
Sample records for van den bor

  1. van den Heuvel, Prof. Edward P J

    Indian Academy of Sciences (India)

    van den Heuvel, Prof. Edward P J . Date of birth: 2 November 1940. Address: Professor of Astrophysics, Astronomical Inst. Anton Pannekoek, Postbus 94249, 1090 GE Amsterdam, The Netherlands Contact: Office: (+31-20) 525 ...

  2. Joop van den Bremen, Streektaalmuziek in Nederland

    NARCIS (Netherlands)

    A.J.C. van der Hoeven (Arno)


    textabstractIn 1996, folk music fan Joop van den Bremen started his website Streektaalmuziek in Nederland (“Regional language music in the Netherlands”).1 On this website he collects information on Dutch musicians singing in dialect.2 As of September 2014, his still expanding database contains 6,164

  3. 'Welzijnsvloer verdient zich op den duur terug'; van den Berg beproeft de groene vlag roostervloer

    NARCIS (Netherlands)



    Het onderzoek van Wageningen UR naar de welzijnsvloeren is nog in volle gang. Maar vleeskalverhouder Wijnand van den Berg uit Kootwijkerbroek heeft op eigen initiatief al een welzijnsrooster in zijn stal op proef

  4. Philipp van den Bossche – Sac. Caes. Mai. Phrygiarius

    Czech Academy of Sciences Publication Activity Database

    Bukovinská, Beket

    -, č. 0130 (2015), s. 1-18 ISSN 2190-3328 Institutional support: RVO:68378033 Keywords : Philipp van den Bossche * Prague court * Rudolph II * Kunstkammer Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Groei van ongelijkjarige mengingen van grove den en berk op arme zandgronden; resultaten van metingen in 22 opstanden op de Veluwe en de Sallandse Heuvelrug

    NARCIS (Netherlands)

    Wijdeven, S.M.J.; Oosterbaan, A.; Berg, v.d. C.; Jole, van M.


    Het voorkomen en de groei van berk in ongelijkjarige mengingen van grove den en berk is bepaald op basis van opstandgemiddelden. Er is geen duidelijk verband tussen het voorkomen en de groei van berk en de schermdichtheid van grove den. Actuele groeigegevens zijn noodzakelijk voor een nadere

  6. Vrouekarakters in enkele prosawerke van C.M. van den Heever

    Directory of Open Access Journals (Sweden)

    E. Botha


    Full Text Available The role of women in some prose works of C.M. van den Heever Re-reading the C.M. van den Heever “classics” Somer (1935 and Laat vrugte (1939 within the framework of Van den Heever criticism through the years, one becomes aware that central themes in his oeuvre are acted out by women. The beautiful young girl Linda in Somer embodies the sadness of the transcience of beauty and happiness. Through Ouma Willa, Betta and Johanna – three women from three generations in Laat vrugte – the theme of the endurance of the memory of love and passion beyond decay and death is expressed. A cursory examination of other and earlier works by Van den Heever – Op die plaas (1927, Langs die grootpad (1928, Kromburg (1937 and the short story “Leuens” (Lies from Vuurvlieg en sterre (1934 – bears out the observation that women express core meanings in C.M. van den Heever’s prose works.

  7. Over den invloed van insuline op de permeabiliteit der weefsels voor glucose

    NARCIS (Netherlands)

    Hamburger, Rudolf Jacobus


    In het voorafgaande overzicht van de literatuur, hebben wij gezien, dat vooral vele proeven in vivo, erop wijzen, dat bij diabetes, zoowel van den mensch als bij door pancreasextirpatie diabetisch gemaakte proefdieren minder glucose in de weefsels voorkomt en eveneens minder glucose daarin wordt

  8. Tussen de mazen van het net : drie Poolse mannen in Den Haag aan het woord

    NARCIS (Netherlands)

    Karijn Nijhoff

    In deze publicatie staan de verhalen van drie Poolse mannen in Den Haag centraal. De onderzoeker, Karijn Nijhoff, heeft zeer intensief deze mannen gevolgd en hun verhalen opgetekend. We lezen over aankomst, vertrek en terugkomst. We zien een grillig proces van werken en niet werken, klussen en

  9. Threatened fishes of the world: Coptodon walteri (Thys van den Audenaerde 1968 (Perciformes: Cichlidae

    Directory of Open Access Journals (Sweden)

    Konan Felix Koffi


    Full Text Available Coptodon walteri Thys van den Audenaerde 1968, an endemic cichlid of Ivory Coast and Liberia, is assessed as Near Threatened due to fishing pressure and loss of habitats, and aquatic pollution as a result of extensive clandestine gold mining in the bed of the Cavally River. There is an immediate need for developing conservation and management plans for this species.

  10. Johannes van den Berg, Constrained by Jesus' Love. An Inquiry into ...

    African Journals Online (AJOL)

    Johannes van den Berg, Constrained by Jesus' Love. An Inquiry into the Motives of the missionary Awakening in Qreat Britain in the Period between 1698 and 1815, J. H. Kok, N.V., Kampen, 1956. P.S Dreyer. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT ...

  11. The utopian challenge to global capitalism by Walter van den Broeck in Terug naar Walden

    Directory of Open Access Journals (Sweden)

    Andries Visagie


    Full Text Available The socialist sympathies that inform the writing of Flemish author Walter van den Broeck align him with a well-established tradition of socially engaged writing in Flanders. In his novel Terug naar Walden (Back to Walden, published in 2009, he revisits the Walden project of the Dutch reformer and writer Frederik van Eeden (1860−1932. Van den Broeck suggests that a reconsideration of the socialist ideals that inspired Van Eeden to establish settlements in the Netherlands and the United States is warranted in the light of the economic crisis triggered by unchecked capitalist practices in 2008. In Terug naar Walden Ruler Marsh, the richest man in the world, unleashes a global financial crisis as a form of retaliation against the capitalist system that ruined his parents. Marsh returns to the Kempen in Flanders where his family originated. In a Heideggerean affirmation of the local as exemplified by the country road, Van den Broeck articulates his vision of the common, that theorists Michael Hardt and Antonio Negri in their Empire trilogy have attempted to salvage from communist thinking, with a utopian notion that a stronger connection with the land and the people within one’s immediate environment may provide a useful premise for the development of viable alternatives to capitalism.

