June 2015. We started out by developing, refining and testing the Half Double methodology on seven pilot projects in the first phase of the project, which will end June 2016. The current......Project Half Double has a clear mission to succeed in finding a project methodology that can increase the success rate of our projects while increasing the speed at which we generate new ideas and develop new products and services. Chaos and complexity should be seen as a basic condition...... and as an opportunity rather than a threat and a risk. We are convinced that by doing so, we can strengthen Denmark’s competitiveness and play an important role in the battle for jobs and future welfare. The overall goal is to deliver “projects in half the time with double the impact”, where projects in half the time...
Integrated project risk management of nuclear power projects
International Nuclear Information System (INIS)
Wang Xiaohui; Xu Yuanhui
2001-01-01
The concept and the features of risks in nuclear power projects are introduced, and in terms of nuclear power projects' own features, the Nuclear Power Project Integrated Risk Management Model is presented. The identification, estimation, evaluation, response plan development, control of risks and the theoretical basis of risk management are discussed. The model has feedback and control functions in order to control and manage the risks dynamically
REPNET: project scheduling and workflow optimization for Construction Projects
Directory of Open Access Journals (Sweden)
Marco Alvise Bragadin
2013-10-01
Full Text Available Project planning and control are core processes for construction management. In practice project planning is achieved by network - based techniques like Precedence Diagramming Method (PDM.Indeed many researchers and practitioners claims that networking techniques as such do not provide a suitable model for construction projects. Construction process modeling should incorporate for specific features of resource flows through project activities. So an improved resource scheduling method for construction is developed, called REPNET, based on a precedence network plotted on a resource–space chart and presented with a flow-line chart. The heuristics of REPNET are used to carry out resource timing while optimizing processes flows and resource usage. The method has been tested on a sample project.
Directory of Open Access Journals (Sweden)
Zubović Jovan
2004-01-01
Full Text Available This paper looks at the difficulties of managing modem capital projects and endeavors to reduce the complexities to simpler and more understandable terms. It examines the project environment, defines project management and discusses points of difference from traditional management. In the second part of the paper are presented fundamentals for project success for different types of projects.
Competency model for the project managers of technical projects
Duncan, William R.
1992-05-01
Traditional job description techniques were developed to support compensation decisions for hourly wage earners in a manufacturing environment. Their resultant focus on activities performed on the job works well in this environment where the ability to perform the activity adequately is objectively verifiable by testing and observation. Although many organizations have adapted these techniques for salaried employees and service environments, the focus on activities performed has never been satisfactory. For example, stating that a project manager `prepares regular project status reports' tells us little about what to look for in a potential project manager or how to determine if a practicing project manager is ready for additional responsibilities. The concept of a `competency model' has been developed within the last decade to address this shortcoming. Competency models focus on what skills are needed to perform the tasks defined by the job description. For example, a project manager must be able to communicate well both orally and in writing in order to `prepare regular project status reports.'
PROJECT SCOPE MANAGEMENT PROCESS
Directory of Open Access Journals (Sweden)
Yana Derenskaya
2018-01-01
Full Text Available The purpose of the article is to define the essence of project scope management process, its components, as well as to develop an algorithm of project scope management in terms of pharmaceutical production. Methodology. To carry out the study, available information sources on standards of project management in whole and elements of project scope management in particular are analysed. Methods of system and structural analysis, logical generalization are used to study the totality of subprocesses of project scope management, input and output documents, and to provide each of them. Methods of network planning are used to construct a precedence diagram of project scope management process. Results of the research showed that components of the project scope management are managing the scope of the project product and managing the content of project work. It is the second component is investigated in the presented work as a subject of research. Accordingly, it is defined that project scope management process is to substantiate and bring to the realization the necessary amount of work that ensures the successful implementation of the project (achievement of its goal and objectives of individual project participants. It is also determined that the process of managing the project scope takes into account the planning, definition of the project scope, creation of the structure of project work, confirmation of the scope and management of the project scope. Participants of these subprocesses are: customer, investor, and other project participants – external organizations (contractors of the project; project review committee; project manager and project team. It is revealed that the key element of planning the project scope is the formation of the structure of design work, the justification of the number of works, and the sequence of their implementation. It is recommended to use the following sequence of stages for creating the structure of project work
VarioML framework for comprehensive variation data representation and exchange.
Byrne, Myles; Fokkema, Ivo Fac; Lancaster, Owen; Adamusiak, Tomasz; Ahonen-Bishopp, Anni; Atlan, David; Béroud, Christophe; Cornell, Michael; Dalgleish, Raymond; Devereau, Andrew; Patrinos, George P; Swertz, Morris A; Taschner, Peter Em; Thorisson, Gudmundur A; Vihinen, Mauno; Brookes, Anthony J; Muilu, Juha
2012-10-03
Sharing of data about variation and the associated phenotypes is a critical need, yet variant information can be arbitrarily complex, making a single standard vocabulary elusive and re-formatting difficult. Complex standards have proven too time-consuming to implement. The GEN2PHEN project addressed these difficulties by developing a comprehensive data model for capturing biomedical observations, Observ-OM, and building the VarioML format around it. VarioML pairs a simplified open specification for describing variants, with a toolkit for adapting the specification into one's own research workflow. Straightforward variant data can be captured, federated, and exchanged with no overhead; more complex data can be described, without loss of compatibility. The open specification enables push-button submission to gene variant databases (LSDBs) e.g., the Leiden Open Variation Database, using the Cafe Variome data publishing service, while VarioML bidirectionally transforms data between XML and web-application code formats, opening up new possibilities for open source web applications building on shared data. A Java implementation toolkit makes VarioML easily integrated into biomedical applications. VarioML is designed primarily for LSDB data submission and transfer scenarios, but can also be used as a standard variation data format for JSON and XML document databases and user interface components. VarioML is a set of tools and practices improving the availability, quality, and comprehensibility of human variation information. It enables researchers, diagnostic laboratories, and clinics to share that information with ease, clarity, and without ambiguity.
Directory of Open Access Journals (Sweden)
Cassereau Julien
2011-12-01
Full Text Available Abstract Background The ganglioside-induced differentiation-associated protein 1 gene (GDAP1, which is involved in the Charcot-Marie-Tooth disease (CMT, the most commonly inherited peripheral neuropathy, encodes a protein anchored to the mitochondrial outer membrane. The phenotypic presentations of patients carrying GDAP1 mutations are heterogeneous, making it difficult to determine genotype-phenotype correlations, since the majority of the mutations have been found in only a few unrelated patients. Locus-specific databases (LSDB established in the framework of the Human Variome Project provide powerful tools for the investigation of such rare diseases. Methods and Results We report the development of a publicly accessible LSDB for the GDAP1 gene. The GDAP1 LSDB has adopted the Leiden Open-source Variation Database (LOVD software platform. This database, which now contains 57 unique variants reported in 179 cases of CMT, offers a detailed description of the molecular, clinical and electrophysiological data of the patients. The usefulness of the GDAP1 database is illustrated by the finding that GDAP1 mutations lead to primary axonal damage in CMT, with secondary demyelination in the more severe cases of the disease. Conclusion Findings of this nature should lead to a better understanding of the pathophysiology of CMT. Finally, the GDAP1 LSDB, which is part of the mitodyn.org portal of databases of genes incriminated in disorders involving mitochondrial dynamics and bioenergetics, should yield new insights into mitochondrial diseases.
Project risk management: A review of an institutional project life cycle
Directory of Open Access Journals (Sweden)
Wanjiru Gachie
2017-11-01
Full Text Available This article is a desktop analysis of project risk management involving a project management institutional restructuring. The pragmatic nature of this research allows for the literature review and the document analysis to be integrated and presented as both a descriptive and analytical research. The analysis demonstrates that the project committee did not proactively manage project risk. The restructuring was a change management project, entailing the implementation of many organisational changes, such as restructuring, lay-off of some part of the administrative workforce, adoption of new technology, provision of new approaches to well-established procedures, and implementation of new performance initiative, the process which should have been managed with an effective integrated risk strategy and plan. Analysis of the restructuring project risk management exhibits little evidence of a systematic (computer based or manual record that should have provided policies, procedures, and structures for managing risk. The article concludes that the restructuring risk process was inadequate and it could not have ensured a successful project. An analysis of the restructuring project risk monitoring and control exhibits a reactive rather than proactive application of risk management procedures. The analysis further indicates that the committee failed to make use of the various project risk management processes, standards, and guidelines. Based on the conclusions, the article recommends that project risk planning, strategy, control, and monitoring should be put in place for future institutional projects. The project management team should also put in place procedures for primary stakeholders engagements, identify and address their nature of interest and power in future risk management projects
Lynch, Margaret M.
2013-01-01
This study explores the meaning project managers (PMs) make of their project environment, how they lead their teams and have incorporate complexity into their project management approach. The exploration of the PM's developmental level and meaning making offers a different angle on the project management and leadership literature. The study…
Comparative physical mapping between wheat chromosome arm 2BL and rice chromosome 4.
Lee, Tong Geon; Lee, Yong Jin; Kim, Dae Yeon; Seo, Yong Weon
2010-12-01
Physical maps of chromosomes provide a framework for organizing and integrating diverse genetic information. DNA microarrays are a valuable technique for physical mapping and can also be used to facilitate the discovery of single feature polymorphisms (SFPs). Wheat chromosome arm 2BL was physically mapped using a Wheat Genome Array onto near-isogenic lines (NILs) with the aid of wheat-rice synteny and mapped wheat EST information. Using high variance probe set (HVP) analysis, 314 HVPs constituting genes present on 2BL were identified. The 314 HVPs were grouped into 3 categories: HVPs that match only rice chromosome 4 (298 HVPs), those that match only wheat ESTs mapped on 2BL (1), and those that match both rice chromosome 4 and wheat ESTs mapped on 2BL (15). All HVPs were converted into gene sets, which represented either unique rice gene models or mapped wheat ESTs that matched identified HVPs. Comparative physical maps were constructed for 16 wheat gene sets and 271 rice gene sets. Of the 271 rice gene sets, 257 were mapped to the 18-35 Mb regions on rice chromosome 4. Based on HVP analysis and sequence similarity between the gene models in the rice chromosomes and mapped wheat ESTs, the outermost rice gene model that limits the translocation breakpoint to orthologous regions was identified.
Overlapping Boundaries of the Project Time Management and Project Risk Management
Directory of Open Access Journals (Sweden)
Marius PODEAN
2010-01-01
Full Text Available Based on utility function, milestones during project and/or the end of projects or programme may be categorized in what are called soft-deadline and hard-deadline. In contrast with the soft-end projects, the hard-end projects posses a decrease of utility function with a vertical asymptote character around the deadline for project completion. In extreme situations, the utility function itself may fall under zero (projects may generate losses to both constructor and customer. Existing risk analysis methodologies observe risks from monetary terms. The typical risks are correlated with an increase in final project costs. In order to estimate harddeadline milestones and/or end of projects or programme is critical to employ the time dimension rather than the typical cost-based risk analysis. Here, we comprehensively describe a structured methodology that focuses on minimizing and mitigating project specific delay risks. The method may supplement existing cost-based risk analysis in projects. We aim to elegantly combine moderation techniques to reveal the intrinsic risk of the projects. In addition to the technical risks, the moderation techniques are able to bring evidence of risks as the team efficacy, diverse un-correlations or miss-understanding about the roles of the team members in the team – most of the project soft risk. Described methodology encourages the common understanding of risks for participants, crystallizing the essence of what can go wrong in complex situations and where the opportunities can be unlocked.
DEFF Research Database (Denmark)
Frøkjær, E.; Hornbæk, K.; Høegh, Rune Thaarup
2006-01-01
This paper provides experience from activities in the USE project. The USE project is a research project that aims at bridging the gap between usability evaluation and user interface design. It is conducted from 2005 to 2008 in collaboration between researchers from Aalborg University and Copenha......This paper provides experience from activities in the USE project. The USE project is a research project that aims at bridging the gap between usability evaluation and user interface design. It is conducted from 2005 to 2008 in collaboration between researchers from Aalborg University...... and Copenhagen University, and developers and managers working in software development organizations....
Conjoint utility analysis of technical maturity and project progress of construction project
Directory of Open Access Journals (Sweden)
Ma Wei
2016-01-01
Full Text Available In this paper, taking construction project as the research object, the relationship between the project maturity index calculated by the construction project technical risks with different fine degree and the project progress index is studied, and the equilibrium relationship between the Party A’s utility curve and the Party B’s cost curve of using project maturity index and project progress index as the research variables is analyzed. The results show that, when the construction project technical risk division is more precise, the conjoint utility of the project's technical maturity index and the project progress is higher, and the project’s Party A and Party B two sides are closer to the optimal equilibrium. This shows that the construction project technical risk must be finely divided, and managed and controlled respectively, which will help to improve the conjoint utility of the project Party A and Party B two sides.
Final Project Report Project 10749-4.2.2.1 2007-2009
Energy Technology Data Exchange (ETDEWEB)
Zacher, Alan H.; Holladay, Johnathan E.; Frye, J. G.; Brown, Heather M.; Santosa, Daniel M.; Oberg, Aaron A.
2009-05-11
This is the final report for the DOE Project 10749-4.2.2.1 for the FY2007 - FY2009 period. This report is non-proprietary, and will be submitted to DOE as a final project report. The report covers activities under the DOE Project inside CRADA 269 (Project 53231) as well as project activites outside of that CRADA (Project 56662). This is the final report that is summarized from the non-proprietary quarterlies submitted to DOE over the past 2.5 years, which in turn are summaries from the proprietary technical reporting to UOP.
International Nuclear Information System (INIS)
1994-02-01
The Department of Energy (DOE) established the Office of Technology Development (EM-50) (OTD) as an element of Environmental Restoration and Waste Management (EM) in November, 1989. OTD has begun to search out, develop, test and demonstrate technologies that can now or in the future be applied to the enormous remediation problem now facing the DOE and the United States public in general. Technology demonstration projects have been designed to attack a separate problem as defined by DOE. The Heavy Metals Contaminated Soil Project was conceived to test and demonstrate off-the-shelf technologies (dominantly from the mining industry) that can be brought to bear on the problem of radionuclide and heavy metal contamination in soils and sediments. The Resource Recovery Project is tasked with identifying, developing, testing, and evaluating new and innovative technologies for the remediation of metal contaminated surface and groundwater. An innovative twist on this project is the stated goal of recovering the metals, formerly disposed of as a waste, for reuse and resale, thereby transforming them into a usable resource. Finally, the Dynamic Underground Stripping Project was developed to demonstrate and remediate underground spills of hydrocarbons from formations that are (1) too deep for excavation, and/or (2) require in-situ remediation efforts of long duration. This project has already been shown effective in reducing the time for remediation by conventional methods from an estimated 200 years at the Lawrence Livermore National Laboratory (LLNL) to less than one year. The savings in time and dollars from this technology alone can be immeasurable
Young, Trevor L
2016-01-01
Successful Project Management, 5th edition, is an essential guide for anyone who wants to improve the success rate of their projects. It will help managers to maintain a balance between the demands of the customer, the project, the team and the organization. Covering the more technical aspects of a project from start to completion it contains practised and tested techniques, covering project conception and start-up, how to manage stake holders, effective risk management, project planning and launch and execution. Also including a brand new glossary of key terms, it provides help with evaluating your project as well as practical checklists and templates to ensure success for any ambitious project manager. With over one million copies sold, the hugely popular Creating Success series covers a wide variety of topic, with the latest editions including new chapters such as Tough Conversations and Treating People Right. This indispensable business skills collection is suited to a variety of roles, from someone look...
Reflexive project management in high-abition projects
Loeber, Anne; Vermeulen, T.
2016-01-01
Purpose
The Aristotelian notion of phronèsis inspired innovative work in the realm of project management as well as in literature on sustainability and societal transformations. We argue that both literatures may benefit from a dialogue between the two, especially in view of outlining project
Project brief of pre-contract in project management
International Nuclear Information System (INIS)
Mohd Jamil Hashim; Mohd Azmi Sidid Omar; Abdul Rahman Norazumin; Zakaria Dris; Abdul Murad Abu Bakar; Alwi Othman
2010-01-01
Project brief is a comprehensive document used in translating the user needs and requirement for the project implementation. This document is important for the designer as a main guidance towards establishing project details. Research shown that problem usually arises from not well-defined scope and needs by the user. With lack of information the designer tend to assume and interprets wrong translation. Other issues arise from project management are time, cost, budgetary, lack of communication and establishing quality management. Some ideas of improvement were gain by doing cross reference with JKR quality system management, workshop and brainstorming. It shows that an improvement of data collection system has to be integrating with some basic format details, drawings and declaration forms to be established. (author)
DEFF Research Database (Denmark)
Pedersen, Keld
2016-01-01
for initiation. Most of the research on project selection is normative, suggesting new methods, but available empirical studies indicate that many methods are seldom used in practice. This paper addresses the issue by providing increased understanding of IT project selection practice, thereby facilitating...... the development of methods that better fit current practice. The study is based on naturalistic decision-making theory and interviews with experienced project portfolio managers who, when selecting projects, primarily rely on political skills, experience and personal networks rather than on formal IT project......-selection methods, and these findings point to new areas for developing new methodological support for IT project selection....
The role of project planning in project management
Klitsenko, A. I.; Клиценко, А. И.
2013-01-01
This article describes the importance of the process of project planning. The author gives irrefutable arguments concerning crucial role of project planning. This article presents the definition, objects and the main goal of project planning. The purpose of this article is to review such objects of project planning as project scope, risk and human resources. Данная статья описывает важность процесса проектного планирования. Автор дает неопровержимые доводы, касающиеся решающей роли проектн...
ASP project. Dissolved oxygen issues in ASP project
Directory of Open Access Journals (Sweden)
M.Y. Bondar
2018-03-01
Full Text Available The article presents the latest results of studies about the effect of dissolved oxygen on the efficiency of the ASP flooding project implemented by Salym Petroleum Development N.V.. Pilot project on experimental injection of anionic surfactant solutions, soda and polymer into the reservoir for enhanced oil recovery (ASP project has been implemented since 2016. The stability of one of the components of the ASP polymer is strongly dependent on the presence of iron, stiffness cations and dissolved oxygen in the water. Since the polymer is used for injection at two stages of the project, which are essential and the longest, at the design stage of ASP project a whole complex of polymer protection had been established against negative factors, in particular from the influence of oxygen, which causes not only oxygen corrosion but also irreversible destruction polymer chains. In the paper, studies on the stability of polymer solutions are described, an analysis of viscosity loss with time in the presence of iron and oxygen for polymer solutions is carried out. The choice of chemical deoxygenation method for the control of dissolved oxygen is substantiated. The program of laboratory studies of the ASP project and the analytical instruments used are described. The technological scheme of the ASP process is presented, and recommendations for the implementation of the technology are given.
Projective geometry and projective metrics
Busemann, Herbert
2005-01-01
The basic results and methods of projective and non-Euclidean geometry are indispensable for the geometer, and this book--different in content, methods, and point of view from traditional texts--attempts to emphasize that fact. Results of special theorems are discussed in detail only when they are needed to develop a feeling for the subject or when they illustrate a general method. On the other hand, an unusual amount of space is devoted to the discussion of the fundamental concepts of distance, motion, area, and perpendicularity.Topics include the projective plane, polarities and conic sectio
Projective measure without projective Baire
DEFF Research Database (Denmark)
Schrittesser, David; Friedman, Sy David
We prove that it is consistent (relative to a Mahlo cardinal) that all projective sets of reals are Lebesgue measurable, but there is a ∆13 set without the Baire property. The complexity of the set which provides a counterexample to the Baire property is optimal.......We prove that it is consistent (relative to a Mahlo cardinal) that all projective sets of reals are Lebesgue measurable, but there is a ∆13 set without the Baire property. The complexity of the set which provides a counterexample to the Baire property is optimal....
Project Planning and Implementation: Lessons Learned From the AQBMP Project
National Research Council Canada - National Science Library
1997-01-01
...). This NSRP report is funded as an addendum to the Air Quality Best Management Practices (AQBMP) project (N1 -944). The AQBMP project was completed using an intensive project planning process using a variety of quality management tools...
Surentheran, T; Harwood, C A; Spink, P J; Sinclair, A L; Leigh, I M; Proby, C M; McGregor, J M; Breuer, J
1998-01-01
AIM: To develop a unified diagnostic approach for the detection of human papillomavirus (HPV) DNA in skin and mucosal biopsies from both immunocompetent and immunosuppressed individuals using a degenerate polymerase chain reaction (PCR) method. METHODS: The sensitivity and specificity of three published degenerate primer sets (HVP2/B5 and F14/B15; MY09/MY11; CP62/69 outer and CP65/68 nested primer pairs) were evaluated in PCR reactions with serial dilutions of 12 representative cloned HPV typ...