  12. Van strafbaar tot huwbaar : homorecht wereldwijd (presentatie op Ministerie van Buitenlandse Zaken, Den Haag)

    NARCIS (Netherlands)

    Waaldijk, C.


    Met de door hem ontwikkelde Global Index on Legal Recognition of Homosexual Orientation (GILRHO) geeft Kees Waaldijk op een schaal van nul tot acht aan, hoe ver een land is met het uit het strafrecht halen van homoseksualiteit, met het verbieden van homodiscriminatie en met het erkennen van

  13. Dirc van Delfts Tafel van den Kersten Ghelove en de stervensliteratuur

    DEFF Research Database (Denmark)

    Robbe, Joost Roger


    treatise, Dirc van Delft presents a veritable ars moriendi which provides practical guidance for the dying and those attending them. The treatise culminates in a vivid drama in which the soul, being subject to three temptations of the devil, can benefit from the protection of its guardian angel as well...

  14. Honors and Theater: Spinoza's Pedagogical Experience and His Relation to F. Van Den Enden (United States)

    Rovere, Maxime


    Franciscus Van den Enden (1602-1674) is commonly considered as the man who taught Latin to B. de Spinoza (1632-1677). It is unknown if he actually taught him something else, but we do know he used a pedagogy of his own and made the young philosopher aware of the importance of pedagogical issues. The present article helps to document their…

  15. ‘Men zou Virgilius zien opgaen in zijn’ tolck’. De functie van Vergilius in het artistiek ondernemerschap van Joost van den Vondel

    Directory of Open Access Journals (Sweden)

    Sophie Reinders


    Full Text Available This article analyzes Joost van den Vondel's career strategies and shows that the ambition for obtaining patronage as a poet played a crucial role in the dedications of his consecutive Vergil translations. In the period 1646-1660 Vondel published three Dutch translations of Vergil, one in prose, one 'preview' of the poetry translation, and a final translation of the complete works rendered in verse. For each of the individual dedicatees, the Prince of Orange, the son of the Amsterdam burgomaster Cornelis de Graeff, and the mighty burgomaster himself, the publications' paratexts work to achieve a single goal by means of this work of art: obtaining structural patronage for composing an epic.

  16. Diagnosis of Van den Ende-Gupta syndrome: Approach to the Marden-Walker-like spectrum of disorders. (United States)

    Niederhoffer, Karen Y; Fahiminiya, Somayyeh; Eydoux, Patrice; Mawson, John; Nishimura, Gen; Jerome-Majewska, Loydie A; Patel, Millan S


    Marden-Walker syndrome is challenging to diagnose, as there is significant overlap with other multi-system congenital contracture syndromes including Beals congenital contractural arachnodactyly, D4ST1-Deficient Ehlers-Danlos syndrome (adducted thumb-clubfoot syndrome), Schwartz-Jampel syndrome, Freeman-Sheldon syndrome, Cerebro-oculo-facio-skeletal syndrome, and Van den Ende-Gupta syndrome. We discuss this differential diagnosis in the context of a boy from a consanguineous union with Van den Ende-Gupta syndrome, a diagnosis initially confused by the atypical presence of intellectual disability. SNP microarray and whole exome sequencing identified a homozygous frameshift mutation (p.L870V) in SCARF2 and predicted damaging mutations in several genes, most notably DGCR2 (p.P75L) and NCAM2 (p.S147G), both possible candidates for this child's intellectual disability. We review distinguishing features for each Marden-Walker-like syndrome and propose a clinical algorithm for diagnosis among this spectrum of disorders. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  17. Van den Wyngaerde, una vista de Belmonte y la campaña de trabajo de 1563

    Directory of Open Access Journals (Sweden)

    Ibáñez Martínez, Pedro Miguel


    Full Text Available This article studies a topographical view of Belmonte, a small town in the province of Cuenca, painted by Anton Van den Wyngaerde, a Flemish artist. The analysis of the work allows us to penetrate in some problems that have an effect on the knowledge of his production. In particular it is very important the long campaign of work developed by the painter through the lands of the Kingdom of Aragón in 1563. The view of Belmonte will be just the final point of his trip, that can be only understood in relation with the journey Philip II made through the same lands some months later. The present article ends in a detailed exam of the drawing, contrasting it with the own historical reality of Belmonte as for its general composition and details.

    Este artículo estudia una panorámica de la villa de Belmonte (Cuenca, obra del pintor flamenco Anton Van den Wyngaerde. El análisis de la pieza nos permite profundizar en alguno de los problemas que afectan al conocimiento de su producción. Interesa en particular la larga campaña de trabajo desarrollada por el artista en 1563, a través de los territorios de la Corona de Aragón. La vista de Belmonte constituiría precisamente el punto final de la expedición, que sólo puede ser entendida en conexión con el viaje efectuado por Felipe II, unos meses más tarde, por los mismos territorios. El artículo concluye con un detenido examen del dibujo, contrastándolo en su composición general y detalles con la propia realidad histórica de Belmonte.

  18. Heldenmoed, huwelijkstrouw en vrouweneer. Bakhuizen van den Brink en de 'nijvere huisbestierster' Brecht Proosten († ca. 1592

    Directory of Open Access Journals (Sweden)

    E. Kloek


    Full Text Available 'Heroism, marital fidelity and women's honour'. Bakhuizen van den Brink and the 'diligent housewife'. Brecht Proosten († circa 1592'Heroism, marital fidelity and women's honour' is an account of the quest for Brecht Proosten, a 'diligent housewife' and contemporary of the Dutch writer Vondel, who was praised by the historian Bakhuizen van den Brink, in his famous article 'Vondel met Roskam en Rommelpot'(Gids, 1837, though he failed to explain why she was so exemplary. The story is all about the wife of Kies, Mayor of Haarlem who hid her husband in the family home during the wave of religious persecutions under the reign of the Duke of Alva. She almost gave her husband away by becoming pregnant, but rather than betray him she sacrificed her reputation instead by telling the sheriff that the child could have been fathered by almost anyone. Bakhuizen must have read this story in Hooft's Histoorien (1642. In another publication (1843 Bakhuizen praised her for not mincing her words, however, not all of his contemporaries agreed with him on this point. During the first half of the 19th Century the story of Brecht Proosten's marital fidelity was frequently recounted, though it was noticeable that most authors only dared to write about it in covert terms. When Bakhuizen's ex-fiancée, the famous author Truitje Toussaint, removed the 'sting' from the tale in 1850 by leaving out the episode about the questionable fatherhood and her willingness to sacrifice her reputation, Brecht Proosten finally fell into oblivion.

  19. Policy beyond the horizon. Climate policy in Den Bosch, Netherlands; Beleid tot achter de horizon. Totstandkoming van klimaatbeleid in de gemeente 's-Hertogenbosch

    Energy Technology Data Exchange (ETDEWEB)

    Backus, G.B.C.


    In 's-Hertogenbosch (a.k.a. Den Bosch), the Netherlands, the municipal auditing committee was asked by the city council to evaluate the city's climate policy, looking at both design and implementation. Progress on the long-term aim of climate-neutrality proved to be lagging behind. The aim of the audit was to establish what policy targets have been set, whether the stated ambitions are realistic, why target realisation is not on track, and what kind of strategies and corrective action might be pursued to rectify the situation. The learning effects of the audit have spin-off for more than just climate policy, as the city, and city hall, face issues relating to long-term policy (development, steering, validation) in other areas, too. The topic of climate (policies, targets) is currently on the agenda of many Dutch municipalities. In their work, the Den Bosch municipal auditing committee were supported by several CE Delft consultants [Dutch] De Rekenkamercommissie 's-Hertogenbosch heeft op verzoek van de gemeenteraad onderzoek verricht naar de totstandkoming en uitvoering van het klimaatbeleid in 's-Hertogenbosch. De lange termijndoelen rondom het bereiken van klimaatneutraliteit bleken achter te lopen. Het doel van het onderzoek was om na te gaan welke beleidsdoelen geformuleerd zijn, of de daarbij geformuleerde verwachtingen reëel zijn, wat de oorzaken zijn van het lagere dan beoogde realisatietempo, en welke mogelijke oplossingsrichtingen en (bij)sturingsmogelijkheden er zijn. De leereffecten van het onderzoek zijn breder dan alleen het klimaatbeleid. Er zijn meer terreinen waarop de gemeente(raad) te maken krijgt met ontwikkeling, sturing en controle van doelen op de langere termijn. Het onderwerp (klimaatbeleid/klimaatdoelen) is bij veel gemeenten actueel. De Rekenkamercommissie heeft zich bij dit onderzoek laten ondersteunen door onderzoekers van bureau CE Delft.

  20. Book received: Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

    Directory of Open Access Journals (Sweden)

    Paul van den Akker


    Full Text Available Paul van den Akker, Looking for Lines: Theories of the Essence of Art and the Problem of Mannerism, Amsterdam: Amsterdam University Press 2010 including preface, contents and introduction.

  1. 08Van den Bergh

    African Journals Online (AJOL)


    1880-1881 and seriously disrupted by the spilling over of the Uitlander tensions on ... General Bryan Mahon on 11 June 1900, ostensibly as part of the routine pacification .... dictated that De Wet first move northward across the Gatsrand to the ...

  2. Rapport van het onderzoek naar de kosten, verbonden aan het bewaren van consumptie-aardappelen

    NARCIS (Netherlands)



    Het doel van deit rapport is vast te stellen hoe het verloop van den prijs van consumptie-aardappelen gedurende den winter en het voorjaar moet zijn om de gemaakte kosten en het verlies aan product goed te maken.

  3. Evaluation of BOR-60 operation safety

    International Nuclear Information System (INIS)

    Minakov, A.A.; Antipin, G.K.; Efimov, V.N.; Kuzin, G.G.; Eschenko, L.V.; Eschenko, S.N.


    In this communication, BOR-60 reactor operation anomalies capable to produce a dangerous overheating of the core (SDC) is examined. On bases of calculations and reactor operation experience an event tree for SDC is built. Evaluations of probable anomalies entering in the event tree and reactor parameters modifications in case of anomalies are presented. In conclusion BOR-60 agree with the sovietic nuclear safety [fr

  4. Hartbewaking in de pre-hospitale fase : onderzoek naar de activiteiten van de ambulanceverpleegkundigen van de G. G. en G.D. Rotterdam voor en tijdens het vervoer van patiënten met een vermoedelijk acuut ischaemisch hartlijden

    NARCIS (Netherlands)

    H.N. Hart


    textabstractHet feit, dat 50-60% van alle sterfgevallen tengevolge van een acuut myocardinfarct buiten het ziekenhuis plaatsvond, werd voor het eerst door Pantridge et al. (1967, 1971) in Belfast vastgelegd. Op grond daarvan veranderden zij enkele ambulances in rijdende coronary care units en