Garc?a-Espinosa, Benjam?n; Nieto-Bona, Ma Paz; Rueda, Sonsoles; Silva-S?nchez, Lu?s Fernando; Piernas-Morales, Ma Concepci?n; Carro-Campos, Patricia; Cort?s-Lambea, Lu?s; Moro-Rodr?guez, Ernesto
2009-01-01
Abstract Background The HVP vaccine is a useful tool for preventing cervical cancer. The purpose of this study is to determine the most frequent HPV genotypes in Equatorial Guinea in order to develop future vaccination strategies to apply in this country. Methods A campaign against cervical cancer was carried out in the area on a total of 1,680 women. 26 of the women, following cytological screening, were treated surgically with a loop electrosurgical excision procedure (LEEP). Cases were stu...
One project's waste is another project's resource
International Nuclear Information System (INIS)
Short, J.
1997-01-01
The author describes the efforts being made toward pollution prevention within the DOE complex, as a way to reduce overall project costs, in addition to decreasing the amount of waste to be handled. Pollution prevention is a concept which is trying to be ingrained into project planning. Part of the program involves the concept that ultimately the responsibility for waste comes back to the generator. Parts of the program involve efforts to reuse materials and equipment on new projects, to recycle wastes to generate offsetting revenue, and to increase awareness, accountability and incentives so as to stimulate action on this plan. Summaries of examples are presented in tables
Ambidextrous Leadership and Sustainability-Based Project Performance: The Role of Project Culture
Directory of Open Access Journals (Sweden)
Junwei Zheng
2017-12-01
Full Text Available Most studies in the project management field emphasized the effects of leaders or managers, but these effects have rarely been examined at the project level. To cover this research gap, this study applies organizational ambidexterity theory to examine the effects among ambidextrous leadership, ambidextrous culture and sustainability-based project performance. Using a valid sample of 217 project leaders and members from Chinese construction projects, the method of multiple linear regression was adopted to assess the direct relationship among ambidextrous leadership, ambidextrous culture and project performance. Moreover, the bootstrapping technique through structural equation modeling, has been used to analyze the mediating effect of ambidextrous culture. Additionally, the sample data was divided into different groups according to the median value of the variables to conduct the ANOVA and to assess the within-group differences. The results indicated a positive and direct relationship that ambidextrous leadership has on project performance and ambidextrous culture. In addition, there was also a mediating impact of ambidextrous leadership on project performance via ambidextrous culture. Thus, ambidextrous leadership combined with transformational leadership as well as transactional leadership likely has a stronger positive impact on project performance through fostering the adaptive culture and consistent culture. Our findings contribute to an in-depth understanding of the role of the leader and culture for project outcomes. The project-based organization in construction projects could train project leaders’ ambidextrous leadership behavior to facilitate the formation of an ambidextrous culture and to increase project performance. Moreover, this study enriches the existing literature on leadership and project management by highlighting the important path of ambidextrous leadership and ambidextrous culture on the performance at the project level
Managing complex, high risk projects a guide to basic and advanced project management
Marle, Franck
2016-01-01
Maximizing reader insights into project management and handling complexity-driven risks, this book explores propagation effects, non-linear consequences, loops, and the emergence of positive properties that may occur over the course of a project. This book presents an introduction to project management and analysis of traditional project management approaches and their limits regarding complexity. It also includes overviews of recent research works about project complexity modelling and management as well as project complexity-driven issues. Moreover, the authors propose their own new approaches, new methodologies and new tools which may be used by project managers and/or researchers and/or students in the management of their projects. These new elements include project complexity definitions and frameworks, multi-criteria approaches for project complexity measurement, advanced methodologies for project management (propagation studies to anticipate potential behaviour of the project, and clustering approaches...
Managing a project's legacy: implications for organizations and project management
Cooper, Lynne P.; Hecht, Michael H.; Majchrzak, Ann
2003-01-01
Organizations that rely on projects to implement their products must find effective mechanisms for propagating lessons learned on one project throughout the organization. A broad view of what constitutes a project's 'legacy' is presented that includes not just the design products and leftover parts, but new processes, relationships, technology, skills, planning data, and performance metrics. Based on research evaluating knowledge reuse in innovative contexts, this paper presents an approach to project legacy management that focuses on collecting and using legacy knowledge to promote organizational learning and effective reuse, while addressing factors of post-project responsibility, information obsolescence, and the importance of ancillary contextual information. .
The Environmental Management Project Manager's Handbook for improved project definition
International Nuclear Information System (INIS)
1995-02-01
The United States Department of Energy (DOE) is committed to providing high quality products that satisfy customer needs and are the associated with this goal, DOE personnel must possess the knowledge, skills, and abilities to ensure successful job performance. In addition, there must be recognition that the greatest obstacle to proper project performance is inadequate project definition. Without strong project definition, DOE environmental management efforts are vulnerable to fragmented solutions, duplication of effort, and wastes resources. The primary means of ensuring environmental management projects meet cost and schedule milestones is through a structured and graded approach to project definition, which is the focus of this handbook
Lessons Learned from Client Projects in an Undergraduate Project Management Course
Pollard, Carol E.
2012-01-01
This work proposes that a subtle combination of three learning methods offering "just in time" project management knowledge, coupled with hands-on project management experience can be particularly effective in producing project management students with employable skills. Students were required to apply formal project management knowledge to gain…
Project management. A discipline which contributes to project success
International Nuclear Information System (INIS)
Hoch, G.
2008-01-01
The presentation covers the following topics: description of the Project - a contract was signed between KNPP and European Consortium Kozloduy (ECK) consisting of Framatome ANP GmbH as Leader (63%), Framatome ANP S.A.S. (17%), Atomenergoexport (20%) ; Project management in the modernization of NPP Kozloduy units 5 and 6; Project management process within AREVA NP GmbH; current status
Muir, Nancy C
2010-01-01
A friendly reference guide to Microsoft Project, the leading enterprise project management software. As project management software, Microsoft Project allows you to oversee your business activities effectively. You can manage resources, share project info, perform modeling and scenario analysis, and standardize reporting processes. This easy-to-understand guide is completely updated to cover the latest changes and newest enhancements to Project 2010 and shows you how to get Project 2010 to work for you. After an introduction to basic project management concepts, you'll discover the mechanics o
Next Generation Nuclear Plant Project Preliminary Project Management Plan
International Nuclear Information System (INIS)
Dennis J. Harrell
2006-01-01
This draft preliminary project management plan presents the conceptual framework for the Next Generation Nuclear Plant (NGNP) Project, consistent with the authorization in the Energy Policy Act of 2005. In developing this plan, the Idaho National Laboratory has considered three fundamental project planning options that are summarized in the following section. Each of these planning options is literally compliant with the Energy Policy Act of 2005, but each emphasizes different approaches to technology development risks, design, licensing and construction risks, and to the extent of commercialization support provided to the industry. The primary focus of this draft preliminary project management plan is to identify those activities important to Critical Decision-1, at which point a decision on proceeding with the NGNP Project can be made. The conceptual project framework described herein is necessary to establish the scope and priorities for the technology development activities. The framework includes: A reference NGNP prototype concept based on what is judged to be the lowest risk technology development that would achieve the needed commercial functional requirements to provide an economically competitive nuclear heat source and hydrogen production capability. A high-level schedule logic for design, construction, licensing, and acceptance testing. This schedule logic also includes an operational shakedown period that provides proof-of-principle to establish the basis for commercialization decisions by end-users. An assessment of current technology development plans to support Critical Decision-1 and overall project progress. The most important technical and programmatic uncertainties (risks) are evaluated, and potential mitigation strategies are identified so that the technology development plans may be modified as required to support ongoing project development. A rough-order-of-magnitude cost evaluation that provides an initial basis for budget planning. This
From Project Management to Process Management - Effectively Organising Transdisciplinary Projects
Moschitz, Heidrun
2013-01-01
In transdisciplinary projects, the roles of researchers change. In addition to being a source of knowledge, they are required to engage in knowledge exchange processes. This results in an alteration at project level: researchers need to creatively manage projects as group processes.
Marlim project finance; 'Project finance' de Marlim
Energy Technology Data Exchange (ETDEWEB)
D' Almeida, Albino Lopes [PETROBRAS, Rio de Janeiro, RJ (Brazil)
2004-07-01
Project Finance is often used worldwide to raise the funds to develop big projects, particularly in the area of power and infra-structure. It is designed to support a singular project and a specific purpose company is created to obtain the financing. The debt payment is secured by the enterprise's cash flow, avoiding real guarantee requirements. The lenders receive the future revenues and the property of the assets to be built. The risks are mitigated by agreements exhaustively negotiated among the parties. One of the most important Project Finances performed in Brazil is the Marlim Project, structured in order to complete the development of the Marlim oil field. This is the biggest Brazilian oil field, producing more than 500,000 barrels a day, almost 35% of the national production. This paper presents the general concepts related to this type of financing and general information about the project, including its structuring, negotiation and closing. The total commitment reaches US$ 1.5 billion obtained in both domestic and international markets through equity, bridge loan, bonds and commercial papers. Its whole life is 10 years, using 2 special purpose companies in its configuration. (author)
DEFF Research Database (Denmark)
Rolstadås, Asbjørn; Pinto, Jeffrey K.; Falster, Peter
2015-01-01
To add value to project performance and help obtain project success, a new framework for decision making in projects is defined. It introduces the project decision chain inspired by the supply chain thinking in the manufacturing sector and uses three types of decisions: authorization, selection......, and plan decision. A primitive decision element is defined where all the three decision types can be accommodated. Each task in the primitive element can in itself contain subtasks that in turn will comprise new primitive elements. The primitive elements are nested together in a project decision chain....
Project management with dynamic scheduling baseline scheduling, risk analysis and project control
Vanhoucke, Mario
2013-01-01
The topic of this book is known as dynamic scheduling, and is used to refer to three dimensions of project management and scheduling: the construction of a baseline schedule and the analysis of a project schedule's risk as preparation of the project control phase during project progress. This dynamic scheduling point of view implicitly assumes that the usability of a project's baseline schedule is rather limited and only acts as a point of reference in the project life cycle.
Pilot Project: analysis, development and projection
Tapia Abril, Verónica Emilia; Chérrez Rodas, Karina; García Pesántez, Gabriela Rosana; Maldonado Marchán, María Elisa; Bustamante Montesdeoca, José Luis
2014-01-01
Since the introduction of ICT in architecture and teaching, pedagogies of education have faced their learning paradigms change. Institutes of higher education have folded to this motion and have undergone a process of change by implementing multimedia elements in their subjects. Through the pilot project educational videos that aim to meet the highest standards of educational videos described by Van Dam have been developed. The project expects to generate educational videos for different depa...
Adaptation of Agile Project Management Methodology for Project Team
Directory of Open Access Journals (Sweden)
Rasnacis Arturs
2015-12-01
Full Text Available A project management methodology that defines basic processes, tools, techniques, methods, resources and procedures used to manage a project is necessary for effective and successful IT project management. Each company needs to define its own methodology or adapt some of the existing ones. The purpose of the research is to evaluate the possibilities of adapting IT project development methodology according to the company, company employee characteristics and their mutual relations. The adaptation process will be illustrated with a case study at an IT company in Latvia where the developed methodology is based on Agile Scrum, one of the most widespread Agile methods.
International Nuclear Information System (INIS)
Anon.
1979-01-01
An engineering project office was established during the fall of 1976 to manage and coordinate all of the activities of the Electron Beam Fusion Project. The goal of the project is to develop the Electron Beam Fusion Accelerator (EBFA) and its supporting systems, and integrate these systems into the new Electron Beam Fusion Facility (EBFF). Supporting systems for EBFA include a control/monitor system, a data acquistion/automatic data processing system, the liquid transfer systems, the insulating gas transfer systems, etc. Engineers and technicians were assigned to the project office to carry out the engineering design, initiate procurement, monitor the fabrication, perform the assembly and to assist the pulsed power research group in the activation of the EBFA
Traditional Project Management and the Visual Workplace Environment to Improve Project Success
Fichera, Christopher E.
2016-01-01
A majority of large IT projects fail to meet scheduled deadlines, are over budget and do not satisfy the end user. Many projects fail in spite of utilizing traditional project management techniques. Research of project management has not identified the use of a visual workspace as a feature affecting or influencing the success of a project during…
The project manager's desk reference: project planning, schedulding, evaluation, control, systems
National Research Council Canada - National Science Library
Lewis, James P
2007-01-01
In this Third Edition of The Project Manager's Desk Reference, top project management consultant James Lewis arms you with today's most comprehensive and understandable project management resources...
DEFF Research Database (Denmark)
Rasmussen, Troels A.; Merritt, Timothy R.
2017-01-01
CNC cutting machines have become essential tools for designers and architects enabling rapid prototyping, model-building and production of high quality components. Designers often cut from new materials, discarding the irregularly shaped remains. We introduce ProjecTables, a visual augmented...... reality system for interactive packing of model parts onto sheet materials. ProjecTables enables designers to (re)use scrap materials for CNC cutting that would have been previously thrown away, at the same time supporting aesthetic choices related to wood grain, avoiding surface blemishes, and other...... relevant material properties. We conducted evaluations of ProjecTables with design students from Aarhus School of Architecture, demonstrating that participants could quickly and easily place and orient model parts reducing material waste. Contextual interviews and ideation sessions led to a deeper...
DEFF Research Database (Denmark)
Demissew, Sebsebe; Brochmann, Christian; Kelbessa, Ensermu
2011-01-01
The account reviews and analyses the scietific projects derived from activities in connection with the Ethiopian Flora Project, including the [Ethiopian] Monocot Project, the Afro-alpine "Sky-island" project, the Vegetation and Ecological Conditions of Plantations Project, the Fire Ecology Projec...
International Nuclear Information System (INIS)
Perthuis, Ch. de
2005-06-01
The project mechanism complete the quotas systems concerning the carbon dioxide emissions market. The author explains and discusses these mechanisms and provides a panorama of the existing and developing projects. More specially she brings information on the mechanism of clean developments and renewable energies, the coordinated mechanisms, the agricultural projects, the financing of the projects and the exchange systeme of the New south Wales. (A.L.B.)
International Nuclear Information System (INIS)
Nagamiya, Shoji
2004-01-01
From Japanese fiscal year JFY01, which started on April 1, 2001, a new accelerator project to provide high-intensity proton beams proceeded into its construction phase. This project, which is now called the Japan Proton Accelerator Research Complex (J-PARC) project, is conducted under a cooperation of two institutions, KEK and Japan Atomic Energy Research Institution. We set a goal to achieve 1 MW proton beams at 3 GeV and 0.75 MW beams at 50 GeV. The project will be completed within six years, with the anticipated first beams in the spring of 2007. In this article I will describe (a) the project itself, (b) sciences to be pursued at this new accelerator complex and (c) the present status and future plans of the project
How to Grow Project Scientists: A Systematic Approach to Developing Project Scientists
Kea, Howard
2011-01-01
The Project Manager is one of the key individuals that can determine the success or failure of a project. NASA is fully committed to the training and development of Project Managers across the agency to ensure that highly capable individuals are equipped with the competencies and experience to successfully lead a project. An equally critical position is that of the Project Scientist. The Project Scientist provides the scientific leadership necessary for the scientific success of a project by insuring that the mission meets or exceeds the scientific requirements. Traditionally, NASA Goddard project scientists were appointed and approved by the Center Science Director based on their knowledge, experience, and other qualifications. However the process to obtain the necessary knowledge, skills and abilities was not documented or done in a systematic way. NASA Goddard's current Science Director, Nicholas White saw the need to create a pipeline for developing new projects scientists, and appointed a team to develop a process for training potential project scientists. The team members were Dr. Harley Thronson, Chair, Dr. Howard Kea, Mr. Mark Goldman, DACUM facilitator and the late Dr. Michael VanSteenberg. The DACUM process, an occupational analysis and evaluation system, was used to produce a picture of the project scientist's duties, tasks, knowledge, and skills. The output resulted in a 3-Day introductory course detailing all the required knowledge, skills and abilities a scientist must develop over time to be qualified for selections as a Project Scientist.
Something of value Governance of Projects in the Project-Based Organisation
DEFF Research Database (Denmark)
Riis, Eva
2013-01-01
The paper presents a conceptual framework for studying Governance of Projects and issues of value in the project-based organisation. Attempts at exploring and conceptualising the issues in the current literature are reviewed. Issues pertinent to gaining value by Governance of Projects have mainly...... for a better understanding of Governance of Projects and value contribution. The findings presented here form the conceptual foundation for subsequent empirical studies of value by Governance of Projects....... been explored from the perspective of economic theory. Models found in the literature are not typically concerned with value for the implementing organisation as a whole; their scope is limited to the time just after project completion. No valid, empirically-based models of value creation by Governance...
Underestimation of Project Costs
Jones, Harry W.
2015-01-01
Large projects almost always exceed their budgets. Estimating cost is difficult and estimated costs are usually too low. Three different reasons are suggested: bad luck, overoptimism, and deliberate underestimation. Project management can usually point to project difficulty and complexity, technical uncertainty, stakeholder conflicts, scope changes, unforeseen events, and other not really unpredictable bad luck. Project planning is usually over-optimistic, so the likelihood and impact of bad luck is systematically underestimated. Project plans reflect optimism and hope for success in a supposedly unique new effort rather than rational expectations based on historical data. Past project problems are claimed to be irrelevant because "This time it's different." Some bad luck is inevitable and reasonable optimism is understandable, but deliberate deception must be condemned. In a competitive environment, project planners and advocates often deliberately underestimate costs to help gain project approval and funding. Project benefits, cost savings, and probability of success are exaggerated and key risks ignored. Project advocates have incentives to distort information and conceal difficulties from project approvers. One naively suggested cure is more openness, honesty, and group adherence to shared overall goals. A more realistic alternative is threatening overrun projects with cancellation. Neither approach seems to solve the problem. A better method to avoid the delusions of over-optimism and the deceptions of biased advocacy is to base the project cost estimate on the actual costs of a large group of similar projects. Over optimism and deception can continue beyond the planning phase and into project execution. Hard milestones based on verified tests and demonstrations can provide a reality check.
Directory of Open Access Journals (Sweden)
Halyna V. Lutsenko
2015-02-01
Full Text Available The peculiarities of modern world experience of implementation of project-based learning in engineering education have been considered. The potential role and place of projects in learning activity have been analyzed. The methodology of organization of project-based activity of engineering students when studying the project management methodology and computer systems of project management has been proposed. The requirements to documentation and actual results of students' projects have been described in detail. The requirements to computer-aided systems of project management developed by using Microsoft Project in the scope of diary scheduling and resources planning have been formulated.
Influence of Selected Stakeholders of Construction Investment Projects on the Course of Project
Bizon-Górecka, Jadwiga; Górecki, Jarosław
2017-10-01
The article presents an entity perspective of the construction investment projects. In a course of the project there are stakeholders who have an indirect influence (e.g. decision-makers in the selection of projects) or a direct influence (e.g. members of the project team). An intuitive opinion about a significant influence of project stakeholders on the project’s course encouraged the authors to undertake a research in this area. The article illustrates the initial phases of the construction project life cycle in a perspective of the entities and, in particular, a role of different stakeholders in making decisions that affect a course of the project. An analysis of the structure of the construction project life cycle makes a substantial involvement of various subjects in the initial phases of the project, i.e. in an initial phase and during a creation of the structures. A key point is to underline the factors of decision-making by the participants of the construction process. It was indicated that the stakeholders have a different impact on the course of the project. In large projects, which have many stakeholders, their role in the implementation of the investment project can vary, depending on the life cycle of the project. They can have positive or negative impacts on achieving the project objectives. The paper presents the results of 100 surveys made among participants of the building processes, executors of the construction projects in the Kuyavian-Pomeranian region. The study was conducted in December 2016 and January 2017. It revealed what is the impact of individual stakeholders of the construction projects on the course of the project. A special attention was paid to a complex relationship between objectives of the project and stakeholders’ goals. A great care to the smallest possible number of risks, which may arise from the different objectives of the project and its stakeholders’ goals, should be focused on the augmentation of correlation of
Project Leadership and Quality Performance of Construction Projects
Directory of Open Access Journals (Sweden)
SPG Buba
2017-05-01
Full Text Available Background: The construction industry in Nigeria, is pigeonholed by poor quality of construction products as a result of the inherent corruption in the country. Lack of purposeful leadership and inappropriate choice of leadership styles in the industry have been attributed to project failure. Abandoned and failed projects are more predominant in the public sector which litters every corner of the country. Objectives: The objective of this paper is to assess the impact of leadership styles on quality performance criteria of public projects in Nigeria. Methodology: A total of 43 questionnaires were distributed to 3 key groups of respondents (Quantity Surveyors, Builders, and Architects who are project managers in Nigeria. Descriptive and Inferential statistics were used to analyse the data using the Statistical Package for Social Sciences (SPSS. Likert Scale was used to measure the independent variables (leadership style: facilitative, coaching, delegating and directing; and the level of achievement of projects based on the dependent variables (quality and function performance criteria which are: achieving highest aesthetic quality; and functional building that fits its purpose. Findings: The study revealed that Directing is the major leadership style used by project managers in Nigeria. Amongst the leadership styles which has the most impact on quality performance indicators is also directing which has the most relative influence on achieving highest aesthetic quality and functional building that fits its purpose. Conclusion/Recommendation/Way forward: The underlying relationship between Directing leadership styles and the performance criteria of achieving highest aesthetic quality and functional building that fits its purpose will be beneficial to the Nigerian construction environment.