  5. Possibilities of sustainable development the RTB Bor

    Directory of Open Access Journals (Sweden)

    Zeković Slavka


    Full Text Available The paper analysis the medium and long-term perspectives, framework and considered possibilities of sustainable development of RTB "Bor" in the period of transition. It is today the giant in the best quality copper production in the Balkans. In the paper are elaborated the problems of privatization, debt, investment, growth of copper production from own mines (and imported raw, opening of new mines, economical efficiency of production, environmental problems and impacts in the last time. The RTB "Bor" is a serious hot spot in Serbia. Unsustainability trends and process are identified, as follows: open-pit waste dumps, flotation tailings, mining and processing waste waters, air pollution; inefficiency useful of energy water and other inputs in copper complex; trans boundary character of emissions of dust; environmental degradation and quality of wide area and ecologically highly risk, etc.


    Directory of Open Access Journals (Sweden)

    Abdul Muhith


    Full Text Available Introduction: Bed Occupancy Ratio (BOR in RSI Arafah Mojosari during the last three years are at under ideal rate and the lowest of the three existing hospitals in the area of Mojosari. The purpose of this study was to determine the relationship marketing mix with Bed Occupancy Ratio in RSI Arafah Mojosari. Methods: This research uses analytic methods with crossectional approach. Variables in the study is marketing mix and Bed Occupancy Ratio (BOR. The population in this study were all patients hospitalized in the RSI Arafah Mojosari. Samples amounted 44 respondents taken by the Stratified random sampling technique. Data were collected using the questionnaire and analyzed using Fisher's Exact test. Result: The results obtained more than 50% of respondents (59.1% rate well against the marketing mix is developed by the hospital management and the majority of respondents (79.5% are in the treatment room that has a number BOR is not ideal. Fisher Exact test test results obtained probabililty value=0.02<0.05 so that H0 is rejected, which means there is a relationship marketing mix with the Bed Occupancy Ratio in RSI Arafah Mojosari. Discussion: Hospitals which able to develop the marketing mix very well, can attract consumers to use inpatient services at the hospital, with that BOR value will increase as the increased use of inpatient services. Hospital management must be able to formulate a good marketing mix strategy that hospital marketing objectives can be achieved. Conformity between service quality and service rates must be addressed, otherwise it extent of media promotions can attract patients to inpatient services.

  7. Innovative Informations- und Kommunikationswege an wissenschaftlichen Bibliotheken: 10 Fragen über Anwendungen und Erfahrungen von Web 2.0 bis Emerging Technologies von Bruno Bauer an Guus van den Brekel, Informationsexperte an der Medizinischen Bibliothek der Universität Groningen / Innovative information and communication systems for scientific libraries: 10 questions about practice and experience covering Web 2.0 to Emerging Technologies. An interview with Guus van den Brekel, information specialist for the medical library at Groningen University (Netherlands by Bruno Bauer

    Directory of Open Access Journals (Sweden)

    van den Brekel, Guus


    Full Text Available Guus van den Brekel is information specialist and IT-Coordinator for the Central Medical Library at the University Medical Center Groningen (Netherlands. There he is responsible for innovation and for the development of new library services. The present interview informs about the meaning and benefit of Web 2.0 and Emerging Technologies, about the advantage of Blogs and Twitter and the importance of mobile applications for libraries. Furthermore the interview deals with the future role of library.

  8. Het geheim van Alibaba

    NARCIS (Netherlands)

    den Butter, F.A.G.; Wu, X.


    Alibaba is in korte tijd uitgegroeid tot het grootste internet handelsplatform in de wereld. Volgens de Amsterdamse hoogleraar Frank den Butter en de Chinese studente Xiaoyi Wu weet Alibaba uitstekend in te spelen op de Chinese cultuur en instituties bij het omlaag brengen van de kosten van

  9. Het effect van creatief schrijven op het lezen van korte verhalen

    NARCIS (Netherlands)

    Janssen, T.; van den Bergh, H.


    Schrijven en lezen zijn complementaire vaardigheden, niet alleen bij referentiële teksten, maar ook bij fictionele. Janssen en Van den Bergh doen verslag van een onderzoek naar de invloed van creatief schrijven op het lezen van verhalen. Als leerlingen, voorafgaand aan het lezen van een verhaal, een

  10. Calculated investigation of actinide transmutation in the BOR-60 reactor

    International Nuclear Information System (INIS)

    Zhemkov, I.Yu.; Ishunina, O.V.; Yakovleva, I.V.


    One of the prospective actinide burner reactor type is the fast reactor with a 'hard' spectrum and small breeding factor, which is the BOR-60. The calculated investigations demonstrate that Loading up to 40% of minor-actinides to the BOR-60 reactor did not lead to the considerable change of neutron-physical characteristics. The performed calculations show that the BOR- 60 reactor possesses a high efficiency of the minor-actinide and plutonium bum-up (up to 37 kg/(TW · h)) hat is comparable with properties of the actinide burner-reactors under design. The BOR-60 reactor can provide a homogeneous minor-actinide Loading (minor-actinide addition to the standard fuel) to the core and heterogeneous Loading (as separate assemblies-targets with a high minor-actinide fraction) to the first rows of a radial blanket that allows the optimum usage of the reactor and its characteristics. (authors)

  11. Case note: EuGH (Az. C-137/09 (Marc Michel Josemans/Burgemeester van Maastricht): Verbot des Zutritts zu Coffeeshops für nicht in den Niederlanden ansässige Personen)

    NARCIS (Netherlands)

    Purnhagen, K.