ORGANIZATIONAL PROJECT MANAGEMENT MATURITY
Directory of Open Access Journals (Sweden)
Yana Derenskaya
2017-11-01
Full Text Available The present article is aimed at developing a set of recommendations for achieving a higher level of organizational project maturity at a given enterprise. Methodology. For the purposes of the current research, the available information sources on the components of project management system are analysed; the essence of “organizational maturity” and the existing models of organizational maturity are studied. The method of systemic and structural analysis, as well as the method of logical generalization, are employed in order to study the existing models of organizational maturity, to describe levels of organizational maturity, and finally to develop a set of methodological recommendations for achieving a higher level of organizational project maturity at a given enterprise. The results of the research showed that the core elements of project management system are methodological, organizational, programtechnical, and motivational components. Project management encompasses a wide range of issues connected with organizational structure, project team, communication management, project participants, etc. However, the fundamental basis for developing project management concept within a given enterprise starts with defining its level of organizational maturity. The present paper describes various models of organizational maturity (staged, continuous, petal-shaped and their common types (H. Кеrzner Organizational Maturity Model, Berkeley PM Maturity Model, Organizational Project Management Maturity Model, Portfolio, Program & Project Management Maturity Model. The analysis of available theoretic works showed that the notion “organizational project maturity” refers to the capability of an enterprise to select projects and manage them with the intention of achieving its strategic goals in the most effective way. Importantly, the level of maturity can be improved by means of formalizing the acquired knowledge, regulating project-related activities
Impact evaluation in multicultural educational projects : case: ADAPTYKES project
Kuusisto, Miika
2014-01-01
The objective of this thesis was to examine the common evaluation concepts of the European Union’s funded projects. Such concepts inter alia are effectiveness, impacts and sustainability. The aim was to study how these are realized in multicultural educational case–project in a context, where the project is funded by the European Commission’s Leonardo DaVinci Programme. Thesis introduces two evaluation approaches, which are Logical Framework Approach and Realistic evaluation model. The fi...
Role of quality assurance vs project manager's responsibility for waste projects
International Nuclear Information System (INIS)
Solecki, J.
1989-01-01
This paper takes a project manager's perspective and discusses the role of the quality assurance organization in the development, implementation and interface related to the QA program for waste projects. The author describes the role which the QA program plays in allowing project management to assure that the project manager knows what is placed in the repository and the characteristics of the surrounding environment meet closure requirements
U.S. Department of Health & Human Services — The BioProject database provides an organizational framework to access information about research projects with links to data that have been or will be deposited...
Mihalache Anita; Salagean Liana
2010-01-01
Project management is a technique that can aid in the planning, scheduling, and monitoring of complex projects characterized by numerous, non repetitive jobs called activities. Examples of projects that would use project management include: - developing a mass rapid – transit system for a metropolitan area; - organizing the relocation of a corporate headquarters; - planning the production of a concert, film, or play; - developing and marketing a new automobile; - constructing a high – rise of...
Energy Technology Data Exchange (ETDEWEB)
Harris, R
1978-08-01
Conventional cost/benefit or project analysis has generally not taken into account circumstances in which the project under consideration is large enough that its introduction to the economy would have significant general equilibrium effects. In this paper, rules are examined that would indicate whether such large projects should be accepted or rejected. The rules utilize information yielded by before-project and after-project equilibrium prices and production data. Rules are developed for the undistorted ''first-best'' case, the case in which the fixed costs of the project are covered by distortionary taxation, and for the case of projects producing public goods. 34 references.
[Detection of human papillomavirus (HVP)-DNA in oral manifestation of lichen planus].
Vesper, M; Riethdorf, S; Christoph, E; Ruthke, A; Schmelzle, R; Löning, T
1997-05-01
Human papilloma viruses (HPV) can be detected in different epithelia with the help of the polymerase chain reaction (PCR). The role of HPV in the development of anogenital cancers has been intensively studied, and current evidence shows that most cervical cancers are associated with so-called high risk HPV types (e.g. HPV 16 and 18). HPV-infections can also be demonstrated in oral premalignant lesions and squamous cell carcinomas. Depending on the sensitivity of the detection method, 40-67% of leukoplakias, 2.5-76% of squamous cell carcinomas and 0-87% of cases of lichen planus were described to be infected with HPV 16 or 18. Whether lichen planus can be considered as a premalignant lesion is still controversial. By the use of PCR and hybridization we found infections with the high risk HPV types 16, 18 and 31 in 42% (3/7) of the patients with lichen planus. Further investigations with a higher numbers of cases in combination with the analysis of the viral gene expression as well as the clinical and histological control of the corresponding regions are necessary. The aim of these studies is to find out the prognostic value of the HPV infection for this facultative premalignant disease.
Project management best practices: forging win-win partnerships and mitigating power project risk
International Nuclear Information System (INIS)
Trowsdale, R.
2006-01-01
This paper discusses aspects of project management to mitigate power project risk. end-to-end project development involves development phase, permitting phase, implementation phase, and operational phase. Each phase involves a number of different elements. In renewable energy project good management requires maintaining project discipline and schedule throughout all phases. Project success requires commercial competitiveness, fuel availability, power sales contracts, stake holder support, permitting, effective execution, construction and good technical performance
Harvard Project Physics Newsletter 10. The Project Physics Course, Text.
Harvard Univ., Cambridge, MA. Harvard Project Physics.
A short description of the availability of Harvard Project Physics course components is given as is a discussion of the growth of the use of Project Physics in schools, including some enrollment data and survey results. Locations of the 1970 and 1971 Summer Institutes are listed. Adaptations of Project Physics course outside the United States are…
Space Projects: Improvements Needed in Selecting Future Projects for Private Financing
1990-01-01
The Office of Management and Budget (OMB) and NASA jointly selected seven projects for commercialization to reduce NASA's fiscal year 1990 budget request and to help achieve the goal of increasing private sector involvement in space. However, the efforts to privately finance these seven projects did not increase the commercial sector's involvement in space to the extent desired. The General Accounting Office (GAO) determined that the projects selected were not a fair test of the potential of increasing commercial investment in space at an acceptable cost to the government, primarily because the projects were not properly screened. That is, neither their suitability for commercialization nor the economic consequences of seeking private financing for them were adequately evaluated before selection. Evaluations and market tests done after selection showed that most of the projects were not viable candidates for private financing. GAO concluded that projects should not be removed from NASA's budget for commercial development until after careful screening has been done to determine whether adequate commercial demand exists, development risks are commercially acceptable and private financing is found or judged to be highly likely, and the cost effectiveness of such a decision is acceptable. Premature removal of projects from NASA's budget ultimately can cause project delays and increased costs when unsuccessful commercialization candidates must be returned to the budget. NASA also needs to ensure appropriate comparisons of government and private financing options for future commercialization projects.
A new approach to cost effective projects: High performance project teams
International Nuclear Information System (INIS)
Chambers, N.C.
1994-01-01
In low oil price environment in which environmental conditions are more challenging, reservoir characteristics less favourable and political risk increasing, successful projects are required in such cases. The present paper deals with the visionary process of establishing high performance project teams. According to the author, such project teams embody dynamic recognition of holism. Holism is achieved as an output from the process of establishing the drivers and enablers for success on a project. They are given birth during the unfolding of the operators development plans and contracting strategy. The paper discusses the main drivers of project teams comprising purpose and performance goals, selection, common approach, commitment and accountability, and financial alignment
A new approach to cost effective projects: High performance project teams
Energy Technology Data Exchange (ETDEWEB)
Chambers, N.C. [Brown and Root Energy Services (United Kingdom)
1994-12-31
In low oil price environment in which environmental conditions are more challenging, reservoir characteristics less favourable and political risk increasing, successful projects are required in such cases. The present paper deals with the visionary process of establishing high performance project teams. According to the author, such project teams embody dynamic recognition of holism. Holism is achieved as an output from the process of establishing the drivers and enablers for success on a project. They are given birth during the unfolding of the operators development plans and contracting strategy. The paper discusses the main drivers of project teams comprising purpose and performance goals, selection, common approach, commitment and accountability, and financial alignment
Project Finance and Projects in the Energy Sector in Developing Countries
ERMELA KRIPA; HALIT XHAFA
2013-01-01
The purpose of this study is to show the importance of using project finance in infrastructure investments in developing countries. The paper will be focused only on one infrastructure sector, which is energy. Structurally, power project finance has involved largely buildown-transfer (BOT) project structures and long-term contracts. The projects largely reflect a rational allocation of risks among public and private participants. Private sponsors and lenders generally assume risks for complet...
Northcraft, Terry G.
2017-01-01
This qualitative study examined the effect the level of project management maturity a banking IT project sponsor has on project success. Project management maturity is gauged by the amount of modern project management training, knowledge and organizational skills an individual or organization has and applies to their project lifecycle experiences.…
International Nuclear Information System (INIS)
Adamson, M. G.
1997-01-01
The re-baseline of the Expedited Technology Demonstration Project (Revised Mixed Waste Facility Project) is designated as Project Baseline Revision 4.0. The last approved baseline was identified as Project Baseline Revision 3.0 and was issued in October 1996. Project Baseline Revision 4.0 does not depart from the formal DOE guidance followed by, and contained in, Revision 3.0. This revised baseline document describes the MSO and Final Forms testing activities that will occur during FY98, the final year of the ETD Project. The cost estimate for work during FY98 continues to be $2.OM as published in Revision 3.0. However, the funds will be all CENRTC rather than the OPEX/CENTRC split previously anticipated. LLNL has waived overhead charges on ETD Project CENRTC funds since the beginning of project activities. By requesting the $2.OM as all CENTRC a more aggressive approach to staffing and testing can be taken. Due to a cost under- run condition during FY97 procurements were made and work was accomplished, with the knowledge of DOE, in the Feed Preparation and Final Forms areas that were not in the scope of Revision 3.0. Feed preparation activities for FY98 have been expanded to include the drum opening station/enclosure previously deleted
Projects as value constellations
DEFF Research Database (Denmark)
Laursen, Markus
Creating value has been outlined as very central to projects applying the organizational perspective to projects. It has been suggested that value is created in value constellations or project networks, where actors work together to create value. However, research on the value creation process...... in value constellations is scarce, and through an exploratory study of two project networks in a cultural setting we investigate how value is created in value constellations. We outline how each project may be a distinct type of value constellation, one project creates value for the partners of the network...... as a consortium, and the project creates value primarily for others as a facilitator....
DEFF Research Database (Denmark)
Kuhn, Johan M.; Malchow-Møller, Nikolaj; Sørensen, Anders
In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two ...... important qualifications for the understanding of the contributions and results established in the project.......In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two...
Forecast Inaccuracies in Power Plant Projects From Project Managers' Perspectives
Sanabria, Orlando
Guided by organizational theory, this phenomenological study explored the factors affecting forecast preparation and inaccuracies during the construction of fossil fuel-fired power plants in the United States. Forecast inaccuracies can create financial stress and uncertain profits during the project construction phase. A combination of purposeful and snowball sampling supported the selection of participants. Twenty project managers with over 15 years of experience in power generation and project experience across the United States were interviewed within a 2-month period. From the inductive codification and descriptive analysis, 5 themes emerged: (a) project monitoring, (b) cost control, (c) management review frequency, (d) factors to achieve a precise forecast, and (e) factors causing forecast inaccuracies. The findings of the study showed the factors necessary to achieve a precise forecast includes a detailed project schedule, accurate labor cost estimates, monthly project reviews and risk assessment, and proper utilization of accounting systems to monitor costs. The primary factors reported as causing forecast inaccuracies were cost overruns by subcontractors, scope gaps, labor cost and availability of labor, and equipment and material cost. Results of this study could improve planning accuracy and the effective use of resources during construction of power plants. The study results could contribute to social change by providing a framework to project managers to lessen forecast inaccuracies, and promote construction of power plants that will generate employment opportunities and economic development.
Risks management in project planning
Stankevičiūtė, Roberta
2017-01-01
Project management consists of two very important aspects – managing the right project and managing the project right. To know that you are managing the right project you need to ensure that your project is based on an actual requirement and that your project goal is relevant and beneficial. And professional project planning assists in managing project the right way. The project planning process is very time consuming and is one of the most important parts of the project management process. T...
FME Senior Project Managers: A Juggling Act of Multiple Projects | Poster
By Peggy Pearl, Contributing Writer It was not until the 1950s that organizations in the United States began to apply project management tools and techniques to complex construction and engineering projects (http://en.m.wikipedia.org/wiki/Project_life_cycle).
Jr., R. F. Miles
1995-01-01
Project risk management is primarily concerned with performance, reliability, cost, and schedule. Environmental risk management is primarily concerned with human health and ecological hazards and likelihoods. This paper discusses project risk management and compares it to environmental risk management, both with respect to goals and implementation. The approach of the Jet Propulsion Laboratory to risk management is presented as an example of a project risk management approach that is an extension to NASA NHB 7120.5: Management of Major System Programs and Projects.
International Nuclear Information System (INIS)
Clark, J.; Limbrick, A.
1996-01-01
This paper identifies and reviews the issues to be addressed and the procedures to be followed during the mobilisation of projects using LFG as an energy source. Knowledge of the procedures involved in project mobilisation, their sequence and probable timescales, is essential for efficient project management. It is assumed that the majority of projects will be situated on existing, licensed landfill sites and, in addition to complying with the relevant conditions of the waste management licence and original planning consent, any proposed developments on the site will require a separate planning consent. Experience in the UK indicates that obtaining planning permission rarely constitutes a barrier to the development of schemes for the utilisation of LFG. Even so, an appreciation of the applicable environmental and planning legislation is essential as this will enable the developer to recognise the main concerns of the relevant planning authority at an early stage of the project, resulting in the preparation of an informed and well-structured application for planning permission. For a LFG utilisation scheme on an existing landfill site, the need to carry out an environmental assessment (EA) as part of the application for planning permission will, in vitually all cases, be discretionary. Even if not deemed necessary by the planning authority, an EA is a useful tool at the planning application stage, to identify and address potential problems and to support discussions with bodies such as the Environment Agency, from whom consents or authorisations may be required. Carrying out an EA can thus provide for more cost-effective project development and enhanced environmental protection. Typically, the principal contractual arrangements, such as the purchase of gas or the sale of electricity, will have been established before the project mobilisation phase. However, there are many other contractural arrangements that must be established, and consents and permits that may be
Project network-oriented materials management policy for complex projects
DEFF Research Database (Denmark)
Dixit, Vijaya; Srivastava, Rajiv K; Chaudhuri, Atanu
2015-01-01
This work devises a materials management policy integrated with project network characteristics of complex projects. It proposes a relative quantitative measure, overall criticality (OC), for prioritisation of items based on penalty incurred due to their non-availability. In complex projects...... managerial tacit knowledge which provides them enough flexibility to provide information in real form. Computed OC values can be used for items prioritisation and as shortage cost coefficient in inventory models. The revised materials management policy was applied to a shipbuilding project. OC values were......, practicing managers find it difficult to measure OC of items because of the subjective factors and intractable nature of penalties involved. However, using their experience, they can linguistically identify the antecedents and relate them to consequent OC. This work adopts Fuzzy Set Theory to capture...
DEFF Research Database (Denmark)
Pemsel, Sofia; Wiewiora, Anna
This research investigates the development of project competence, and particularly, three related dynamic capabilities (shifting, adapting, leveraging) that contribute to project competence development. In doing so, we make use of the emerging literature on knowledge governance and theorize how...... of dynamic capability building promoting project competence development....
Organizations, projects and culture
J. van Cleeff; Pieter van Nispen tot Pannerden
2016-01-01
Purpose: to explore and demonstrate the effects of organizational culture on projects, in particular project culture and project management style. Methodology/approach: descriptive and explorative; through students’ groups. Findings: the cultural relationship between organizations, their projects
The Impact of Project Management Maturity upon IT/IS Project Management Outcomes
Carcillo, Anthony Joseph, Jr.
2013-01-01
Although it is assumed that increasing the institutionalization (or maturity) of project management in an organization leads to greater project success, the literature has diverse views. The purpose of this mixed methods study was to examine the correlation between project management maturity and IT/IS project outcomes. The sample consisted of two…
Photovoltaic demonstration projects
Energy Technology Data Exchange (ETDEWEB)
Kaut, W [Commission of the European Communities, Brussels (Belgium); Gillett, W B; Hacker, R J [Halcrow Gilbert Associates Ltd., Swindon (GB)
1992-12-31
This publication, comprising the proceedings of the fifth contractor`s meeting organized by the Commission of the European Communities, Directorate-General for Energy, provides an overview of the photovoltaic demonstration projects which have been supported in the framework of the energy demonstration programme since 1983. It includes reports by each of the contractors who submitted proposals in 1987 and 1988, describing progress within their projects. Projects accepted from earlier calls for proposals and not yet completed were reviewed by a rapporteur and are discussed in the summary section. The results of the performance monitoring of all projects and the lessons drawn from the practical experience of the projects are also presented in the summaries and conclusions. Contractors whose projects were submitted in 1989 were also present at the meeting and contributed to the reported discussions. This proceeding is divided into four sessions (General, Housing, technical presentations, other applications) and 24 papers are offered.
Knowledge Management in a Project Environment: Organisational CT and Project Influences
Polyaninova, Taya
2011-01-01
During a project implementation various forms of information and experience are generated within the organization. If this accumulated knowledge is not recorded and shared amongst other projects, this knowledge will be lost and no longer be available to assist future projects. This may lead to increased future projects costs as resources, time and money will be wasted on redefining the knowledge that once existed within the company. By not capturing and redeploying this knowledge, the quality...
Using Project Complexity Determinations to Establish Required Levels of Project Rigor
Energy Technology Data Exchange (ETDEWEB)
Andrews, Thomas D.
2015-10-01
This presentation discusses the project complexity determination process that was developed by National Security Technologies, LLC, for the U.S. Department of Energy, National Nuclear Security Administration Nevada Field Office for implementation at the Nevada National Security Site (NNSS). The complexity determination process was developed to address the diversity of NNSS project types, size, and complexity; to fill the need for one procedure but with provision for tailoring the level of rigor to the project type, size, and complexity; and to provide consistent, repeatable, effective application of project management processes across the enterprise; and to achieve higher levels of efficiency in project delivery. These needs are illustrated by the wide diversity of NNSS projects: Defense Experimentation, Global Security, weapons tests, military training areas, sensor development and testing, training in realistic environments, intelligence community support, sensor development, environmental restoration/waste management, and disposal of radioactive waste, among others.
Project time boxing and milestones as drivers for open design projects
DEFF Research Database (Denmark)
Tollestrup, Christian H. T.
2015-01-01
is very positive and that the structure, strict enforcement and rolling project management responsibility in a group work setting really helps them drive the project forward with high motivation. The main challenge lies in the balance between loading the teams with too many challenges and just providing......The Curriculums and programs in Problem Based Learning (PBL) utilizes the project-format in a team based setting for rehearsing the competencies of applying the design-oriented skills and knowledge learned in courses and workshops. If the project period is self-organised, there is a tendency......, because of the facilitated format where ‘disturbances’ are eliminated. If successful the state of creative flow is achieved. So how can we create a sense of urgency in longer project periods, not just workshop format, that would help a team of design students to engage and drive the project from the start...
DEFF Research Database (Denmark)
Illerup, J. B.; Birr-Pedersen, K.; Mikkelsen, M. H
Models for projection of SO2-, NOx-, NMVOC- and NH3-emissions to the atmosphere have been developed and the Danish emissions have been projected until 2010 from a basis scenario including all implemented and planned measures. The projections of the four pollutants indicate that it may be difficult...
Heintz, John Linke; Lousberg, L.; Wamelink, J.W.F.; Saari, A.; Huovinen, P.
2016-01-01
In this paper we introduce the concept of Designing Project Management. On the basis of our earlier work, we suggest that there is still a gap between what is known from recent project management literature and what project managers can structurally help in the effectiveness of their work. Assuming
Changing project finance climate; Project finance wo meguru kankyo henka
Energy Technology Data Exchange (ETDEWEB)
Madono, S. [The Export-Import Bank of Japan, Tokyo (Japan)
1998-03-01
Development of conditions under which project financing (PF) functions is described. PF, a method with which funds are procured for a project on the security of the assets of and the cash flow involving the project, established its position as a popular financial means. Into the 1990, however, PF underwent a complete change, when it came to be actively employed as a means for the procurement of money for what is called `infrastructure building project for invigorating the private sector` in the developing countries. PF has now come to be utilized for the financing of projects in various fields besides the field of resources exploitation. In particular, PF is now utilized in schemes such as BOT (build, operate, transfer) in public enterprises, for instance, electric power utilities in developing countries. The gravest problem found in the private sector invigorating type PF is that the sponsor, operator, exporter, and lender on their respective levels are experiencing rising risks because of intensified competition in the presence of a great number of projects. Such risks involve the exchange rate, the completion of work, and the relations between the borrower and operator. 2 figs.
Ranking the Project Management Success Factors for Construction Project in South India
Aneesha, K.; Haridharan, M. K.
2017-07-01
In Today’s construction industry, to achieve a greater advantage over the firms, success of each project and efficiency is required. Effective Project Management overcomes these types of challenges. This study identifies the success factors which are important for project management in construction project success. From the literature review, 26 factors were found to be critical. Project managers, construction managers, civil engineers, contractors and site engineers were the respondents. After analyzing the data in SPSS software, the dominant factors from the regression analysis are top management support, competent project team, abilities to solve problems, realistic cost and time estimates, information/communication, competency of the project manager are the 6 factors out of 12 in 26 factors. Effective communication between stakeholders got highest priority and client involvement, good leadership, clarity of project goals got second priority. Informal communication gives better results compared to formal communications like written formats. To remove communication barrier with the stakeholders, informal communication like speaking face-to-face with the language this fits for the stakeholders.
Project plan remove special nuclear material from PFP project plutonium finishing plant
International Nuclear Information System (INIS)
BARTLETT, W.D.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Remove Special Nuclear Material (SNM) Materials. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617, Rev. 0. This project plan is the top-level definitive project management document for PFP Remove SNM Materials project. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Remove SNM Materials project. Any deviations to the document must be authorized through the appropriate change control process
Fast Flux Test Facility, Sodium Storage Facility project-specific project management plan
International Nuclear Information System (INIS)
Shank, D.R.
1994-01-01
This Project-Specific Project Management Plan describes the project management methods and controls used by the WHC Projects Department to manage Project 03-F-031. The Sodium Storage Facility provides for storage of the 260,000 gallons of sodium presently in the FFTF Plant. The facility will accept the molten sodium transferred from the FFTF sodium systems, and store the sodium in a solid state under an inert cover gas until such time as a Sodium Reaction Facility is available for final disposal of the sodium
Fast Flux Test Facility, Sodium Storage Facility project-specific project management plan
Energy Technology Data Exchange (ETDEWEB)
Shank, D.R.
1994-12-29
This Project-Specific Project Management Plan describes the project management methods and controls used by the WHC Projects Department to manage Project 03-F-031. The Sodium Storage Facility provides for storage of the 260,000 gallons of sodium presently in the FFTF Plant. The facility will accept the molten sodium transferred from the FFTF sodium systems, and store the sodium in a solid state under an inert cover gas until such time as a Sodium Reaction Facility is available for final disposal of the sodium.
Pedrini, D. T.; Pedrini, Bonnie C.
Sigmund Freud and his associates did much clinical work with the dynamic of projection, especially with regard to paranoid symptoms and syndromes. Much experimental work has also been done with projection. Sears evaluated the results of some of those studies. Murstein and Pryer sub-classified projection and reviewed typical studies. The…
Project Communications Management
José C. Santiago-Guevara; Mauricio Rojas-Contreras; Luis A. Esteban-Villamizar
2013-01-01
This article presents a review in relation to the object of study: Communications Management as an important factor in the management of projects. The review includes the most relevant and most renowned authors in the field of project management, focusing on telecommunications projects, which lets you define a communications management model.
Teaching supply chain management through global projects with global project teams
Kopczak, L.R.; Fransoo, J.C.
2000-01-01
In this article, we describe the Global Project Coordination Course, a course in which project teams composed of three students from each of two overseas universities execute company-sponsored projects dealing with global supply chain management issues. The $75,000 to $100,00 contributed in total by
International Nuclear Information System (INIS)
Shibuya, E.H.
1989-01-01
The OMEGA - Observation of Multiple particle production, Exotic Interactions and Gamma-ray Air Shower-project is presented. The project try to associate photosensitive detectors from experiences of hadronic interactions with electronic detectors used by experiences that investigate extensive atmospheric showers. (M.C.K.)
Project Hanford management contract quality improvement project management plan; TOPICAL
International Nuclear Information System (INIS)
ADAMS, D.E.
1999-01-01
On July 13, 1998, the U.S. Department of Energy, Richland Operations Office (DOE-RL) Manager transmitted a letter to Fluor Daniel Hanford, Inc. (FDH) describing several DOE-RL identified failed opportunities for FDH to improve the Quality Assurance (QA) Program and its implementation. In addition, DOE-RL identified specific Quality Program performance deficiencies. FDH was requested to establish a periodic reporting mechanism for the corrective action program. In a July 17, 1998 response to DOE-RL, FDH agreed with the DOE concerns and committed to perform a comprehensive review of the Project Hanford Management Contract (PHMC) QA Program during July and August, 1998. As a result, the Project Hanford Management Contract Quality Improvement Plan (QIP) (FDH-3508) was issued on October 21, 1998. The plan identified corrective actions based upon the results of an in-depth Quality Program Assessment. Immediately following the scheduled October 22, 1998, DOE Office of Enforcement and Investigation (EH-10) Enforcement Conference, FDH initiated efforts to effectively implement the QIP corrective actions. A Quality Improvement Project (QI Project) leadership team was assembled to prepare a Project Management Plan for this project. The management plan was specifically designed to engage a core team and the support of representatives from FDH and the major subcontractors (MSCs) to implement the QIP initiatives; identify, correct, and provide feedback as to the root cause for deficiency; and close out the corrective actions. The QI Project will manage and communicate progress of the process
Pries, Kim H
2010-01-01
Scrum, which was originally invented solely for software development, can now be applied to all types of projects. This book shows project managers how to implement Scrum by explaining the artifacts, rituals, and roles used. The text provides Scrum planning methods to control project scope and schedule as well as Scrum tracking methods to focus teams on improving throughput and streamlining communications. The authors show how to combine traditional project methods with Scrum and how to adapt the familiar work breakdown structure to create Scrum backlogs and sprints. They also demonstrate how
Momentum projection and relativistic boost of solitons: Coherent states and projection
International Nuclear Information System (INIS)
Luebeck, E.G.; Birse, M.C.; Henley, E.M.; Wilets, L.
1986-01-01
We present a method for calculating center-of-mass corrections to hadron properties in soliton models and we apply the method to the soliton bag model. A coherent state is used to provide a quantum wave function corresponding to the mean-field approximation. This state is projected onto a zero-momentum eigenstate. States of nonzero momentum can be constructed from this with a Lorentz boost operator. Hence center-of-mass corrections can be made in a properly relativistic way. The energy of the projected zero-momentum state is the hadron mass with spurious center-of-mass energy removed. We apply a variational principle to our projected state and use three ''virial theorems'' to test our approximate solution. We also study projection of general one-mode states. Projection reduces the nucleon energy by up to 25%. Variation after projection gives a further reduction of less than 20%. Somewhat larger reductions in the energy are found for meson states
Directory of Open Access Journals (Sweden)
Neira Oviedo MV
2011-04-01
Full Text Available Marco V Neira Oviedo1,2, William S Romoser1, Calvin BL James1, Farida Mahmood3, William K Reisen31Tropical Disease Institute, Department of Biomedical Sciences, College of Osteopathic Medicine, Ohio University, Athens, OH, USA; 2Oxitec Inc, Oxford, England; 3Center for Vectorborne Diseases, School of Veterinary Medicine, University of California, Davis, CA, USABackground: Vector competence describes the efficiency with which vector arthropods become infected with and transmit pathogens and depends on interactions between pathogen and arthropod genetics as well as environmental factors. For arbovirus transmission, the female mosquito ingests viremic blood, the virus infects and replicates in midgut cells, escapes from the midgut, and disseminates to other tissues, including the salivary glands. Virus-laden saliva is then injected into a new host. For transmission to occur, the virus must overcome several "barriers", including barriers to midgut infection and/or escape and salivary infection and/or escape. By examining the spatial/temporal infection dynamics of Culex tarsalis strains infected with western equine encephalomyelitis virus (WEEV, we identified tissue tropisms and potential tissue barriers, and evaluated the effects of viral dose and time postingestion.Methods: Using immuno-stained paraffin sections, WEEV antigens were tracked in four Cx. tarsalis strains: two recently colonized California field strains – Coachella Valley, Riverside County (COAV and Kern National Wildlife Refuge (KNWR; and two laboratory strains selected for WEEV susceptibility (high viremia producer, HVP, and WEEV resistance (WR.Results and conclusions: Tissues susceptible to WEEV infection included midgut epithelium, neural ganglia, trachea, chorionated eggs, and salivary glands. Neuroendocrine cells in the retrocerebral complex were occasionally infected, indicating the potential for behavioral effects. The HVP and COAV strains vigorously supported viral growth
2001-01-01
As business environments become increasingly competitive, companies seek more comprehensive solutions to the delivery of their projects. "Project Delivery System: Fourth Edition" describes the process-driven project delivery systems which incorporates the best practices from Total Quality and is aligned with the Project Management Institute and ISO Quality Standards is the means by which projects are consistently and efficiently planned, executed and completed to the satisfaction of clients and customers.
Project management case studies
Kerzner, Harold R
2013-01-01
A new edition of the most popular book of project management case studies, expanded to include more than 100 cases plus a ""super case"" on the Iridium Project Case studies are an important part of project management education and training. This Fourth Edition of Harold Kerzner''s Project Management Case Studies features a number of new cases covering value measurement in project management. Also included is the well-received ""super case,"" which covers all aspects of project management and may be used as a capstone for a course. This new edition:Contains 100-plus case studies drawn from re
Your Project Management Coach Best Practices for Managing Projects in the Real World
Biafore, Bonnie
2012-01-01
A pragmatic approach to project management Many projects fail to deliver on time or on budget, or even to deliver a workable product that satisfies the customer. While good project management goes a long way towards ensuring success, managers often fail to follow the plans they implement. This unique guide helps you understand and successfully handle project management, once and for all. Covering practical ways to solve problems you'll typically face when managing actual projects, this pragmatic book takes you through a full project management lifecycle. You'll find ample tips, tricks, and bes
DEFF Research Database (Denmark)
Lund Pedersen, Carsten; Ritter, Thomas; Andersen, Torben Juul
This paper proposes the adoption of a project-based view to analyze strategy formation and strategic renewal over time. Projects are resource-committing, empirically-tracable investments, and as such, particularly suitable for the analysis of different manifestations of intended strategies as well...... as post-hoc manifestations of deviant, even rebellious, actions taken in opposition to the initial strategy announcement. The paper presents an analytical framework (a 5x2 matrix) of ten different project categories that together allows researchers to investigate how strategic renewal is realized through...... the enactment of different types of project initiatives throughout the organization. The developed framework is validated by two field studies that outline the robustness of the proposed matrix. In addition to the demonstration of the advantages of the framework, we discuss the limitations of the strategy-as-projects...
Project quality assurance plant: Sodium storage facility, project F-031
International Nuclear Information System (INIS)
Shultz, J.W.; Shank, D.R.
1994-11-01
The Sodium Storage Facility Project Quality Assurance Plan delineates the quality assurance requirements for construction of a new facility, modifications to the sodium storage tanks, and tie-ins to the FFTF Plant. This plan provides direction for the types of verifications necessary to satisfy the functional requirements within the project scope and applicable regulatory requirements determined in the Project Functional Design Criteria (FDC), WHC-SD-FF-FDC-009
Bi-project management in engineering complex industrial construction projects
Velde, Robert R. van der; Donk, Dirk Pieter van
2000-01-01
Engineering large industrial construction projects is usually a complex task with several co-operating actors. This paper investigates such projects, characterised by two main actors: the owner of the installation (the client organisation) responsible for the engineering of the production process,
Chivatá Cárdenas, Ibsen; Voordijk, Johannes T.; Dewulf, Geert
2017-01-01
A new project governance model for infrastructure projects is described in this paper. This model contains causal mechanisms that relate a number of project governance variables to project performance. Our proposed model includes relevant variables for measuring project governance in construction
2011-01-01
Background Project management is widely used to deliver projects on time, within budget and of defined quality. However, there is little published information describing its use in managing health and medical research projects. We used project management in the Alcohol and Pregnancy Project (2006-2008) http://www.ichr.uwa.edu.au/alcoholandpregnancy and in this paper report researchers' opinions on project management and whether it made a difference to the project. Methods A national interdisciplinary group of 20 researchers, one of whom was the project manager, formed the Steering Committee for the project. We used project management to ensure project outputs and outcomes were achieved and all aspects of the project were planned, implemented, monitored and controlled. Sixteen of the researchers were asked to complete a self administered questionnaire for a post-project review. Results The project was delivered according to the project protocol within the allocated budget and time frame. Fifteen researchers (93.8%) completed a questionnaire. They reported that project management increased the effectiveness of the project, communication, teamwork, and application of the interdisciplinary group of researchers' expertise. They would recommend this type of project management for future projects. Conclusions Our post-project review showed that researchers comprehensively endorsed project management in the Alcohol and Pregnancy Project and agreed that project management had contributed substantially to the research. In future, we will project manage new projects and conduct post-project reviews. The results will be used to encourage continuous learning and continuous improvement of project management, and provide greater transparency and accountability of health and medical research. The use of project management can benefit both management and scientific outcomes of health and medical research projects. PMID:21635721
The Impact of Project Organizational Culture on the Performance of Construction Projects
Directory of Open Access Journals (Sweden)
Luong Hai Nguyen
2017-05-01
Full Text Available Cultural influence has recently received significant attention from academics due to its vital role in the success or failure of a project. In the construction industry, several empirical investigations have examined the influence of culture on project management. The aim of this study is to determine the impact of project organizational culture on the performance of construction projects. A total of 199 completed construction projects in Vietnam with specific data gathering through questionnaires were analyzed. The findings reveal that contractor commitment to contract agreements is the most significant cultural factor affecting project performance. Goal alignment and reliance, contractor commitment, and worker orientation (i.e., commitment to workers contribute to improved overall performance and participant satisfaction. Contractor commitment and cooperative orientation enhance labor productivity, whereas goal alignment and trust and contractor commitment ensure learning performance (i.e., learning from experience. The findings of this study may assist construction professionals in implementing practices that can contribute to the sustainability and success of construction projects.
Project of the Year Submittal SY-101 Surface Level Rise Remediation Project
International Nuclear Information System (INIS)
BAUER, R.E.
2001-01-01
CH2M HILL Hanford Group is pleased to nominate the SY-101 Surface Level Rise Remediation Project (SLRRP) for the Project Management Institute's consideration as International Project of the Year for 2001. We selected this project as being our best recent example of effective project management, having achieved and exceeded our client's expectations in resolving urgent safety issues related to the storage of high level nuclear waste. In reflection, we consider the SY-101 SLRRP to be a prime example of safe and effective project delivery. The pages that follow present the tools and techniques employed to manage this complex and technically challenging project. Our objective in submitting this nomination is twofold--to share the lessons we have learned with other organizations, and to honor the men and women who contributed to this endeavor. It was by their diligent effort that the successes we relate here were accomplished 10 months ahead of schedule and one million dollars below the authorized budget
International Nuclear Information System (INIS)
Delahaye, J.P.
2010-01-01
There is large number of ambitious accelerator projects with promising performances in the near (and short term) future which aims at exploring energy and/or luminosity frontiers and Complementary aspects of various particles species. High Energy Physics requirements are extremely demanding with challenging parameters: entering into the new territories of the tera-scale data, high Energy or/and High (Integrated) Luminosity, high performance, high availability, long lifetime, luminosity leveling etc.. New projects are more and more challenging: larger, more powerful, more expensive, technology above present standard. Innovative ideas and breakthrough on novel technologies are key for HEP adventure. Aggressive R and D is imperative on beam and Technology related, on cost and power consumption mitigation.. There is ambitious Test Facilities to address feasibility. More and more time and (M and P) resources are required from first ideas to project proposal: it is of prime importance to launch R and D early, explore all possible options of schemes and technologies (anticipating future Physics requests), make realistic status and schedule estimates (preserve credibility and make reasonable plans). Global Collaboration is mandatory from the R and D phase to the construction and operation in order to make best use of limited resources and available expertise as inspired from successful collaborations on Detectors. The global strategy of new accelerator projects in truly world-wide collaboration aims at: - defining all various Projects and Technology options worth exploring, - taking advantage of global teams made of world-wide experts, and of synergies to address common issues (generic R and D) of various projects, - preparing together plethora of project proposals to cover Physics Landscape (ready for window opportunity), - developing Collaborative/Competition (Experts in Collaboration, Technology and Projects options in Competition), - Joining resources on (few) selected
Oil pipeline performance review 1995, 1996, 1997, 1998 : Technical/statistical report
International Nuclear Information System (INIS)
2000-12-01
This document provides a summary of the pipeline performance and reportable pipeline failures of liquid hydrocarbon pipelines in Canada, for the years 1995 through 1998. The year 1994 was the last one for which the Oil Pipeline Performance Review (OPPR) was published on an annual basis. The OPPR will continue to be published until such time as the Pipeline Risk Assesment Sub-Committee (PRASC) has obtained enough pipeline failure data to be aggregated into a meaningful report. The shifts in the mix of reporting pipeline companies is apparent in the data presented, comparing the volumes transported and the traffic volume during the previous ten-year period. Another table presents a summary of the failures which occurred during the period under consideration, 1995-1998, allowing for a comparison with the data for the previous ten-year period. From the current perspective and from an historical context, this document provides a statistical review of the performance of the pipelines, covering refined petroleum product pipelines, clean oil pipelines and High Vapour Pressure (HVP) pipelines downstream of battery limits. Classified as reportable are spills of 1.5 cubic metre or more of liquid hydrocarbons, any amount of HVP material, any incident involving an injury, a death, a fire, or an explosion. For those companies that responded to the survey, the major items, including number of failures and volumes released are accurate. Samples of the forms used for collecting the information are provided within the document. 6 tabs., 1 fig
Cacchioli, Antonio; Ravanetti, Francesca; Bagno, Andrea; Dettin, Monica; Gabbi, Carlo
2009-10-01
Peptide and protein exploitation for the biochemical functionalization of biomaterial surfaces allowed fabricating biomimetic devices able to evoke and promote specific and advantageous cell functions in vitro and in vivo. In particular, cell adhesion improvement to support the osseointegration of implantable devices has been thoroughly investigated. This study was aimed at checking the biological activity of the (351-359) human vitronectin precursor (HVP) sequence, mapped on the human vitronectin protein; the peptide was covalently linked to the surface of titanium cylinders, surgically inserted in the femurs of New Zealand white rabbits and analyzed at short experimental time points (4, 9, and 16 days after surgery). To assess the osteogenic activity of the peptide, three vital fluorochromic bone markers were used (calcein green, xylenol orange, and calcein blue) to stain the areas of newly grown bone. Static and dynamic histomorphometric parameters were measured at the bone-implant interface and at different distances from the surface. The biological role of the (351-359)HVP sequence was checked by comparing peptide-grafted samples and controls, analyzing how and how much its effects change with time across the bone regions surrounding the implant surface. The results obtained reveal a major activity of the investigated peptide 4 days after surgery, within the bone region closest to the implant surface, and larger bone to implant contact 9 and 16 days after surgery. Thus, improved primary fixation of endosseous devices can be foreseen, resulting in an increased osteointegration.
Mapping EBNA-1 Domains Involved in Binding to Metaphase Chromosomes
Marechal, Vincent; Dehee, Axelle; Chikhi-Brachet, Roxane; Piolot, Tristan; Coppey-Moisan, Maité; Nicolas, Jean-Claude
1999-01-01
The Epstein-Barr virus (EBV) genome can persist in dividing human B cells as multicopy circular episomes. Viral episomes replicate in synchrony with host cell DNA and are maintained at a relatively constant copy number for a long time. Only two viral elements, the replication origin OriP and the EBNA-1 protein, are required for the persistence of viral genomes during latency. EBNA-1 activates OriP during the S phase and may also contribute to the partition and/or retention of viral genomes during mitosis. Indeed, EBNA-1 has been shown to interact with mitotic chromatin. Moreover, viral genomes are noncovalently associated with metaphase chromosomes. This suggests that EBNA-1 may facilitate the anchorage of viral genomes on cellular chromosomes, thus ensuring proper partition and retention. In the present paper, we have investigated the chromosome-binding activity of EBV EBNA-1, herpesvirus papio (HVP) EBNA-1, and various derivatives of EBV EBNA-1, fused to a variant of the green fluorescent protein. The results show that binding to metaphase chromosomes is a common property of EBV and HVP EBNA-1. Further studies indicated that at least three independent domains (CBS-1, -2, and -3) mediate EBNA-1 binding to metaphase chromosomes. In agreement with the anchorage model, two of these domains mapped to a region that has been previously demonstrated to be required for the long-term persistence of OriP-containing plasmids. PMID:10196336
The happy victimizer phenomenon: Not found here
Directory of Open Access Journals (Sweden)
Jevtić Ana
2014-01-01
Full Text Available Children’s attribution of emotions to a moral transgressor is an important research topic in the psychology of moral and emotional development. This is especially because of the so-called Happy Victimizer Phenomenon (HVP where younger children attribute positive emotions to a moral transgressor described in a story. In the two studies that we have conducted (children aged 5, 7 and 9, 20 of each age; 10 of each age in the second study we have tested the possible influence of the fear of sanctions and the type of transgression (stealing and inflicting body injuries on the attribution of emotions. Children were presented with stories that described transgressions and they were asked to answer how the transgressor felt. The fear of sanctions did not make a significant difference in attribution but the type of transgression did - more negative emotions were attributed for inflicting body injuries than for stealing. Positive emotions were explained with situational-instrumental explanations in 84% of cases while negative emotions were explained with moral explanations in 63,5%. Girls attributed more positive emotions (61% than boys (39%. However, our main finding was that, for the aforementioned age groups, we did not find the HVP effect although it has regularly been registered in foreign studies. This finding denies the generalizability of the phenomenon and points to the significance of disciplining styles and, even more so, culture for children’s attribution of emotions to moral transgressors.