    Die Coffeeshops in den Niederlanden sind Einrichtungen, deren Haupttätigkeit im Verkauf von Marihuana und Haschisch besteht. Der Besitz dieser Cannabis-Produkte zum persönlichen Gebrauch ist straffrei und ihr Verkauf wird von den Behörden geduldet. Nach den staatsanwaltlichen Richtlinien dürfen in

  12. Den gode handling og den gode grund

    DEFF Research Database (Denmark)

    Dehs, Jørgen


    Den tyske filosof Immanuel Kant er aktuel i dagens etik-debat. "Grundlæggelse af moralens metafysik".......Den tyske filosof Immanuel Kant er aktuel i dagens etik-debat. "Grundlæggelse af moralens metafysik"....

  13. Den gode argumentations anatomi

    DEFF Research Database (Denmark)

    Kock, Christian Erik J


    God argumentation har tre dimensioner: Den er faktuelt retvisende, den er relevant, og den er vægtig. Desværre slipper politikerne ofte af sted med mangelfuld argumentation fordi de forklæder den godt. Derfor får du her de vigtigste redskaber til at spotte uskikkene i politisk argumentation...

  14. Seasonal and daily patterns of group size, cohesion and activity of the estuarine dolphin, Sotalia guianensis (P.J. van Bénéden (Cetacea, Delphinidae, in southern Brazil Padrões sazonais e diários do tamanho de grupo, coesão e atividade do boto-cinza, Sotalia guianensis (P.J. van Bénéden (Cetacea, Delphinidae, no sul do Brasil

    Directory of Open Access Journals (Sweden)

    Fábio G. Daura-Jorge


    Full Text Available The resident population of estuarine dolphin, Sotalia guianensis (P.J. van Bénéden, 1864, in Norte Bay, Santa Catarina, southern Brazil, was studied from 2000 to 2003. Systematic one-day cruises were undertaken aboard a 5 m sail boat equipped with an outboard motor. Applying the focal-group method, information such as geographical position, predominant behavioural patterns, group size, cohesion index and the presence of calves, were registered at every five-minute interval, totalling 198 hours of direct observation of the dolphins. The estuarine dolphin used preferential areas for each behavioural pattern. The mean group size was approximately 29 individuals, and the presence of calves occurred throughout the entire year, but with a significant increase in the warm seasons. The frequency of behavioural patterns and group size varied according to season and time of day, and were strongly associated. The frequency of moving behaviours increased in the cold seasons and along the day. The seasonal variation in the moving behaviours suggest the requirement of a larger area in the cold seasons, probably related to seasonal fluctuations in the abundance of dominant prey items. Higher group sizes were observed while dolphins were foraging. The cohesion index also varied according to the behaviour. Our results showed that group organization and behavioural patterns of this estuarine dolphin population are probably linked to daily and seasonal environment cycles, and also possibly to the condition of being at the furthest southern limit of distribution of the species.A população residente de boto-cinza, Sotalia guianensis (P.J. van Bénéden, 1864, da Baía Norte, Santa Catarina, sul do Brasil, foi estudada de 2000 a 2003. Foram realizados cruzeiros sistemáticos de um dia, a bordo de um veleiro de 5 m equipado com motor de popa. Utilizando o método de grupo-focal, informações como posição geográfica, padrão comportamental predominante, tamanho

  15. Functional characterization of Citrus macrophylla BOR1 as a boron transporter. (United States)

    Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio


    Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

  16. De werking van de hydro- en acetylverbindingen van kinidine en kinine op het hart van Rana esculenta

    NARCIS (Netherlands)

    Sibie, Johan Dirk


    In hoofdstuk I werd een inleiding gegeven betreffende de geschiedenis van de kina en van het begin der kinacultuur op Java, de chemie der kinaälkaloïden en enkele aspecten der pharmacologische werking van de kinaderivaten. ... Zie: Samenvatting

  17. Dijk- en oeverval aan den cal. Willem Annapolder (Gem. Kapelle)

    NARCIS (Netherlands)

    Verhagen, H.J.


    Foto's van de aanleg van de dijk- en oeverval aan den cal. Willem Annapolder (Gem. Kapelle) 3. Linkerhelft dijkval Willem Annapolder. 30 Dec. 1936 4. Rechtehelft dijkval Willem Annapolder. 30 Dec. 1936 5. Overzicht dijkval Willem Annaolder. 30 Dec. 1936 6. Kleikisting binnendijks aangebacht. 14/15

  18. Den umulige film

    DEFF Research Database (Denmark)

    Moestrup, Steffen Damkjær


    Den smertelige Sorg og Glæde fuldender en lang og glorværdig karriere for danske Nils Malmros. Den er en yderst vellykket film, fordi den forbliver usentimental om en skæbnesvanger dag i instruktørens liv.......Den smertelige Sorg og Glæde fuldender en lang og glorværdig karriere for danske Nils Malmros. Den er en yderst vellykket film, fordi den forbliver usentimental om en skæbnesvanger dag i instruktørens liv....

  19. 10 Van den Bergh WEB 02.pmd

    African Journals Online (AJOL)


    sublime and therefore unrepresentable event denies any semantic relation ... tradition: the role of “context” is an underlying aspect in the work of various ... within the life of the individual or the socio-political context of a community, because ... best way to deal with trauma would be to find a balance between the two. Dealing ...