Directory of Open Access Journals (Sweden)
Alejandra Suarez
2014-02-01
Full Text Available Freedom Project trains prisoners in nonviolent communication and meditation. Two complementary studies of its effects are reported in this article. The first study is correlational; we found decreased recidivism rates among prisoners trained by Freedom Project compared with recidivism rates in Washington state. The second study compared trained prisoners with a matched-pair control group and found improvement in self-reported anger, self-compassion, and certain forms of mindfulness among the trained group. Ratings of role-plays simulating difficult interactions show increased social skills among the group trained by Freedom Project than in the matched controls.
Project Finance: Basic Components
Alfieri Li Ojeda, Jaime
2015-01-01
The natural speed of the contemporary world demands large investment projects which require specialized financial techniques such as Project Finance, defined as a fund to finance investment projects of great magnitude. Every Project Finance involves a wide range of elements such as promoters, government, contractors andsuppliers, among others, that will ensure project success. La rapidez del mundo contemporáneo exige que los grandes proyectos de inversión requieran de técnicas financieras ...
Managing externally financed projects: the Integrated Primary Health Care Project in Bolivia.
Homedes, N
2001-12-01
Bolivia is one of the poorest countries in Latin America. Health indicators are very poor, communicable diseases are prevalent and, coupled with malnutrition, remain the major killers of children under 5 years old. The Integrated Primary Health Care Project (PROISS) was a US$39 million project executed by the Ministry of Health (MOH), 50% financed by the World Bank and aimed at improving primary health care in the four largest Bolivian municipalities. The implementation of the project started in 1990 and ended in 1997. During implementation it went through three distinct phases: Phase 1 (1990-94) was a period characterized by conflict and confusion; Phase 2 (1995-mid-1996) documented major improvements in coverage and service quality; and Phase 3 (mid-1996-97) witnessed the decline of the project. This paper explores the factors that contributed to the success and the decline of the project, draws lessons for project managers and international agencies involved in the definition and implementation of social sector projects, and discusses the unlikelihood that externally financed projects can have a sustainable impact on the development of the health sector of recipient countries.
MANAGING MULTICULTURAL PROJECT TEAMS
Directory of Open Access Journals (Sweden)
Cezar SCARLAT
2014-06-01
Full Text Available The article is based on literature review and authors’ own recent experience in managing multicultural project teams, in international environment. This comparative study considers two groups of projects: technical assistance (TA projects versus information technology (IT projects. The aim is to explore the size and structure of the project teams – according to the team formation and its lifecycle, and to identify some distinctive attributes of the project teams – both similarities and differences between the above mentioned types of projects. Distinct focus of the research is on the multiculturalism of the project teams: how the cultural background of the team members influences the team performance and team management. Besides the results of the study are the managerial implications: how the team managers could soften the cultural clash, and avoid inter-cultural misunderstandings and even conflicts – in order to get a better performance. Some practical examples are provided as well.
Earned value project management
Fleming, Quentin W
2010-01-01
Organizations that follow the principles of good Earned Value Management (EVM) create an environment that allows teams to successfully operate and thrive ? even in the face of challenges that could negatively impact their projects. Earned Value Project Management (EVPM) is a methodology used to measure and communicate the real physical progress of a project taking into account the work completed, the time taken and the costs incurred to complete that work. As a result, EVPM allows more educated and effective management decision-making, which helps evaluate and control project risk by measuring project progress in monetary terms. In the first two editions of Earned Value Project Management, Quentin W. Fleming and Joel M. Koppelman provided guidance for project management practitioners already familiar with EVPM, was well as those who were new to the use of this technique. The third edition expanded the information available on of EVPM for medium and smaller projects while still being relevant for larger projec...
Clustering ERP implementation project activities: a foundation for project size definition
Janssens, G.; Kusters, R.J.; Heemstra, F.J.; Sadiq, A.; Reichert, M.; Schultz, K.; Trienekens, J.J.M.; Moller, C.; Kusters, R.J.
2007-01-01
The size of an ERP project can be a useful measurement for predicting the effort needed to complete an ERP implementation project. Because this measurement does not exist, research is needed to find a set of variables which can define the size of an ERP implementation project. This paper shows 21
Scheduling for decommissioning projects
International Nuclear Information System (INIS)
Podmajersky, O.E.
1987-01-01
This paper describes the Project Scheduling system being employed by the Decommissioning Operations Contractor at the Shippingport Station Decommissioning Project (SSDP). Results from the planning system show that the project continues to achieve its cost and schedule goals. An integrated cost and schedule control system (C/SCS) which uses the concept of earned value for measurement of performance was instituted in accordance with DOE orders. The schedule and cost variances generated by the C/SCS system are used to confirm management's assessment of project status. This paper describes the types of schedules and tools used on the SSDP project to plan and monitor the work, and identifies factors that are unique to a decommissioning project that make scheduling critical to the achievement of the project's goals. 1 fig
Managing Distributed Software Projects
DEFF Research Database (Denmark)
Persson, John Stouby
Increasingly, software projects are becoming geographically distributed, with limited face-toface interaction between participants. These projects face particular challenges that need careful managerial attention. This PhD study reports on how we can understand and support the management...... of distributed software projects, based on a literature study and a case study. The main emphasis of the literature study was on how to support the management of distributed software projects, but also contributed to an understanding of these projects. The main emphasis of the case study was on how to understand...... the management of distributed software projects, but also contributed to supporting the management of these projects. The literature study integrates what we know about risks and risk-resolution techniques, into a framework for managing risks in distributed contexts. This framework was developed iteratively...
Innovations in project activities
Directory of Open Access Journals (Sweden)
Serbskaya O.V.
2016-11-01
Full Text Available this article considers the ways of project management, models of project management: classical model and the model of flexible designing Agile, pays more attention to the process of project management using Agile model and to the problems of using the project management models in modern conditions.
Ganzel, Candy; Stuglik, Jan
2003-01-01
At a suburban Indiana elementary school, the Project Approach serves as the basis of the curriculum in all Kindergarten classrooms. The four classes of 5- and 6-year-old children at this school chose to study llamas. This article discusses how the project evolved, describes the three phases of the project, and provides teachers' reflections on the…
Power supply projects a collection of innovative and practical design projects
Maplin
1996-01-01
Using circuit diagrams, PCB layouts, parts lists and clear construction and installation details, this book provides everything someone with a basic knowledge of electronics needs to know in order to put that knowledge into practice.This latest collection of Maplin projects are a variety of power supply projects, the necessary components for which are readily available from the Maplin catalogue or any of their high street shops. Projects include, laboratory power supply projects for which there are a wide range of applications for the hobbyist, from servicing portable audio and video equipment
Energy Technology Data Exchange (ETDEWEB)
Goto, Y. (Ministry of International Trade and Industry, Tokyo (Japan))
1992-10-05
Significance of using 'super' for naming a project of technological development is discussed. Functions of naming are classified into (1) recognition, (2) display and (3) sales-promotion, whereby mechanism of naming of merchandise that is developed through the technique of 3 is considered. Further, the mechanism of naming is discussed in relation to marketing. It is pointed out that naming of merchandise is determined on the basis of (1) concept of planned goods and (2) marketing-mixes composed of goods, price, sales-roots and sales-promotion. The same mechanism works also in a project for technological development. Technical trends are caught and projects are targetted by taking supposed regimes into account, thereby the most suitable mix is formed. The mix in the technological development is assumed to be composed of purpose, specification, regime and sales-promotion. Two examples of the governmental projects by Ministry of International Trade and Industry, 'the big regime for research and development on industrial technologies' and 'the regime for development of the fundamental technologies in the next generation' are introduced and the significance of their naming is described. 2 tabs.
The IT project manager competencies that impact project success – A qualitative research
Directory of Open Access Journals (Sweden)
Cíntia Cristina Silva de Araújo
2015-07-01
Full Text Available Since there is a lack of studies about the relationship of IT project manager competencies and project success, this paper will address the following research question: Which competencies should IT project managers develop in order to achieve success in IT projects? To answer this question, we conducted a qualitative research with an exploratory approach. To collect data, twelve (12 in-depth interviews were done with Brazilian project managers from different companies from several business sectors. The analysis results pointed out that for our respondents the most needed category of competencies are team management, business domain knowledge, communication, project management and people skills. As other authors have affirmed, technical skills were considered to be less relevant to project success than interpersonal and intrapersonal competencies.
International Nuclear Information System (INIS)
Knebel, J.U.; Fellmoser, F.; Lefhalm, C.; Mack, K.; Pettan, C.; Piecha, H.; Konys, J.; Adelhelm, C.; Glasbrenner, H.; Muscher, H.; Novotny, J.; Voss, Z.; Wedemeyer, O.; Mueller, G.; Heinzel, A.; Schumacher, G.; Huber, R.; Zimmermann, F.; Groetzbach, G.; Dorr, B.; Carteciano, L.N.
2000-01-01
Within the Hermann von Helmholtz-Gemeinschaft Deutscher Forschungszentren (HGF) an HGF-Strategy Fund Project entitled 'Innovative Technologies to Reduce Radiotoxicity' is funded since October 1999. The objectives of this HGF-Strategy Fund Project is the development of new methods and technologies to design and manufacture thin-walled and highly thermally-loaded surfaces which are cooled by a corrosive heavy liquid metal (lead-bismuth eutectic). The result of this project will be the basic scientific-technical tool which allows the conception and the design of a European Demonstrator of an ADS system (cf. 32.23.05). The work performed at Forschungszentrum Karlsruhe is embedded in a broad European research and development programme on ADS systems. The project is divided in three sub-projects: Sub-Project 1: Thermalhydraulic Investigations, Sub-Project 2: Material Specific Investigations, Sub-Project 3: Oxygen Control System. This progress report gives a general description of the project and its envisaged objectives. As a selection of the results achieved, first, FLUTAN calculations for the COULI beam window design and, second, the oxygen control system for the KArlsruhe Lead LAboratory KALLA are described in detail. Finally, the design and status of KALLA is given. (orig.)
Directory of Open Access Journals (Sweden)
2007-01-01
Full Text Available Many software and IT projects fail in completing theirs objectives because different causes of which the management of the projects has a high weight. In order to have successfully projects, lessons learned have to be used, historical data to be collected and metrics and indicators have to be computed and used to compare them with past projects and avoid failure to happen. This paper presents some metrics that can be used for the IT project management.
DEFF Research Database (Denmark)
Borch, Ole; Kirkegaard, B.; Knudsen, Morten
1998-01-01
for information exchange in the traditional project environment is performed. A group of teachers and a student group using small project examples test the method. The first test group used a prototype for testing and found the new activity synchronization difficult to adapt, so the method was finally adjusted...... to be very precises and with success used on the second test group. Distributed project work is coming pretty soon and with little improvement in server tools, projects in different topics with a large and inhomogeneous profile of users are realistic.......Project work has been used for many years at Aalborg University to improve learning of theory and methods given in courses. In a closed environment where the students are forming a group in a single room, the interaction behaviour is more or less given from the natural life. Group work...
Bioenergy/Biotechnology projects
Energy Technology Data Exchange (ETDEWEB)
Napper, Stan [Louisiana Tech Univ., Ruston, LA (United States); Palmer, James [Louisiana Tech Univ., Ruston, LA (United States); Wilson, Chester [Louisiana Tech Univ., Ruston, LA (United States); Guilbeau, Eric [Louisiana Tech Univ., Ruston, LA (United States); Allouche, Erez [Louisiana Tech Univ., Ruston, LA (United States)
2012-06-30
This report describes the progress of five different projects. The first is an enzyme immobilization study of cellulase to reduce costs of the cellulosic ethanol process. High reusability and use of substrates applicable to large scale production were focus areas for this study. The second project was the development of nanostructured catalysts for conversion of syngas to diesel. Cobalt nanowire catalyst was used in Fischer-Tropsch synthesis. The third project describes work on developing a microfluidic calorimeter to measure reaction rates of enzymes. The fourth project uses inorganic polymer binders that have the advantage of a lower carbon footprint than Portland cement while also providing excellent performance in elevated temperature, high corrosion resistance, high compressive and tensile strengths, and rapid strength gains. The fifth project investigates the potential of turbines in drop structures (such as sewer lines in tall buildings) to recover energy.
Statistical Techniques for Project Control
Badiru, Adedeji B
2012-01-01
A project can be simple or complex. In each case, proven project management processes must be followed. In all cases of project management implementation, control must be exercised in order to assure that project objectives are achieved. Statistical Techniques for Project Control seamlessly integrates qualitative and quantitative tools and techniques for project control. It fills the void that exists in the application of statistical techniques to project control. The book begins by defining the fundamentals of project management then explores how to temper quantitative analysis with qualitati
Project Management Communication 2.0
DEFF Research Database (Denmark)
Berggreen, Line; Kampf, Constance Elizabeth
2015-01-01
How can we understand project management communication practices for developing effective practices in professional and technical communication? In this article we explore an approach to project management that focuses on projects as having a technical documentation structure with content...... that is developed through social or interpersonal communication practices. Looking at the broader picture of project management which besides the implementation phase also includes conception, planning and closure, we see a project management framework that brings together both technical and social aspects...... of project communication. To understand how this works, we interviewed project managers about their understanding and strategy in communicating about the projects they lead. Findings demonstrate that more experienced project managers have a more nuanced understanding of project communication as both...
Four Approaches to Project Evaluation
DEFF Research Database (Denmark)
Laursen, Markus; Svejvig, Per; Rode, Anna Le Gerstrøm
. Each of the framework’s four approaches provides a distinct evaluation that sheds light on some issues while leaving others unattended. Following these lines, the paper calls for more multi-faceted project evaluations. Introducing a framework that can help analyze existing evaluations and structure......There are many theoretical and practical reasons for evaluating projects – including explorative arguments focusing on expanding descriptive knowledge on project work as well as normative arguments focusing on improving prescriptive models of project performance. Despite the need for project...... management methodologies that work and combat project failure, and research methods that can assess effective project management and methodologies, as well as empirical research on the actuality of projects as practice, evaluation research on projects including project management and methodologies is scarce...
Salt Repository Project: FY 85 technical project plan
International Nuclear Information System (INIS)
1985-07-01
The FY 85 technical plan for the Salt Repository Project is briefly presented. The objectives of the project in relation to the Civilian Radioactive Waste Management Program are discussed, and the technical activities directed toward accomplishing these objectives are detailed. A budget is presented for each of the Level 2 work breakdown structure tasks (Systems, Waste Package, Site, Repository, Regulatory and Institutional, Exploratory Shaft, Test Facilities, Land Acquisition, and Project Management) in the various sections. An overall description, current status, and planned activities are presented for each of the subtasks which make up the above-mentioned Level 2 tasks. A strategy diagram and a master schedule are included and each of the milestones is also listed chronologically in the sections
MORE. Management of Requirements in NPP modernisation projects - Project report 2005
International Nuclear Information System (INIS)
Thunem, A.P.J.; Fredriksen, R.; Thunem, H.P.J.; Ventae, O.; Valkonen, J.; Holmberg, J.E.
2006-04-01
The overall objective of the project MORE is to improve the means for managing the large amounts of evolving requirements in Nordic NPP modernisation projects. In accordance to this objective, the activity will facilitate the industrial utilisation of the research results from the project TACO. On the basis of experiences in the Nordic countries, the overall aim of the TACO project has been to identify the best practices and most important criteria for ensuring effective communication in relation to requirements elicitation and analysis, understandability of requirements to all parties, and traceability of requirements. The project resulted in the development of a traceability model for handling requirements from their origins and through their final shapes. Particular emphasis for the MORE project in 2005 was put on utilising a prototype of a tool (TRACE) intended to support an adopted approach to dependable requirements engineering, suitable for modelling and handling large amounts of requirements related to all stages of the systems development process and not only those traditionally including requirements at high-level stages. (au)
MORE. Management of Requirements in NPP modernisation projects - Project report 2005
Energy Technology Data Exchange (ETDEWEB)
Thunem, A.P.J.; Fredriksen, R.; Thunem, H.P.J. [IFE (Norway); Ventae, O.; Valkonen, J.; Holmberg, J.E. [VTT Technical Research Centre of Finland (Finland)
2006-04-15
The overall objective of the project MORE is to improve the means for managing the large amounts of evolving requirements in Nordic NPP modernisation projects. In accordance to this objective, the activity will facilitate the industrial utilisation of the research results from the project TACO. On the basis of experiences in the Nordic countries, the overall aim of the TACO project has been to identify the best practices and most important criteria for ensuring effective communication in relation to requirements elicitation and analysis, understandability of requirements to all parties, and traceability of requirements. The project resulted in the development of a traceability model for handling requirements from their origins and through their final shapes. Particular emphasis for the MORE project in 2005 was put on utilising a prototype of a tool (TRACE) intended to support an adopted approach to dependable requirements engineering, suitable for modelling and handling large amounts of requirements related to all stages of the systems development process and not only those traditionally including requirements at high-level stages. (au)
Flat-plate solar array project. Volume 8: Project analysis and integration
Mcguire, P.; Henry, P.
1986-01-01
Project Analysis and Integration (PA&I) performed planning and integration activities to support management of the various Flat-Plate Solar Array (FSA) Project R&D activities. Technical and economic goals were established by PA&I for each R&D task within the project to coordinate the thrust toward the National Photovoltaic Program goals. A sophisticated computer modeling capability was developed to assess technical progress toward meeting the economic goals. These models included a manufacturing facility simulation, a photovoltaic power station simulation and a decision aid model incorporating uncertainty. This family of analysis tools was used to track the progress of the technology and to explore the effects of alternative technical paths. Numerous studies conducted by PA&I signaled the achievement of milestones or were the foundation of major FSA project and national program decisions. The most important PA&I activities during the project history are summarized. The PA&I planning function is discussed and how it relates to project direction and important analytical models developed by PA&I for its analytical and assessment activities are reviewed.
Methodologies of Project Management
Directory of Open Access Journals (Sweden)
Wojciech Macek
2011-07-01
Full Text Available This paper presents comparison of three most popular project management standardsbelonging to a wider group of models (for example, PMBOK, Prince 2, CMMI, ISO 10006,BS 6079, IPMA Competence Baseline, European Commission Project Cycle ManagementGuidelines. The author discusses methods of project management according to PMBoK,Prince 2 and ISO 10006, some chosen criteria and fields of knowledge, such as generalregulations of standards, project range management, resources management, and processesconnected with risk, systems of project quality management.
International Nuclear Information System (INIS)
Doman, J.W.; Vlahakis, J.
1992-01-01
Management of projects under the control of the Office of Civilian Radioactive Waste Management within the Department of Energy is subject to overview by a variety of internal and external entities. This paper reports that effective project management often requires balancing of conflicting directions and conflicting agendas of the different entities in order to proceed with implementation of the Monitored Retrievable Storage project
The Canada Goose Project: A First Project with Children under 3
Brewer, Ruth A.
2010-01-01
This project report describes how five children (an infant, three toddlers, and a preschooler) enrolled at a private day care home engaged in their first journey into project work through a study of Canada geese living on a nearby body of water. Prior to the experience described in this paper, the author had used the Project Approach only with…
Project-based fieldwork: perspectives of graduate entry students and project sponsors.
Fortune, Tracy; McKinstry, Carol
2012-08-01
This article builds on an earlier viewpoint regarding the need for project-focussed fieldwork. It presents the findings of an evaluative study into the value of project placements undertaken by final year graduate entry master's students as part of a capstone subject. The authors argue that provision of project placements enable impending graduates to develop and implement macro level strategies to develop prevention, resource and service development skills often required of contemporary occupational therapy practitioners. A qualitative approach is adopted. Student cohorts from 2005 and 2006 completed open-ended, written questionnaires, and agency project sponsors were interviewed to obtain their perspectives of the project placement experience. Despite some concern that project placements might be undertaken at the expense of 'clinical' placements these findings reveal that projects managed by students were perceived by services to add great value enabling them to advance important priorities. Students and sponsors highlighted a range of positive learning outcomes, including the ability to work collaboratively with supervisors and develop advanced communication skills and political acumen. The success of such placements depends on supportive supervision from academic staff. CONCLUSIONS AND SIGNIFICANCE OF THE STUDY: The findings promote project placements as a highly authentic aspect of work integrated learning enabling learners to draw together a range of attributes that support the ability to manage complex issues that have occupational relevance at a macro level. In addition, such experiences help learners to develop agency and political acumen both increasingly important capabilities for the contemporary workplace. © 2012 The Authors Australian Occupational Therapy Journal © 2012 Occupational Therapy Australia.