  20. Internationaal huwelijksvermogensrecht : van Den Haag naar Brussel

    NARCIS (Netherlands)

    Kuper, Alexandra Geertruida Henderika


    Alexandra Kuper’s doctoral thesis holds a study into the applicable law on matrimonial property. In international cases it is not always intelligible that Dutch law is applicable. In the present study, the main question is how the current Dutch conflicts-of-laws rule for international matrimonial

  1. Den danske astronaut

    DEFF Research Database (Denmark)

    Jakobsen, Lars Sejersgård


    Undervisningsmateriale til mellemtrinnet om raketter, astronauter og rummet lavet for Planetariet i anledning af opsendelsen af den første danske astronaut, Andreas Mogensen, til Den Internationale Rumstation (ISS) i sensommeren 2015......Undervisningsmateriale til mellemtrinnet om raketter, astronauter og rummet lavet for Planetariet i anledning af opsendelsen af den første danske astronaut, Andreas Mogensen, til Den Internationale Rumstation (ISS) i sensommeren 2015...

  2. Den danske astronaut

    DEFF Research Database (Denmark)

    Jakobsen, Lars Sejersgård


    Undervisningsmateriale til udskolingen om raketter, astronauter og rummet lavet for Planetariet i anledning af opsendelsen af den første danske astronaut, Andreas Mogensen, til Den Internationale Rumstation (ISS) i sensommeren 2015......Undervisningsmateriale til udskolingen om raketter, astronauter og rummet lavet for Planetariet i anledning af opsendelsen af den første danske astronaut, Andreas Mogensen, til Den Internationale Rumstation (ISS) i sensommeren 2015...

  3. Den juridiske metode

    DEFF Research Database (Denmark)

    Hansen, Lone Louring; Werlauff, Erik

    DEN JURIDISKE METODE – en introduktion (2. udgave 2016) er en brugervenlig og praktisk bog om den juridiske metode. Den kan læses af både studerende og læsere uden juridiske forkundskaber. Bogen omhandler juridisk metode gennem 2000 år, retsområderne, udstedelse af retsregler, domstolene og deres...

  4. Den kommunikerende organisation

    DEFF Research Database (Denmark)

    Tække, Jesper


    samtidig tilbydes optimale muligheder for at få opfyldt individuelle behov og karrieremuligheder. For at en organisation skal kunne korrigere sig i forhold til de krav den konfronteres med, må der kunne fremstilles et adækvat billede af den. Det vil sige at dens faktiske kommunikationsprocesser må kunne...... drages frem i lyset på en måde så hensigtsmæssigheder og uhensigtsmæssigheder kan iagttages og selv blive objekt for reflekteret organisationskommunikation. Dette paper giver et udkast til en analysestrategi, hvormed der kan tegnes et billede af den enkelte organisation ud fra hvordan dens enkelte og...

  5. Een traditie herneemt zich - Over het belang van Aldo van Eyck

    NARCIS (Netherlands)

    Colenbrander, B.J.F.


    Zo'n zeven, acht jaar geleden veranderde Aldo van Eyck, overigens bij leven en welzijn, van een lijfelijk deelnemer aan de architectuurdiscussie in een historische figuur. Hij werd verguisd en gelauwerd. Met de Rekenkamer in Den Haag echter doet Van Eyck lang vergeten manifesten herleven. Gloort er

  6. Taalonderrig en die teorie van meervoudige intelligensie | van den ...

    African Journals Online (AJOL)

    One of the consequences will be that educators have to present learning opportunities in a wide variety of ways (Armstrong 1994: 1) to give learners the opportunity to learn in different ways. Several methods and activities are proposed to develop the different intelligences in the language classroom. Assessment is also ...

  7. Shear Punch Testing of BOR-60 Irradiated TEM Specimens

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    As a part of the project “High Fidelity Ion Beam Simulation of High Dose Neutron Irradiation” an Integrated Research Program (IRP) project from the U.S. Department of Energy, Nuclear Energy University Programs (NEUP), TEM geometry samples of ferritic cladding alloys, Ni based super alloys and model alloys were irradiated in the BOR-60 reactor to ~16 dpa at ~370°C and ~400°C. Samples were sent to Los Alamos National Laboratory and subjected to shear punch testing. This report presents the results from this testing.

  8. Acoustic monitoring of the BOR-60 reactor circulating pump state

    International Nuclear Information System (INIS)

    Efimov, V.N.; Myntsov, A.A.


    Diagnostics methods for circulation pumps of the experimental BOR-60 fast reactor are described. The results of signal processing during a microcompain, as well as detected anomalies in pump operation in the earth stage are presented. Analysis carried out for an acoustic signal envelope has shown high efficiency of the method. When oscillations of a mechanical shaft are present, the envelope level increases 1.5 times. More detailed investigation is carried out by the analysis of the spectrum of the pump acoustic signal envelope. During abnormal operation there are peaks, corresponding to the circulation frequency, and harmonics multiple of it, in the spectrum. 6 figs

  9. "Den onde kvinde"

    DEFF Research Database (Denmark)

    Holst, Søren


    Et af Dødehavsskrifterne, af den første udgiver kaldet "Den onde kvindes rænker" (4Q184), beskriver en svigefuld kvinde, der lokker fromme mænd i fordærv. Artiklen gennemgår tekstens fortolkningshistorie og påviser den rolle, det har spillet for læsningen, at teksten a priori er blevet opfattet s...

  10. Den inkluderende skole

    DEFF Research Database (Denmark)

    Hedegaard Hansen, Janne


    Artiklen tager afsæt i en forståelse af inklusion som den enkelte elevs ret til deltagelse i de eksisterende fællesskaber, forstået som de læringsrum, der bedst muligt tilgodeser den enkelte elevs særlige behov. I artiklen diskuteres hvilke nødvendige forandringer det fordrer i den pædagogiske pr...