Trappl, R.; Nijholt, Antinus; Stuk, M.; Zwiers, Jakob
2002-01-01
In this paper we discuss our virtual reality project Gulliver. This project is part of a more comprehensive project conceived by two artists, Matjaž Štuk and Alena Hudcovicová, called “Gulliver’s Museum of Living Art��?. Our part of the project involves a virtual reality version of Swift’s Gulliver
Rutherford, Sandra; Coffman, Margaret
2004-01-01
For several decades, science teachers have used bottles for classroom projects designed to teach students about biology. Bottle projects do not have to just focus on biology, however. These projects can also be used to engage students in Earth science topics. This article describes the Earth System Science Project, which was adapted and developed…
Interactions of the NAEG information support project with other projects
International Nuclear Information System (INIS)
Pfuderer, H.A.
1976-01-01
In the past year the Information Support Project to the Nevada Applied Ecology Group has interacted with many other research projects on the transuranics and other radionuclides. Group interactions through symposiums, workshops, and responding to search requests have proven to be mutually beneficial. The NAEG Information Support Project will draw on the information resources of the Oak Ridge National Laboratory to produce a bibliography of the radionuclides (other than the transuranics) of interest to the Nevada Test Site
Cole, Charles; Krampis, Konstantinos; Karagiannis, Konstantinos; Almeida, Jonas S; Faison, William J; Motwani, Mona; Wan, Quan; Golikov, Anton; Pan, Yang; Simonyan, Vahan; Mazumder, Raja
2014-01-27
Next-generation sequencing (NGS) technologies have resulted in petabytes of scattered data, decentralized in archives, databases and sometimes in isolated hard-disks which are inaccessible for browsing and analysis. It is expected that curated secondary databases will help organize some of this Big Data thereby allowing users better navigate, search and compute on it. To address the above challenge, we have implemented a NGS biocuration workflow and are analyzing short read sequences and associated metadata from cancer patients to better understand the human variome. Curation of variation and other related information from control (normal tissue) and case (tumor) samples will provide comprehensive background information that can be used in genomic medicine research and application studies. Our approach includes a CloudBioLinux Virtual Machine which is used upstream of an integrated High-performance Integrated Virtual Environment (HIVE) that encapsulates Curated Short Read archive (CSR) and a proteome-wide variation effect analysis tool (SNVDis). As a proof-of-concept, we have curated and analyzed control and case breast cancer datasets from the NCI cancer genomics program - The Cancer Genome Atlas (TCGA). Our efforts include reviewing and recording in CSR available clinical information on patients, mapping of the reads to the reference followed by identification of non-synonymous Single Nucleotide Variations (nsSNVs) and integrating the data with tools that allow analysis of effect nsSNVs on the human proteome. Furthermore, we have also developed a novel phylogenetic analysis algorithm that uses SNV positions and can be used to classify the patient population. The workflow described here lays the foundation for analysis of short read sequence data to identify rare and novel SNVs that are not present in dbSNP and therefore provides a more comprehensive understanding of the human variome. Variation results for single genes as well as the entire study are available
UNIFIED DISPERSIVE APPROACH TO γ* → γππ AND γγ → ππ
Moussallam, B.
2014-12-01
A representation of the amplitude γ*(q2) → γππ is proposed which combines large Nc chiral resonance Lagrangian modelling with general unitarity and analyticity properties. The amplitude is constrained from γγ scattering results and e+e- → γπ0π0 measurements by the CMD-2 and SND collaborations. As an application, the contribution of the ππ + γ states in the HVP contribution to the muon g - 2 are reconsidered, taking into account the effect of the strong S-wave ππ rescattering in a model independent way.
Blum, T.; Izubuchi, T.; Jin, L.; Jüttner, A.; Lehner, C.; Maltman, K.; Marinkovic, M.; Portelli, A.; Spraggs, M.
2016-01-01
We report the first lattice QCD calculation of the hadronic vacuum polarization disconnected contribution to the muon anomalous magnetic moment at physical pion mass. The calculation uses a refined noise-reduction technique which enabled the control of statistical uncertainties at the desired level with modest computational effort. Measurements were performed on the $48^3 \\times 96$ physical-pion-mass lattice generated by the RBC and UKQCD collaborations. We find $a_\\mu^{\\rm HVP~(LO)~DISC} = -9.6(3.3)(2.3)\\times 10^{-10}$, where the first error is statistical and the second systematic.
Preliminary Project Execution Plan for the Remote-Handled Low-Level Waste Disposal Project
Energy Technology Data Exchange (ETDEWEB)
David Duncan
2011-05-01
This preliminary project execution plan (PEP) defines U.S. Department of Energy (DOE) project objectives, roles and responsibilities of project participants, project organization, and controls to effectively manage acquisition of capital funds for construction of a proposed remote-handled low-level waste (LLW) disposal facility at the Idaho National Laboratory (INL). The plan addresses the policies, requirements, and critical decision (CD) responsibilities identified in DOE Order 413.3B, 'Program and Project Management for the Acquisition of Capital Assets.' This plan is intended to be a 'living document' that will be periodically updated as the project progresses through the CD process to construction and turnover for operation.
Preliminary Project Execution Plan for the Remote-Handled Low-Level Waste Disposal Project
International Nuclear Information System (INIS)
Duncan, David
2011-01-01
This preliminary project execution plan (PEP) defines U.S. Department of Energy (DOE) project objectives, roles and responsibilities of project participants, project organization, and controls to effectively manage acquisition of capital funds for construction of a proposed remote-handled low-level waste (LLW) disposal facility at the Idaho National Laboratory (INL). The plan addresses the policies, requirements, and critical decision (CD) responsibilities identified in DOE Order 413.3B, 'Program and Project Management for the Acquisition of Capital Assets.' This plan is intended to be a 'living document' that will be periodically updated as the project progresses through the CD process to construction and turnover for operation.
The Human Genome Diversity Project
Energy Technology Data Exchange (ETDEWEB)
Cavalli-Sforza, L. [Stanford Univ., CA (United States)
1994-12-31
The Human Genome Diversity Project (HGD Project) is an international anthropology project that seeks to study the genetic richness of the entire human species. This kind of genetic information can add a unique thread to the tapestry knowledge of humanity. Culture, environment, history, and other factors are often more important, but humanity`s genetic heritage, when analyzed with recent technology, brings another type of evidence for understanding species` past and present. The Project will deepen the understanding of this genetic richness and show both humanity`s diversity and its deep and underlying unity. The HGD Project is still largely in its planning stages, seeking the best ways to reach its goals. The continuing discussions of the Project, throughout the world, should improve the plans for the Project and their implementation. The Project is as global as humanity itself; its implementation will require the kinds of partnerships among different nations and cultures that make the involvement of UNESCO and other international organizations particularly appropriate. The author will briefly discuss the Project`s history, describe the Project, set out the core principles of the Project, and demonstrate how the Project will help combat the scourge of racism.
MORE: Management of requirements in NPP modernisation projects. Project report 2007
International Nuclear Information System (INIS)
Fredriksen, R.; Katta, V.; Raspotnig, C.; Valkonen, J.
2008-03-01
This report documents the work and related activities of the MORE project in the period January 1 - December 31 in 2007. The focus of this report is on improvements of the former project results, to identify and apply a couple of case studies from NPP projects, and activities in order to initiate and implement the industrial take-up and utilisation of the research results in real modernisation projects. The report also provides a brief description of the extended industrial network and disseminations of the results in Nordic and NKS related events such as seminars and workshops. (au)
MORE: Management of requirements in NPP modernisation projects. Project report 2007
Energy Technology Data Exchange (ETDEWEB)
Fredriksen, R.; Katta, V.; Raspotnig, C. [Institutt for energiteknikk (IFE) (Norway); Valkonen, J. [Technical Research Centre of Finland (VTT) (Finland)
2008-03-15
This report documents the work and related activities of the MORE project in the period January 1 - December 31 in 2007. The focus of this report is on improvements of the former project results, to identify and apply a couple of case studies from NPP projects, and activities in order to initiate and implement the industrial take-up and utilisation of the research results in real modernisation projects. The report also provides a brief description of the extended industrial network and disseminations of the results in Nordic and NKS related events such as seminars and workshops. (au)
Scaffolding Project-Based Learning with the Project Management Body of Knowledge (PMBOK[R])
van Rooij, Shahron Williams
2009-01-01
This paper reports the results of a study of the extent to which processes and procedures from the discipline of project management can scaffold online project-based learning in a graduate-level instructional technology course, by facilitating intra-team interaction, enhancing project outcomes and promoting a positive project team experience. With…
McLeod, Keri
2007-01-01
This article describes the 100 People Project and how the author integrates the project in her class. The 100 People Project is a nonprofit organization based in New York City. The organization poses the question: If there were only 100 people in the world, what would the world look like? Through the project, students were taught about ethics in…
PROJECT MANAGEMENT AND RELATIONSHIP MARKETING: INTERSECTIONS FOR STAKEHOLDER MANAGEMENT IN PROJECTS
Directory of Open Access Journals (Sweden)
Ronielton Rezende Oliveira
2017-06-01
Full Text Available Projects development is essential for organizations. Among the factors originated in projects that influence performance is quality. This variable must be managed to meet the expectations of the stakeholders and this can only be achieved through effective monitoring and control. It can be seen that relationship marketing is relevant to the competitive reality of contemporary organizations. With the purpose of contributing to organizational studies, this theoretical essay proposes to approach project management in relationship marketing. In the context of integrated management, it is discussed how management action can be applied to engage and involve stakeholders in projects, in order to create value and achieve the expectations sustained by the execution of the projects. Based on the reflection, the quality of relationship management is pointed out as a construct of higher order, composed of at least two dimensions: trust and satisfaction.
How Agile Methods Conquers General Project Management - The Project Half Double Initiative
DEFF Research Database (Denmark)
Tordrup Heeager, Lise; Svejvig, Per; Schlichter, Bjarne Rerup
2016-01-01
Increased complexity in projects has forced new project management initiatives. In software development several agile methods have emerged and methods such as Scrum are today highly implemented in practice. General project management practice has been inspired by agile software development...
Innovative Project Activities in Science [From the NSTA Study of Innovative Project Activities
Science Teacher, 1975
1975-01-01
Describes four projects chosen as innovative project activities in science which exhibited identification of unique or novel problems and creative approaches to their solutions. Projects included a study of fish in Lake Erie, a goat raising project, an analysis of terrestrial plant ecology and soil composition, and a study of marine and wetlands…
DEFF Research Database (Denmark)
Damkilde, Lars; Larsen, Torben J.; Walbjørn, Jacob
This document is aimed at helping all parties involved in the LEX project to get a common understanding of words, process, levels and the overall concept.......This document is aimed at helping all parties involved in the LEX project to get a common understanding of words, process, levels and the overall concept....
Braden, Barry M.
2004-01-01
How does a Project Management Office provide: Consistent, familiar, easily used scheduling tools to Project Managers and project team members? Provide a complete list of organization resources available for use on the project? Facilitate resource tracking and visibility? Provide the myriad reports that the organization requires? Facilitate consistent budget planning and cost performance information? Provide all of this to the entire organization? Provide for the unique requirement of the organization? and get people to use it? Answer: Implementation of the Kennedy space Center Projects and Resources Online (KPRO), a modified COTS solution.
Project studies and engaged scholarship
DEFF Research Database (Denmark)
Geraldi, Joana; Söderlund, Jonas
2016-01-01
and to rejuvenate these research directions. Design/methodology/approach The authors propose the umbrella term: “project studies” to denote the research related to projects and temporary organizing. Project studies is conceived not only as a body of research, but also as a social process embedded in research...... scholars, who’s “job” goes beyond the writing of articles and research applications, and includes shaping discourses of project research, nurturing new project scholars, contributing to project practice and carefully considering the legacy of projects and project studies in society. Originality......Purpose In 2006, the “Rethinking Project Management” network called for a paradigm shift in project research, and proposed five research directions. The directions inspired research and marked a milestone in the development of the field. The purpose of this paper is to reflect on the past decade...
VarioML framework for comprehensive variation data representation and exchange
Directory of Open Access Journals (Sweden)
Byrne Myles
2012-10-01
Full Text Available Abstract Background Sharing of data about variation and the associated phenotypes is a critical need, yet variant information can be arbitrarily complex, making a single standard vocabulary elusive and re-formatting difficult. Complex standards have proven too time-consuming to implement. Results The GEN2PHEN project addressed these difficulties by developing a comprehensive data model for capturing biomedical observations, Observ-OM, and building the VarioML format around it. VarioML pairs a simplified open specification for describing variants, with a toolkit for adapting the specification into one's own research workflow. Straightforward variant data can be captured, federated, and exchanged with no overhead; more complex data can be described, without loss of compatibility. The open specification enables push-button submission to gene variant databases (LSDBs e.g., the Leiden Open Variation Database, using the Cafe Variome data publishing service, while VarioML bidirectionally transforms data between XML and web-application code formats, opening up new possibilities for open source web applications building on shared data. A Java implementation toolkit makes VarioML easily integrated into biomedical applications. VarioML is designed primarily for LSDB data submission and transfer scenarios, but can also be used as a standard variation data format for JSON and XML document databases and user interface components. Conclusions VarioML is a set of tools and practices improving the availability, quality, and comprehensibility of human variation information. It enables researchers, diagnostic laboratories, and clinics to share that information with ease, clarity, and without ambiguity.
DEFF Research Database (Denmark)
Kuhn, Johan M.; Malchow-Møller, Nikolaj; Sørensen, Anders
In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two...... important qualifications for the understanding of the contributions and results established in the project....
The New Mexico Technology Deployment Pilot Project: A technology reinvestment project. Final report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
The New Mexico Technology Deployment Project (NMTDP) has been in operation for slightly more than two years. As one of the original TRP projects, NMTDP had the charter to develop and validate a new model for technology extraction which emphasized focused technology collaboration, early industry involvement, and a strong dual use commercialization and productization emphasis. Taken in total, the first two years of the NMTDP have been exceptionally successful, surpassing the goals of the project. This report describes the accomplishments and evolution of the NMTDP to date and discusses the future potential of the project. Despite the end of federal funding, and a subsequent reduction in level of effort, the project partners are committed to continuation of the project.
Project plan remove special nuclear material from PFP project plutonium finishing plant; TOPICAL
International Nuclear Information System (INIS)
BARTLETT, W.D.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Remove Special Nuclear Material (SNM) Materials. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617,Rev. 0. This project plan is the top-level definitive project management document for PFP Remove SNM Materials project. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Remove SNM Materials project. Any deviations to the document must be authorized through the appropriate change control process
Project management plan for the 105-C Reactor interim safe storage project. Revision 1
International Nuclear Information System (INIS)
Miller, R.L.
1997-01-01
In 1942, the Hanford Site was commissioned by the US Government to produce plutonium. Between 1942 and 1955, eight water-cooled, graphite-moderated reactors were constructed along the Columbia River at the Hanford Site to support the production of plutonium. The reactors were deactivated from 1964 to 1971 and declared surplus. The Surplus Production Reactor Decommissioning Project (BHI 1994b) will decommission these reactors and has selected the 105-C Reactor to be used as a demonstration project for interim safe storage at the present location and final disposition of the entire reactor core in the 200 West Area. This project will result in lower costs, accelerated schedules, reduced worker exposure, and provide direct benefit to the US Department of Energy for decommissioning projects complex wide. This project sets forth plans, organizational responsibilities, control systems, and procedures to manage the execution of the Project Management Plan for the 105-C Reactor Interim Safe Storage Project (Project Management Plan) activities to meet programmatic requirements within authorized funding and approved schedules. The Project Management Plan is organized following the guidelines provided by US Department of Energy Order 4700.1, Project Management System and the Richland Environmental Restoration Project Plan (DOE-RL 1992b)
International Nuclear Information System (INIS)
1995-04-01
The purpose of the Isotopes Facilities Deactivation Project (IFDP) is to place former isotopes production facilities at the Oak Ridge National Laboratory in a safe, stable, and environmentally sound condition suitable for an extended period of minimum surveillance and maintenance (S ampersand M) and as quickly and economically as possible. Implementation and completion of the deactivation project will further reduce the already small risks to the environment and to public safety and health. Furthermore, the project should result in significant S ampersand M cost savings in the future. The IFDP management plan has been prepared to document the project objectives, define organizational relationships and responsibilities, and outline the management control systems to be employed in the management of the project. The project has adopted a strategy to deactivate the simple facilities first, to reduce the scope of the project, and to gain experience before addressing more difficult facilities. A decision support system is being developed to identify those activities, that best promote the project mission and result in largest cost savings. The Work Plan for the Isotopes Facilities Deactivation Project at Oak Ridge National Laboratory (Energy Systems 1994) defines the project schedule, the cost estimate, and the technical approach for the project
We Scrum Every Day: Using Scrum Project Management Framework for Group Projects
Pope-Ruark, Rebecca
2012-01-01
Collaborative group projects have documented learning benefits, yet collaboration is challenging for students because the educational system values individual achievement. This article explores Scrum, an approach to framing, planning, and managing group projects used in Web-software development. Designed for multi-faceted projects, this approach…
Why does project planning fail
International Nuclear Information System (INIS)
Foley, M.; Luciano, G.
1991-01-01
The technology of project controls have become increasingly sophisticated. Some say that the technological advancements of the Nineteen-Eighties represented a maturation of project control tools. Others say that the advancements were merely bells and whistles that added little or nothing to the project management process. Above it all, as we enter the Nineties, there is a popular outcry to get back to the basics of planning. The genesis of this outcry is the sobering impact of significant cost overruns and schedule extensions, even on projects that have employed the most advanced project control tools and systems. This paper examines the merits of taking a strategic approach to the project planning process. Within that context, there are basic goals of planning which are enduring through the life cycle of the project. Key reasons for failure and inability to achieve the goals of project planning are explained. By examining the goals of project planning and the reasons for failure, insight is provided into the role of project controls specialists and sophisticated project control tools in meeting the challenges of complex project management in the 1990's
MANAGING LARGE INVESTMENT PROJECTS IN GORJ
Directory of Open Access Journals (Sweden)
CÎRNU DORU
2016-12-01
Full Text Available Currently, the concept of project management is considered to be the best concept for efficient management of a project, so it is used all over the world, and most recently in our country. This concept is designed with all the general characteristics of project management, but adapted to the large investment projects. This paper presents the project management concept and project management organization for capital projects. This concept is conceived with all general characteristics of project management, but adopted to the condition of large investment projects. The concept also includes the project team and the project manager, the person authorized and responsible for achieving the objectives planned in the project. For efficient managing by project, it is necessary to insure a good compozition of project team, as a team of people who, in collaboration with project manager, work directly on managing the project. To effectively manage the project, it is necessary to ensure a proper composition of the project team, a team of people who, in collaboration with the project manager to work directly for project management. It is a particularly good method of achieving the objectives planned projects, which means a project with a certain level of performance required in a planned time, with planned costs.
Project management for profit a failsafe guide to keeping projects on track and on budget
Knight, Joe; Angus, Brad; Case, John
2012-01-01
If your work involves projects, then this book is for you. It will show every company owner and project manager—at businesses large and small—how to run projects differently. You’ll benefit if you’ve ever: • been over budget on a project • exceeded a timeline on a project • worked on a project that completely stalled as you neared the finish line • lost money on a sure-thing project and had no idea why • noticed that scope and feature creep held you back • watched a project take three times as long as planned • felt too embarrassed to perform a review of your successes and failures • wondered whether your project actually made any money By the time you finish the book, you’ll be ready to implement Project Management for Profit in your own company—and be prepared to keep your projects on track and on budget.
Relationships and project marketing success
DEFF Research Database (Denmark)
Skaates, Maria Anne; Tikkanen, Henrikki; Lindblom, Jarno
2002-01-01
Project operations are a dominating mode of international business. Managing relationships and networks is crucial to project marketing success both at the level of the individual project and at the level of multiple projects. This article first defines key characteristics of project business, id...
PROJECT FINANCE AS A TOOL FOR THE IMPLEMENTATION OF INVESTMENT PROJECTS
Directory of Open Access Journals (Sweden)
U. V. Vsyakih
2015-02-01
Full Text Available The article discusses the reasons for the insufficient use of project financing in the Russian Federation, the brief historical background for the project financing in Russia, as well as the main principles, types and stages of project financing. For results was used theoretical methods associated with the study of general and specialized literature, as well as methods of analysis and synthesis.
Chan, Ka Fai
2011-01-01
Project finance is a financing arrangement for projects, and it is characterised by the creation of a legally independent project company financed with non- or limited recourse loans. It is observed that the popularity of project finance is increasing in the recent decades, despite of the impact of Asian financial crisis. Especially in emerging markets, project finance is very common among the public-private partnership projects. It is possible that project finance yields some benefits in pro...