  11. İçme ve sulama sularında bor kirliliği ve bor giderme yöntemleri

    Directory of Open Access Journals (Sweden)

    Meltem Bilici Başkan


    Full Text Available Periyodik cetvelin 3A grubunda yer alan bor yüksek iyonlaşma potansiyeline sahip olması nedeniyle yarı metal olarak kabul edilir. Yerkabuğundaki ortalama bor konsantrasyonu 10 mg/kg'dır. Bor doğada Ca, Na ve Mg'un tuzları şeklinde bulunur. Yüksek konsantrasyonlarda ve ekonomik boyutlardaki bor yatakları; borun oksijen ile bağlanmış bileşikleri şeklinde daha çok Türkiye ve ABD'nin kurak, volkanik ve hidrotermal aktivitesi olan bölgelerinde bulunmaktadır. Bor, bitkiler için gerekli bir mikro besin elementi olmanın yanı sıra, gerekli tüm besin elementleri içerisinde, eksiklik belirtilerine neden olan miktarı ile toksik etki yapan miktarı, birbirine çok yakın olan tek elementtir. Bor su ortamında genellikle borik asit ve kısmen de borat tuzları formlarında bulunmaktadır. Pek çok endüstride kullanım alanı bulan bor bileşiklerinin endüstriyel gelişmelere bağlı olarak yüzeysel sularda bulunan konsantrasyonu artış göstermektedir. Yüzeysel sularda bulunan bor aynı zamanda evsel atıksulardan da kaynaklanmaktadır. Türkiye'de içme ve sulama sularını en çok kirleten toksik elementlerin başında bor gelmektedir. Bu nedenle bor giderimi hem insan sağlığı açısından hem de sağlıklı tarım ürünü yetiştirilebilmesi açısından oldukça önemlidir. Sulardan bor giderimi için uygulanan temel yöntemler arasında iyon değişimi, ultrafiltrasyon, ters osmoz ve adsorbsiyon gelmektedir.

  12. Optimization of heavy metals total emission, case study: Bor (Serbia) (United States)

    Ilić, Ivana; Bogdanović, Dejan; Živković, Dragana; Milošević, Novica; Todorović, Boban


    The town of Bor (Serbia) is one of the most polluted towns in southeastern Europe. The copper smelter which is situated in the centre of the town is the main pollutant, mostly because of its old technology, which leads to environmental pollution caused by higher concentrations of SO 2 and PM 10. These facts show that the word is about a very polluted region in Europe which, apart from harming human health in the region itself, poses a particular danger for wider area of southeastern Europe. Optimization of heavy metal's total emission was undertaken because years of long contamination of the soil with heavy metals of anthropogenic origin created a danger that those heavy metals may enter the food chains of animals and people, which can lead to disastrous consequences. This work represents the usage of Geographic Information System (GIS) for establishing a multifactor assessment model to quantitatively divide polluted zones and for selecting control sites in a linear programming model, combined with PROMETHEE/GAIA method, Screen View modeling system, and linear programming model. The results show that emissions at some control sites need to be cut for about 40%. In order to control the background of heavy metal pollution in Bor, the ecological environment must be improved.

  13. Den positive psykologis metoder

    DEFF Research Database (Denmark)

    Andersen, Frans Ørsted; Mørck, Line Lerche; Nissen, Poul Erik

    En antologi der giver en introduktion til en række af de metoder der anvendes til forskning, assessment, test, udviklingsarbejde og intervention indenfor den positive psykologi.......En antologi der giver en introduktion til en række af de metoder der anvendes til forskning, assessment, test, udviklingsarbejde og intervention indenfor den positive psykologi....

  14. Den katolske kirke

    DEFF Research Database (Denmark)

    Olden-Jørgensen, Sebastian


    En kort gennemgang af den katolske kirkes kirkerum, ritualer, selvforståelse og syn på andre kristne efterfulgt af 16 forskellige kildetekster til belysning og uddybning af emnerne. Bogen omfatter tilsvarende afsnit om de ortodokse kirker og om folkekirken. Den er beregnet til gymnasium og HF....

  15. Den levende sangfugl

    DEFF Research Database (Denmark)

    Bjerre, Thomas Ærvold


    Kronik om Harper Lee's roman "Dræb ikke en sangfugl" (1960) og den store indflydelse bog og film har haft på amerikansk kultur. Udgivelsesdato: 30. juli......Kronik om Harper Lee's roman "Dræb ikke en sangfugl" (1960) og den store indflydelse bog og film har haft på amerikansk kultur. Udgivelsesdato: 30. juli...

  16. Den moderate revolution

    DEFF Research Database (Denmark)

    Larsen, Bøje

    "normale" industrivirksomheder, men den er absolut set begrænset. Årsagerne til denne kun "moderate revolution" af organisationsformerne diskuteres: Er det fordi klassisk organisation og social nærkontakt er nødvendig i den nye økonomi, eller er det manglende fantasi og tryghedsbehov? Begge muligheder...

  17. Den iscenesatte virkelighed

    DEFF Research Database (Denmark)

    Bondebjerg, Ib


    Artiklen diskuterer den dramatiserede dokumentarismes forskellige genrer inden for film og tv. Det diskuteres hvor grænserne mellem fiktion og fakta går i journalistik og dokumentarisme. Hovedkonklusionen er, at den dramatiserede og iscenesatte dokumentarisme er en genre, der har en vigtig funktion...

  18. Den menneskelige plet

    DEFF Research Database (Denmark)

    Kjerkegaard, Stefan

    endog en selvstigmatisering, hvor selvfortællingen ikke hænger sammen. Der er tale om en menneskelig henvendelse inkorporeret i det, som litteraturen gør, snarere end i det, den siger. I den nye danske litteratur af eksempelvis Yahya Hassan, Asta Olivia Nordenhof eller Bjørn Rasmussen oplever man...

  19. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor


    Gardić Vojka R.; Petrović Jelena V.; Đurđevac-Ignjatović Lidija V.; Kolaković Srđan R.; Vujović Svetlana R.


    Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB) activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj ...