Project Management in Real Time: A Service-Learning Project
Larson, Erik; Drexler, John A., Jr.
2010-01-01
This article describes a service-learning assignment for a project management course. It is designed to facilitate hands-on student learning of both the technical and the interpersonal aspects of project management, and it involves student engagement with real customers and real stakeholders in the creation of real events with real outcomes. As…
Fundamentals of Project Management
Heagney, Joseph
2011-01-01
With sales of more than 160,000 copies, Fundamentals of Project Management has helped generations of project managers navigate the ins and outs of every aspect of this complex discipline. Using a simple step-by-step approach, the book is the perfect introduction to project management tools, techniques, and concepts. Readers will learn how to: ò Develop a mission statement, vision, goals, and objectives ò Plan the project ò Create the work breakdown structure ò Produce a workable schedule ò Understand earned value analysis ò Manage a project team ò Control and evaluate progress at every stage.
Visualizations as Projection Devices
DEFF Research Database (Denmark)
Harty, Chris; Holm Jacobsen, Peter; Tryggestad, Kjell
The aim of this paper is to inquire into the role of project visualizations in shaping healthcare spaces and practices. The study draws upon an ethnographic field study from a large on-going hospital construction project in Denmark, and focuses on the early phases of on-boarding the design team...... into the project organization. During the on-boarding visualizations multiplies in form, content and purpose, ranging from paper and digitally based projections of clinical work spaces and practices for the future hospital building in use, to paper and digitally based projections of the cost budget and time...
Agile Project Management For Dummies
Layton, Mark C
2012-01-01
Be flexible and faster with Agile project management As mobile and web technologies continue to evolve rapidly, there is added pressure to develop and implement software projects in weeks instead of months. Agile Project Management For Dummies can make that happen. This is the first book to provide a simple, step-by-step guide to Agile Project Management approaches, tools, and techniques. With the fast pace of mobile and web technology development, software project development must keep pace; Agile Project Management enables developers to complete and implement projects more quickly and this b
Three domains of project organising
Winch, Graham M.
2014-01-01
It has become axiomatic in research on project organising that projects are temporary organisations. Yet there are a number of challenges to this axiom: research on matrix organisation, the embeddedness of projects in project ecologies, and projectification all emphasise the relationship of the project to permanent organisations. Similarly, research on project-based firms and owner organisations which are relatively permanent challenges this axiom. This paper develops a conceptual framework w...
1995 project of the year Hanford Environmental compliance project nomination
Energy Technology Data Exchange (ETDEWEB)
Kelly, J.R.
1996-02-01
The completion of the Hanford Environmental Compliance (HEC) Project in December 1995 brought to a successful close a long line of major contributions to environmental cleanup. Not since the early days of the Hanford Site during and shortly after World War 11 had such a large group of diverse construction activities, with a common goal, been performed at Hanford. Key to this success was the unique combination of 14 subprojects under the HEC Project which afforded the flexibility to address evolving subproject requirements. This strategy resulted in the accomplishment of the HEC Project stakeholders` objectives on an aggressive schedule, at a $33 million cost savings to the customer. The primary objectives of the HEC Project were to upgrade selected Hanford Site facilities and systems to bring them into compliance with current environmental standards and regulations. The HEC Project contributed significantly towards the Hanford site compliance with Clean Water Act, Resource Conservation and Recovery Act (RCRA) and Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) requirements. It provided, in part, those construction activities required to comply with those requirements in the areas of liquid and solid waste treatment and disposal, waste characterization, and groundwater monitoring.
1995 project of the year Hanford Environmental compliance project nomination
International Nuclear Information System (INIS)
Kelly, J.R.
1996-02-01
The completion of the Hanford Environmental Compliance (HEC) Project in December 1995 brought to a successful close a long line of major contributions to environmental cleanup. Not since the early days of the Hanford Site during and shortly after World War 11 had such a large group of diverse construction activities, with a common goal, been performed at Hanford. Key to this success was the unique combination of 14 subprojects under the HEC Project which afforded the flexibility to address evolving subproject requirements. This strategy resulted in the accomplishment of the HEC Project stakeholders' objectives on an aggressive schedule, at a $33 million cost savings to the customer. The primary objectives of the HEC Project were to upgrade selected Hanford Site facilities and systems to bring them into compliance with current environmental standards and regulations. The HEC Project contributed significantly towards the Hanford site compliance with Clean Water Act, Resource Conservation and Recovery Act (RCRA) and Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) requirements. It provided, in part, those construction activities required to comply with those requirements in the areas of liquid and solid waste treatment and disposal, waste characterization, and groundwater monitoring
Multi-Role Project (MRP): A New Project-Based Learning Method for STEM
Warin, Bruno; Talbi, Omar; Kolski, Christophe; Hoogstoel, Frédéric
2016-01-01
This paper presents the "Multi-Role Project" method (MRP), a broadly applicable project-based learning method, and describes its implementation and evaluation in the context of a Science, Technology, Engineering, and Mathematics (STEM) course. The MRP method is designed around a meta-principle that considers the project learning activity…
Efficient and Effective Project Management
Directory of Open Access Journals (Sweden)
Dusan Pene
2014-03-01
Full Text Available The purpose of the article is to investigate different authorities and responsibilities of a project manager and of a project leader. Considering the fact that nowadays the project management is becoming the important factor in performing and leading the investments which are modified by modern leadership theories, we can say that the key element is the sovereign leadership of a manager and a project leader. The current multi-project environments and modern techniques at the project management area need the interdisciplinary leadership approach and at the same time they enable the strengthening of company’s competitive features so they are consistently satisfying high project expectations of the project investor or a client.
Vince, O.
2013-05-01
The DWARF project is an important international project for observing eclipsing binary stars and searching for third companion which orbit around both stars. Recently, a group of researchers at the Astronomical Observatory of Belgrade joined this project using the 60 cm telescope at the Astronomical Station Vidojevica for observations. All the equipment and the human potential involved with this project from Serbia will be described in this paper.
Process-based project proposal risk management
Directory of Open Access Journals (Sweden)
Alok Kumar
2016-12-01
Full Text Available We all are aware of the organizational omnipresence. Projects within the organizations are ubiquitous too. Projects achieve their goals successfully if they are planned, scheduled, controlled and implemented well. The project lifecycle of initiating, planning, scheduling, controlling and implementing are very well-planned by project managers and the organizations. Successful projects have well-developed risk management plans to deal with situations impacting projects. Like any other organisation, a university does try to access funds for different purposes too. For such organisations, running a project is not the issue, rather getting a project proposal approved to fund a project is the key. Project proposal processing is done by the nodal office in every organisation. Usually, these nodal offices help in administration and submission of a project proposal for accessing funds. Seldom are these nodal project offices within the organizations facilitate a project proposal approval by proactively reaching out to the project managers. And as project managers prepare project proposals, little or no attention is made to prepare a project proposal risk plan so as to maximise project acquisition. Risk plans are submitted while preparing proposals but these risk plans cater to a requirement to address actual projects upon approval. Hence, a risk management plan for project proposal is either missing or very little effort is made to treat the risks inherent in project acquisition. This paper is an integral attempt to highlight the importance of risk treatment for project proposal stage as an extremely important step to preparing the risk management plan made for projects corresponding to their lifecycle phases. Several tools and techniques have been proposed in the paper to help and guide either the project owner (proposer or the main organisational unit responsible for project management. Development of tools and techniques to further enhance project
Dominik, Michael T.
The success of a project is dependent in part on the skills, knowledge, and behavior of its leader, the project manager. Despite advances in project manager certifications and professional development, the aerospace and defense industry has continued to see highly visible and expensive project failures partially attributable to failures in leadership. Servant leadership is an emerging leadership theory whose practitioners embrace empowerment, authenticity, humility, accountability, forgiveness, courage, standing back, and stewardship, but has not yet been fully examined in the context of the project manager as leader. The objective of this study was to examine the relationship between servant leadership behaviors demonstrated by aerospace and defense project managers and the resulting success of their projects. Study participants were drawn from aerospace and defense oriented affinity groups from the LinkedInRTM social media web system. The participants rated their project managers using a 30-item servant leadership scale, and rated the success of their project using a 12-item project success scale. One hundred and fifteen valid responses were analyzed from 231 collected samples from persons who had worked for a project manager on an aerospace and defense project within the past year. The results of the study demonstrated statistically significant levels of positive correlation to project success for all eight servant leadership factors independently evaluated. Using multiple linear regression methods, the servant leadership factors of empowerment and authenticity were determined to be substantial and statistically significant predictors of project success. The study results established the potential application of servant leadership as a valid approach for improving outcomes of projects.
Directory of Open Access Journals (Sweden)
A. N. Petrov
2016-01-01
Full Text Available The balanced methodology for assessing the Technology Project Readiness Level for commercialization (TPRL is proposed. TPRL allows to determine the dynamics and balance of development projects that use the standardized approaches used in assessing the readiness of the technology. Validation of the methodology undertaken for the projects of Federal target programs “Research and development on priority directions of development of scientific-technological complex of Russia for 2007–2013” and “Research and development on priority directions of development of scientific-technological complex of Russia for 2014–2020”. The obtained results showed the possibility of application of the methodology for the evaluation of projects, improving efficiency of expert activity in the evaluation of projects, monitoring the status of individual project and group of projects (portfolio. The application of the methodology allowed us to improve the management of individual project and portfolio of projects.Methodology TPRL will allow the implementers, industry partners, investors, and innovative industrial companies to improve the efficiency of its activities.
Ying Zhang; Corinne Bishop
2005-01-01
This paper discusses how Microsoft Project 2000 was utilized at the University of Central Florida Libraries to manage an e-reference implementation project. As libraries today adopt more information technologies, efficiently managing projects can be challenging. The authors’ experience in the implementation of QuestionPoint e-reference software in October 2003 is described. Their conclusion illustrates that project-management tools, such as Microsoft Project 2000, offer practical workflow-man...
The Impact of Project Manager on Project Success – The Case of ICT Sector
Blaskovics, Bálint
2016-01-01
The project management literature on project success is rich. Numerous papers focus on the evolution of the understanding of project success, identification of success criteria and critical success factors. Critical success factors increase the potential for achieving project success, while project success can be evaluated with the help of success criteria. Although the interrelationships between critical success factors and success criteria are rarely analyzed, yet there is a strong demand f...
Projective relativity, cosmology and gravitation
International Nuclear Information System (INIS)
Arcidiacono, G.
1986-01-01
This book describes the latest applications of projective geometry to cosmology and gravitation. The contents of the book are; the Poincare group and Special Relativity, the thermodynamics and electromagnetism, general relativity, gravitation and cosmology, group theory and models of universe, the special projective relativity, the Fantappie group and Big-Bang cosmology, a new cosmological projective mechanics, the plasma physics and cosmology, the projective magnetohydrodynamics field, projective relativity and waves propagation, the generalizations of the gravitational field, the general projective relativity, the projective gravitational field, the De Sitter Universe and quantum physics, the conformal relativity and Newton gravitation
Improving Project Manufacturing Coordination
Directory of Open Access Journals (Sweden)
Korpivaara Ville
2014-09-01
Full Text Available The objective of this research is to develop firms’ project manufacturing coordination. The development will be made by centralizing the manufacturing information flows in one system. To be able to centralize information, a deep user need assessment is required. After user needs have been identified, the existing system will be developed to match these needs. The theoretical background is achieved through exploring the literature of project manufacturing, development project success factors and different frameworks and tools for development project execution. The focus of this research is rather in customer need assessment than in system’s technical expertise. To ensure the deep understanding of customer needs this study is executed by action research method. As a result of this research the information system for project manufacturing coordination was developed to respond revealed needs of the stakeholders. The new system improves the quality of the manufacturing information, eliminates waste in manufacturing coordination processes and offers a better visibility to the project manufacturing. Hence it provides a solid base for the further development of project manufacturing.
International Nuclear Information System (INIS)
Jain, A.K.; Chakraborty, D.K.
1994-01-01
Chamera Hydroelectric Project was selected by National Hydroelectric Power Corporation (NHPC) as a pilot project for accelerated development of hydro-power in the country. This project was considered to have certain distinct specialties from different aspects in comparison with other projects. In the first place, the field investigation for the project was completed in a record time of only eight months by deploying the most modern techniques. Secondly, Chamera was the first NHPC project with external aid both technically and financially. The third and most important of all the specialties was in the planned reduction of construction period to 6 years from the original estimate of 8 years. Such reduction of gestation period was considered to be the direct outcome of modern method of management, monitoring and improved imported technology. The investment decision in the project was taken in April '84 with an estimated cost of energy at busbar 44.12 paise/unit exclusive of return on equity capital and royalty payable to the home state. The all inclusive rate of power was estimated 75.86 paise/unit. (author). 4 tabs
Energy Technology Data Exchange (ETDEWEB)
Smith, Rhett [Schweitzer Engineering Laboratories Inc, Pullman, WA (United States)
2016-12-23
The SDN Project completed on time and on budget and successfully accomplished 100% of the scope of work outlined in the original Statement of Project Objective (SOPO). The SDN Project formed an alliance between Ameren Corporation, University of Illinois Urbana- Champaign (UIUC), Pacific Northwest National Laboratories (PNNL), and Schweitzer Engineering Laboratories, Inc. (SEL). The objective of the SDN Project is to address Topic Area of Interest 2: Sustain critical energy delivery functions while responding to a cyber-intrusion under Funding Opportunity Announcement DE-FOA-0000797. The goal of the project is to design and commercially release technology that provides a method to sustain critical energy delivery functions during a cyber intrusion and to do this control system operators need the ability to quickly identify and isolate the affected network areas, and re-route critical information and control flows around. The objective of the SDN Project is to develop a Flow Controller that monitors, configures, and maintains the safe, reliable network traffic flows of all the local area networks (LANs) on a control system in the Energy sector. The SDN team identified the core attributes of a control system and produced an SDN flow controller that has the same core attributes enabling networks to be designed, configured and deployed that maximize the whitelisted, deny-bydefault and purpose built networks. This project researched, developed and commercially released technology that: Enables all field networks be to configured and monitored as if they are a single asset to be protected; Enables greatly improved and even precalculated response actions to reliability and cyber events; Supports pre-configured localized response actions tailored to provide resilience against failures and centralized response to cyber-attacks that improve network reliability and availability; Architecturally enables the right subject matter experts, who are usually the information
International Nuclear Information System (INIS)
Parazin, R.J.
1998-01-01
This Project Execution Plan (PEP) defines the overall strategy, objectives, and contractor management requirements for the execution phase of Project W-519 (98-D403), Privatization Phase 1 Infrastructure Support, whose mission is to effect the required Hanford site infrastructure physical changes to accommodate the Privatization Contractor facilities. This plan provides the project scope, project objectives and method of performing the work scope and achieving objectives. The plan establishes the work definitions, the cost goals, schedule constraints and roles and responsibilities for project execution. The plan also defines how the project will be controlled and documented
Energy Technology Data Exchange (ETDEWEB)
Nowak, S.
2006-07-01
This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) presents an overview of the work done as part of the 2005 research programme, along with the abstracts of the annual reports of the project leaders on research projects. It presents the programme's main points of focus, discusses the work done and the results obtained. Areas covered include cell technology (13 reports), solar modules and building integration (3 reports) , system technology (4 reports) as well as various further projects (5) that are connected with photovoltaics. Four further reports concern international co-operation. Further, several pilot and demonstration (P+D) projects are discussed. Lists of all research and development projects and pilot and demonstration projects are supplied. Work done at several institutions in Switzerland and at leading commercial companies is described.
International Nuclear Information System (INIS)
Dairiki, J.M.; Browne, E.; Firestone, R.B.; Lederer, C.M.; Shirley, V.S.
1984-01-01
The Isotopes Project compiles and evaluates nuclear structure and decay data and disseminates these data to the scientific community. From 1940-1978 the Project had as its main objective the production of the Table of Isotopes. Since publication of the seventh (and last) edition in 1978, the group now coordinates its nuclear data evaluation efforts with those of other data centers via national and international nuclear data networks. The group is currently responsible for the evaluation of mass chains A = 167-194. All evaluated data are entered into the International Evaluated Nuclear Structure Data File (ENSDF) and are published in Nuclear Data Sheets. In addition to the evaluation effort, the Isotopes Project is responsible for production of the Radioactivity Handbook
Guidelines for Automation Project Execution
Takkinen, Heidi
2011-01-01
The purpose of this Master’s thesis was to create instructions for executing an automation project. Sarlin Oy Ab needed directions on how to execute an automation project. Sarlin is starting up a new business area offering total project solutions for customers. Sarlin focuses on small and minor automation projects on domestic markets. The thesis represents issues related to project execution starting from the theory of the project to its kick-off and termination. Site work is one importan...
The Role of the Project Management Office on Information Technology Project Success
Stewart, Jacob S.
2010-01-01
The rate of failed and challenged Information Technology (IT) projects is too high according to the CHAOS Studies by the Standish Group and the literature on project management (Standish Group, 2008). The CHAOS Studies define project success as meeting the triple constraints of scope, time, and cost. Assessing critical success factors is another…
Project evaluation: main characteristics
Moutinho, Nuno
2010-01-01
— The evaluation process of real investment projects must consider not only the traditional financial approach, but also non-financial aspects. Non financial analysis can provide additional relevant information about projects. We investigate financial and non-financial areas most relevant in project appraisal. We present main critical success factors and areas of analysis that lead to the perception of project success. Finally, companies are segmented to verify its financial and non-financial...
Draft project management update to the Iowa DOT Project Development Manual : final report.
2016-08-01
This work supported drafting project management guidance for the Iowa Department of Transportation (DOT). The goal is to : incorporate a greater focus on project management in their project development process. : A technical advisory committee (TAC) ...
International Nuclear Information System (INIS)
Wintczak, T.M.
2001-01-01
The purpose of this project specification is to provide an overall scoping and document for the Environmental Restoration project, and to provide a link between the overall Hanford Site scope and the ER project. The purpose of this project specification is to provide an overall scoping document for the ER Project, and to provide a link between the overall Hanford Site scope and the ER Project. Additionally, this specification provides an integrated and consolidated source of information for the Richland ER Project. It identifies the ER Project vision, mission, and goals, as well as the operational history of the Hanford Site, along with environmental setting and hazards. This ER Project Specification is part of the overall ER Project baseline
2013-11-05
Goals of this project were as follows: (1) Conduct a comprehensive evaluation study on Nevada's I-15 North Design Build Project; (2) Analyze project implementation with respect to construction zone rules by which the contractor had to abide; (3) Anal...
Fitting the project into the environment : Gulf Heavy Oil Red Cross Projects
International Nuclear Information System (INIS)
Sakires, D.G.; Johannesen, D.V.
1998-01-01
A reservoir delineation project by Gulf Canada's Heavy Oil Division was reviewed. The six well drilling program was completed in 1997 with minimal negative environmental impacts. The program, dubbed the Red Cross project, took place in the Northern Boreal Forest of Saskatchewan. Its success is attributed to the early involvement of the regulatory agencies in Saskatchewan, on-site environmental investigations, the development of an environmental protection plan, conscientious construction practices, a monitoring program during construction, and a pro-active reclamation plan. The project area is identified as being environmentally sensitive and important as a wildlife habitat area. This successful project demonstrated the usefulness of pre-project planning and team work between industry and the regulators. Details of the planning, construction and planned remedial reclamation actions are described. 11 refs., 2 tabs
International Nuclear Information System (INIS)
Knol, S.; Roelofs, F.; Fütterer, M.A.; Kohtz, N.; Laurie, M.; Buckthorpe, D.; Scheuermann, W.
2014-01-01
The European HTR R&D project ARCHER (Advanced High-Temperature Reactors for Cogeneration of Heat and Electricity R&D) builds on a solid HTR technology foundation in Europe, established through former national UK and German HTR programs and in European programs. ARCHER runs from 2011 to 2015 and targets selected HTR R&D subjects that would specifically support demonstration, with a focus on experimental effort. In line with the R&D and deployment strategy of the European Sustainable Nuclear Energy Technology Platform (SNETP) ARCHER contributes to maintaining, strengthening and expanding the HTR knowledge base in Europe to lay the foundations for demonstration of nuclear cogeneration with HTR systems. The project consortium encompasses conventional and nuclear industry, utilities, Technical Support Organizations, R&D organizations and academia. ARCHER shares results with international partners in the Generation IV International Forum and collaborates directly with related projects in the US, China, Japan, the Republic of Korea and South Africa. The ARCHER project is in its final year, and the paper comprises an overview of the achievements thus far for the different Sub Projects. (author)
2007-03-01
This course provides INDOT staff with foundational knowledge and skills in project management principles and methodologies. INDOTs project management processes provide the tools for interdisciplinary teams to efficiently and effectively deliver pr...
"Cheesy Pizza": The Pizza Project
Gallick, Barbara; Lee, Lisa
2009-01-01
A class of 3- to 5-year-old children in a midwestern child care center chose to study pizza restaurants as a group project. This article discusses how the project evolved, describes the three phases of the project, and provides the teachers' reflections on the project. Photos taken during the project and children's sketches are included. (Contains…
Management of research and development project
International Nuclear Information System (INIS)
Go, Seok Hwa; Hong Jeong Yu; Hyun, Byeong Hwan
2010-12-01
This book introduces summary on management of research and development project, prepare of research and development with investigation and analysis of paper, patent and trend of technology, structure of project, management model, management of project, management of project range, management of project time, management of project cost, management of project goods, management of project manpower, management of communication, management of project risk, management of project supply, management of outcome of R and D, management of apply and enroll of patent and management of technology transfer.
Waste Management Project Contingency Analysis
International Nuclear Information System (INIS)
Edward L. Parsons, Jr.
1999-01-01
The purpose of this report is to provide the office of Waste Management (WM) with recommended contingency calculation procedures for typical WM projects. Typical projects were defined as conventional construction-type activities that use innovative elements when necessary to meet the project objectives. Projects involve treatment, storage, and disposal of low level, mixed low level, hazardous, transuranic, and high level waste. Cost contingencies are an essential part of Total Cost Management. A contingency is an amount added to a cost estimate to compensate for unexpected expenses resulting from incomplete design, unforeseen and unpredictable conditions, or uncertainties in the project scope (DOE 1994, AACE 1998). Contingency allowances are expressed as percentages of estimated cost and improve cost estimates by accounting for uncertainties. The contingency allowance is large at the beginning of a project because there are more uncertainties, but as a project develops, the allowance shrinks to adjust for costs already incurred. Ideally, the total estimated cost remains the same throughout a project. Project contingency reflects the degree of uncertainty caused by lack of project definition, and process contingency reflects the degree of uncertainty caused by use of new technology. Different cost estimation methods were reviewed and compared with respect to terminology, accuracy, and Cost Guide standards. The Association for the Advancement of Cost Engineering (AACE) methods for cost estimation were selected to represent best industry practice. AACE methodology for contingency analysis can be readily applied to WM Projects, accounts for uncertainties associated with different stages of a project, and considers both project and process contingencies and the stage of technical readiness. As recommended, AACE contingency allowances taper off linearly as a project nears completion
Králová, Eliška
2013-01-01
Project management approaches are commonly used to write and implement business plans. In this thesis standard project management tools and methods are applied to a real project, which aims to improve the properties of the product it offers (an online educational game). This project is unique in that it is based on a voluntary basis, has limited resources and is very responsive to market demands. Project management is broken down into four stages according to the project life cycle: initiatio...
Rethinking Project Management in Denmark
DEFF Research Database (Denmark)
Svejvig, Per
2012-01-01
. The chapter argues for a rethinking process due to pervasiveness and complexity in the contemporary project environment where rethinking is needed in order to stay competitive. The suggested approach for the rethinking project management is a framing process where body of ideas is established......Projects are everywhere across different sectors, industries and countries. Project management is no longer a sub-discipline of engineering and other rather technical disciplines but is also used for many other purposes. Even though practice has changed dramatically over the years, the models...... and methodologies for project management has been fairly static and has therefore received substantial criticism for a lack of relevance to practice. Several scholars have therefore started to think more widely about projects and project management conceptualized as rethinking project management. However this theme...
International Nuclear Information System (INIS)
Carl-Erik Christoffersen
1996-01-01
Action plans for the prevention of contamination in the Arctic regions is concretized in a number of international projects. The Norwegian Radiation Protection Authority is responsible for the follow-up of 13 projects. The report describes the development of these projects in 1995
Project Management Performance Drivers
Ra’ad, Mohammed A.; Najdawi, Mohammad K.
2010-01-01
The practice of project management has gained enormous importance over the past several years in various business industries. “In industries as diverse as pharmaceuticals, software, and aerospace, projects drive business” (Wheatley). This gain of importance can be attributed to the magnitude of the impact project performance results in terms of time, cost, and scope have over the project performing entity. “On the basis of data released by the Bureau of Economic Analysis, part of the US De...
Project management practice and its effects on project success in Malaysian construction industry
Haron, N. A.; Devi, P.; Hassim, S.; Alias, A. H.; Tahir, M. M.; Harun, A. N.
2017-12-01
The rapid economic development has increased the demand for construction of infrastructure and facilities globally. Sustainable development and globalization are the new ‘Zeitgeist’ of the 21st century. In order to implement these projects successfully and to meet the functional aim of the projects within their lifetime, an efficient project management practice is needed. The aim of this study is to identify the critical success factors (CSFs) and the extent of use of project management practice which affects project success, especially during the implementation stage. Data were obtained from self-administered questionnaires with 232 respondents. A mixed method of data collection was adopted using semi-structured interview and questionnaire approach. The result of the analysis of data obtained showed that new and emerging criteria such as customer satisfaction, competency of the project team, and performance of subcontractors/suppliers are becoming measures of success in addition to the classic iron triangle’s view of time, cost and quality. An insight on the extent of use of different project management practice in the industry was also achieved from the study.
A desk evaluation review of project URT/5/007 tsetse fly eradication. Project desk evaluation
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-06-01
Project URT/5/007 was initiated in 1984 to assist the Government of the United Republic of Tanzania in developing membrane feeding technology for the mass breeding of tsetse flies, which is required for the application of the sterile insect technique to eradicate the tsetse fly from the island of Zanzibar. As the project progressed the objectives focused on the development of inter-related management practices with SIT to control and eventually eradicate the tsetse species infesting Zanzibar. As depicted by the project title, tsetse fly eradication on Zanzibar is the ultimate goal of on-going work of project URT/5/007; however, tsetse fly eradication is not the immediate objective of this project. The total budget of the project for the years 1984 through 1994 includes 53 man-months of expert services, $402,755 for equipment, and $1,959 for fellowship training. Additional funds for 57 man-months of fellowship training were provided from sources outside of the project. Resources provided by the United Republic of Tanzania for the project included staff, local facilities, and local running costs. A Desk Evaluation Review (DER) of Project URT/5/007 was requested by the Africa Section to provide an assessment of project achievements and to determine to what end the project may lead in the near future. Also the review could help determine how experiences gained during the developments of this project might be utilized in the management and implementation of similar projects in Tanzania or the region.
A desk evaluation review of project URT/5/007 tsetse fly eradication. Project desk evaluation
International Nuclear Information System (INIS)
1993-01-01
Project URT/5/007 was initiated in 1984 to assist the Government of the United Republic of Tanzania in developing membrane feeding technology for the mass breeding of tsetse flies, which is required for the application of the sterile insect technique to eradicate the tsetse fly from the island of Zanzibar. As the project progressed the objectives focused on the development of inter-related management practices with SIT to control and eventually eradicate the tsetse species infesting Zanzibar. As depicted by the project title, tsetse fly eradication on Zanzibar is the ultimate goal of on-going work of project URT/5/007; however, tsetse fly eradication is not the immediate objective of this project. The total budget of the project for the years 1984 through 1994 includes 53 man-months of expert services, $402,755 for equipment, and $1,959 for fellowship training. Additional funds for 57 man-months of fellowship training were provided from sources outside of the project. Resources provided by the United Republic of Tanzania for the project included staff, local facilities, and local running costs. A Desk Evaluation Review (DER) of Project URT/5/007 was requested by the Africa Section to provide an assessment of project achievements and to determine to what end the project may lead in the near future. Also the review could help determine how experiences gained during the developments of this project might be utilized in the management and implementation of similar projects in Tanzania or the region
Zhang, L.; Li, Y.; Wu, Q.
2013-05-01
Integrated Project Delivery (IPD) is a newly-developed project delivery approach for construction projects, and the level of collaboration of project management team is crucial to the success of its implementation. Existing research has shown that collaborative satisfaction is one of the key indicators of team collaboration. By reviewing the literature on team collaborative satisfaction and taking into consideration the characteristics of IPD projects, this paper summarizes the factors that influence collaborative satisfaction of IPD project management team. Based on these factors, this research develops a fuzzy linguistic method to effectively evaluate the level of team collaborative satisfaction, in which the authors adopted the 2-tuple linguistic variables and 2-tuple linguistic hybrid average operators to enhance the objectivity and accuracy of the evaluation. The paper demonstrates the practicality and effectiveness of the method through carrying out a case study with the method.
How Project Managers Really Manage: An Indepth Look at Some Managers of Large, Complex NASA Projects
Mulenburg, Gerald M.; Impaeilla, Cliff (Technical Monitor)
2000-01-01
This paper reports on a research study by the author that examined ten contemporary National Aeronautics and Space Administration (NASA) complex projects. In-depth interviews with the project managers of these projects provided qualitative data about the inner workings of the project and the methodologies used in establishing and managing the projects. The inclusion of a variety of space, aeronautics, and ground based projects from several different NASA research centers helped to reduce potential bias in the findings toward any one type of project, or technical discipline. The findings address the participants and their individual approaches. The discussion includes possible implications for project managers of other large, complex, projects.
... Navigation Bar Home Current Issue Past Issues The Alzheimer's Project Past Issues / Spring 2009 Table of Contents ... of this page please turn Javascript on. The Alzheimer's Project A 4-Part Documentary Series Starting May ...
Managing projects a team-based approach
Brown, Karen A
2010-01-01
Students today are likely to be assigned to project teams or to be project managers almost immediately in their first job. Managing Projects: A Team-Based Approach was written for a wide range of stakeholders, including project managers, project team members, support personnel, functional mangers who provide resources for projects, project customers (and customer representatives), project sponsors, project subcontractors, and anyone who plays a role in the project delivery process. The need for project management is on the rise as product life cycles compress, demand for IT systems increases, and business takes on an increasingly global character. This book adds to the project management knowledge base in a way that fills an unmet need—it shows how teams can apply many of the standard project management tools, as well as several tools that are relatively new to the field. Managing Projects: A Team-Based Approach offers the academic rigor found in most textbooks along with the practical attributes often foun...
Project Management with IT Security Focus
Felician Alecu; Paul Pocatilu; Sergiu Capisizu
2011-01-01
The paper focus on the main key points related to the IT security project management. The most important lifecycle stages are identified: IT security project proposal definition, project organization, project planning, quality planning, project team organization, IT security project activities management and project closing. The most important success factors for IT security projects are the support of top-management, customer satisfaction, prevention over remediation and continuous progress....
INDICATIVE MODEL OF DEVIATIONS IN PROJECT
Directory of Open Access Journals (Sweden)
Олена Борисівна ДАНЧЕНКО
2016-02-01
Full Text Available The article shows the process of constructing the project deviations indicator model. It based on a conceptual model of project deviations integrated management (PDIM. During the project different causes (such as risks, changes, problems, crises, conflicts, stress lead to deviations of integrated project indicators - time, cost, quality, and content. For a more detailed definition of where in the project deviations occur and how they are dangerous for the whole project, it needs to develop an indicative model of project deviations. It allows identifying the most dangerous deviations that require PDIM. As a basis for evaluation of project's success has been taken famous model IPMA Delta. During the evaluation, IPMA Delta estimated project management competence of organization in three modules: I-Module ("Individuals" - a self-assessment personnel, P-module ("Projects" - self-assessment of projects and/or programs, and O-module ("Organization" - used to conduct interviews with selected people during auditing company. In the process of building an indicative model of deviations in the project, the first step is the assessment of project management in the organization by IPMA Delta. In the future, built cognitive map and matrix of system interconnections of the project, which conducted simulations and built a scale of deviations for the selected project. They determined a size and place of deviations. To identify the detailed causes of deviations in the project management has been proposed to use the extended system of indicators, which is based on indicators of project management model Project Excellence. The proposed indicative model of deviations in projects allows to estimate the size of variation and more accurately identify the place of negative deviations in the project and provides the project manager information for operational decision making for the management of deviations in the implementation of the project
DIPLOMA PROJECT TEAM WORK MANAGEMENT
Directory of Open Access Journals (Sweden)
V. S. Kruglyk
2014-04-01
Full Text Available During the work performance students should get the maximal approach to the process of real project execution, so the project should include the need to use the latest technology, integration of data or services with different developments, architecture design, interaction of the team members and others. Implementation of graduation projects is the useful activity for the acquisition and consolidation of key IT competencies. Since the task of educational projects is maximal close to real one, students participate almost in all typical stages of commercial product’s development, and do so successfully. This is also confirmed practically: students, who were actively engaged in some projects at the university, have key positions in IT companies of the city and country after that. The main objective of the paper is to describe the organization of a common group students’ work on a degree project, implementation peculiarity of such projects, recommendations for improving the quality of projects. Thus, the paper is devoted to the peculiarities of the joint students’ work on a project during diploma execution in IT specialties, as the final part of the acquisition and consolidation process of key IT competencies of future programmers. The problem of choosing work topic, project concept, work organization in a group, implementation process organization has been considered. Also the specific stages of software development have been considered: development of interface, choice of technology, product quality, project disposal to the next developers, project completion.
Pingston hydroelectric project - stage 2 project report : volume 1 of 2
International Nuclear Information System (INIS)
1999-01-01
The British Columbia Environmental Assessment Office has reviewed an application by Canadian Hydro Developers (B.C.) Inc., to develop the Pingston Hydroelectric Project, a run-of-river facility, located 60 km south of Revelstoke, British Columbia. The review includes an evaluation of any social and environmental impacts, including the effects on migratory birds, small mammals, amphibians, fish, wildlife, water quality, noise and visual aspects, that would be associated with the project. One consideration in selecting the project site was its ease of access along existing roadways and close proximity to power lines, another, the absence of any potential effects on fish and fish habitat. The project is also expected to have a negligible effect on water quality- related matters such as sediment transport, nutrient trapping in the headpond, and movement of large organic debris through the system. The project will not impact on archaeological resources, offers a renewable supply of energy and represents an overall positive effect on air quality for British Columbia. BC Hydro has committed to providing electrical interconnection to the main grid. 9 refs., 5 tabs., 14 figs., 9 appendices
Assessment of Project Website Sustainability: Case of the Arctic EIA Project
Directory of Open Access Journals (Sweden)
Sonja H Bickford
2016-07-01
Full Text Available In many cases, temporary websites may be simple, accessible solutions for knowledge management and dissemination of information. However, such sites may become outdated as the funding ends, but yet in many cases, still publicly available through the Internet. The issue of website sustainability is a relevant topic for all organizations that have websites. Website lifecycle, knowledge management, and website sustainability issues are discussed through a theoretical-based literature review. These issues are then summarized and used as lessons learned for the case study approach of this paper. The aim is to identify a solution to address a website’s life and longevity, post project. A practical case study assessment of the issue of project website sustainability is needed to address the website’s longevity—post project—as creation is often made through temporary endeavors. Recommendations for future project websites are made as the outcomes and results of this study and are expressed in the form of suggested practices for project website sustainability in future projects.
Projected coupled cluster theory.
Qiu, Yiheng; Henderson, Thomas M; Zhao, Jinmo; Scuseria, Gustavo E
2017-08-14
Coupled cluster theory is the method of choice for weakly correlated systems. But in the strongly correlated regime, it faces a symmetry dilemma, where it either completely fails to describe the system or has to artificially break certain symmetries. On the other hand, projected Hartree-Fock theory captures the essential physics of many kinds of strong correlations via symmetry breaking and restoration. In this work, we combine and try to retain the merits of these two methods by applying symmetry projection to broken symmetry coupled cluster wave functions. The non-orthogonal nature of states resulting from the application of symmetry projection operators furnishes particle-hole excitations to all orders, thus creating an obstacle for the exact evaluation of overlaps. Here we provide a solution via a disentanglement framework theory that can be approximated rigorously and systematically. Results of projected coupled cluster theory are presented for molecules and the Hubbard model, showing that spin projection significantly improves unrestricted coupled cluster theory while restoring good quantum numbers. The energy of projected coupled cluster theory reduces to the unprojected one in the thermodynamic limit, albeit at a much slower rate than projected Hartree-Fock.
Microsoft Project 2010 The Missing Manual
Biafore, Bonnie
2010-01-01
Microsoft Project is brimming with features to help you manage any project, large or small. But learning the software is only half the battle. What you really need is real-world guidance: how to prep your project before touching your PC, which Project tools work best, and which ones to use with care. This book explains it all, helping you go from project manager to project master. Get a project management primer. Discover what it takes to handle a project successfullyLearn the program inside out. Get step-by-step instructions for Project Standard and Project ProfessionalBuild and refine your
Managing clinical improvement projects.
Phillips, Joanna; Simmonds, Lorraine
This paper, the second of a three-part series looking at change management tools, provides a practical guide on how to use common project management principles in practice. Much of the literature on project management focuses on the business arena, with little reference to clinical settings. Identifying this literature and understanding its relevance to managing projects in healthcare can be difficult. This article provides a practical guide to identifying the key principles of good project management and applying these in health settings.
Project financing renewable energy schemes
International Nuclear Information System (INIS)
Brandler, A.
1993-01-01
The viability of many Renewable Energy projects is critically dependent upon the ability of these projects to secure the necessary financing on acceptable terms. The principal objective of the study was to provide an overview to project developers of project financing techniques and the conditions under which project finance for Renewable Energy schemes could be raised, focussing on the potential sources of finance, the typical project financing structures that could be utilised for Renewable Energy schemes and the risk/return and security requirements of lenders, investors and other potential sources of financing. A second objective is to describe the appropriate strategy and tactics for developers to adopt in approaching the financing markets for such projects. (author)
Reference projections for greenhouse gases in the Netherlands: emission projections for 2001 - 2010
Wijngaarden R van den; Ybema JR; Gijsen A; Oude Lohuis JA; Thomas R; Daniels B; Dril AWN van; Volkers CH; Energieonderzoek Centrum; LAE
2002-01-01
The results are presented of the project 'reference projection for energy and greenhouse gases' carried out by RIVM and ECN for the Ministries of Housing, Spatial Planning and the Environment, and of Economic Affairs. The reference projection considers emission of greenhouse gases in
IX Disposition Project - project management plan
International Nuclear Information System (INIS)
Choi, I.G.
1994-01-01
This report presents plans for resolving saving and disposal concerns for ion exchange modules, cartridge filters and columns. This plan also documents the project baselines for schedules, cost, and technical information
Battleground Energy Recovery Project
Energy Technology Data Exchange (ETDEWEB)
Bullock, Daniel [USDOE Gulf Coast Clean Energy Application Center, Woodlands, TX (United States)
2011-12-31
In October 2009, the project partners began a 36-month effort to develop an innovative, commercial-scale demonstration project incorporating state-of-the-art waste heat recovery technology at Clean Harbors, Inc., a large hazardous waste incinerator site located in Deer Park, Texas. With financial support provided by the U.S. Department of Energy, the Battleground Energy Recovery Project was launched to advance waste heat recovery solutions into the hazardous waste incineration market, an area that has seen little adoption of heat recovery in the United States. The goal of the project was to accelerate the use of energy-efficient, waste heat recovery technology as an alternative means to produce steam for industrial processes. The project had three main engineering and business objectives: Prove Feasibility of Waste Heat Recovery Technology at a Hazardous Waste Incinerator Complex; Provide Low-cost Steam to a Major Polypropylene Plant Using Waste Heat; and Create a Showcase Waste Heat Recovery Demonstration Project.
International Nuclear Information System (INIS)
Ogilvie, M.C.
1999-01-01
Analytic methods for Abelian projection are developed. A number of results are obtained related to string tension measurements. It is proven that even without gauge fixing, Abelian projection yields string tensions of the underlying non-Abelian theory. Strong arguments are given for similar results in the case where gauge fixing is employed. The methods used emphasize that the projected theory is derived from the underlying non-Abelian theory rather than vice versa. In general, the choice of subgroup used for projection is not very important, and need not be Abelian. While gauge fixing is shown to be in principle unnecessary for the success of Abelian projection, it is computationally advantageous for the same reasons that improved operators, e.g., the use of fat links, are advantageous in Wilson loop measurements. Two other issues, Casimir scaling and the conflict between projection and critical universality, are also discussed. copyright 1999 The American Physical Society
International Nuclear Information System (INIS)
Etcheber, Pascal
1998-01-01
A 'sensitive' project needs to be managed differently from a 'normal' project. This statement might seem simple enough. However, it does not seem to be a simple task to prove it in twenty minutes. This paper is an attempt to share with the audience some of the experiences the company had dealing with sensitive projects. It describes what a sensitive project is, though of all people, the 'nuclear' should know. Then the common mistakes are described, that are made in the hoping that some personal experiences are recognised. Finally the company's strategy is shown, how we foster third party support and the main tools to be used. Ultimately, success is ensured by having a sufficient quantity of allies. A sensitive project does not die because it has too many opponents, but because it has too few allies. Finding and helping allies to act is the thrust of our activity. It enables sensitive projects which deserve to succeed to do so, where traditional management fails miserably
Project Investment and Project Financing: A study on Business Case and Financing Models
Wang, Simiao
2012-01-01
Uncertainty is a very significant factor that must be taken into consideration in project front-end phase management. By taking into uncertainty, the planners can to a great extent make sure that the business case could be accurate between specific intervals, hence business case can be based on to make decision. In a highly uncertain environment; the project sponsors should prefer other means to finance the project rather than using debt. Risk management is extremely important in project fina...