  20. Den Gode Historie

    DEFF Research Database (Denmark)

    Mogensen, T.E.

    den nysgerrige læser af trilogien. Den kan beses og bestilles på: ELLER KØB DEN DIREKTE HOS MIG: SLAGTILBUD 100 kr. (inkl. porto og forsendelse)!                            Henvendelse pr. e-mail til

  1. Den positive psykologis metoder

    DEFF Research Database (Denmark)

    Bogen introducerer til de mange metoder, som anvendes i positiv psykologi. dette sker ud fra en reflekteret tilgang, der ligeledes rummer bidrag fra kritisk psykologi med det formål at nuancere den positive psykologis forståelser...

  2. I den sidste time

    DEFF Research Database (Denmark)

    Norup, Lis

    : Dekadencens teori. Arthur William Symons: Dekadencens litteratur. Oscar Wilde: Kritikeren som kunstner) Noter I tekster skrevet i 1800-tallet udfoldes dekadencekunsten som den forfinede sensibilitets, de forstyrrede sansers og det oprevne sinds digtning. Med litteraturhenvisninger....

  3. Denver District Laboratory (DEN) (United States)

    Federal Laboratory Consortium — Program CapabilitiesDEN-DO Laboratory is a multi-functional laboratory capable of analyzing most chemical analytes and pathogenic/non-pathogenic microorganisms found...

  4. Den professionelle samtale

    DEFF Research Database (Denmark)

    Herskind, Mia


    , som et sådant perspektiv indebærer. Kapitlet tager afsæt i forskellige typer af professionelle samtaler (interview, supervision og terapi), hvor den professionelle stiller spørgsmål og er til stede på måder, så også den prærefleksive og kropslige-sanselige fortælling bliver en del af samtalen. Det...

  5. Den signede dag

    DEFF Research Database (Denmark)

    Balslev-Clausen, Peter


    Artiklen gennemgår de tre middelalderlige versioner af den fællesnordiske dagvise fra 14. århundrede og gør rede for salmens tekst- og receptionshistorie i Dansk tradition.......Artiklen gennemgår de tre middelalderlige versioner af den fællesnordiske dagvise fra 14. århundrede og gør rede for salmens tekst- og receptionshistorie i Dansk tradition....

  6. One-Step Leapfrog LOD-BOR-FDTD Algorithm with CPML Implementation

    Directory of Open Access Journals (Sweden)

    Yi-Gang Wang


    Full Text Available An unconditionally stable one-step leapfrog locally one-dimensional finite-difference time-domain (LOD-FDTD algorithm towards body of revolution (BOR is presented. The equations of the proposed algorithm are obtained by the algebraic manipulation of those used in the conventional LOD-BOR-FDTD algorithm. The equations for z-direction electric and magnetic fields in the proposed algorithm should be treated specially. The new algorithm obtains a higher computational efficiency while preserving the properties of the conventional LOD-BOR-FDTD algorithm. Moreover, the convolutional perfectly matched layer (CPML is introduced into the one-step leapfrog LOD-BOR-FDTD algorithm. The equation of the one-step leapfrog CPML is concise. Numerical results show that its reflection error is small. It can be concluded that the similar CPML scheme can also be easily applied to the one-step leapfrog LOD-FDTD algorithm in the Cartesian coordinate system.

  7. Eogenetic caves in conglomerate: an example from Udin Boršt, Slovenia

    Directory of Open Access Journals (Sweden)

    Lipar Matej


    Full Text Available Udin Boršt is a karstified terrace of carbonate rock, which is of fluvioglacial origin, and is situated in the north-western part of Slovenia. There are 15 registered caves, which have been interpreted as caves in conglomerate, while karst of Udin Boršt itself was interpreted as conglomerate karst, shallow karst or isolated karst. In this article, caves in Udin Boršt have been interpreted as eogenetic caves. Based on porosity and bedding material, different types of caves and cave passages have developed. Four general types of eogenetic caves found in Udin Boršt are; linear stream caves, shelter caves, breakdown caves and vadose shafts.

  8. Een mozaïek van stemmen : Verbeeldend lezen in Vondels Gysbreght van Aemstel

    NARCIS (Netherlands)

    Prandoni, M.


    The present thesis offers a critical reconsideration of the tragedy Gysbreght van Aemstel (1637) of the playwrigth Joost van den Vondel. In my analysis I take into account performance-aspects (with particular attention to the performance-history of the play) as well as 'literary' ones, this

  9. De kristallisatie-methode bij het onderzoek van de liquor cerebro-spinalis

    NARCIS (Netherlands)

    Wittermans, Aafko Willinge


    Ongeveer twaalfhonderd liquores zijn volgens een in de kliniek nog weinig bekende zeer eenvoudige methode van onderzoek van den Roemeenschen Hoogleraar TOMESCO onderzocht. Deze methode berust op het beoordeelen van het kristalbeeld dat ontstaat bij het indampen van druppels sterk verdunde liquor

  10. Necropolis on Bor lake: New reports on Bronze age burial

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar


    Full Text Available This article deals with the social and anthropological aspects of burial rituals during the Middle Bronze Age in Timočka Krajina. Decades of systematic research of necropolises and reconnaissance in the basin of the Crni Timok proved an increase in number of sites around ore - rich areas of the east Kučaj mountains as well as around Romuliana site and the fertile valleys of Džanovo polje (Map. 1. The quantitative increase in settlements was reflected by the emergence of large necropolises, only three of which have been systematically explored; those in Trnjani, Magura and Bor Lake (Fig. 1; Plan 1. Analysis of geographical features of many settlements and their position in relation to natural resources helped define two communities, one of which carried out mining and metallurgical activities, while the other group engaged in the production of food. Both groups lived in the immediate vicinity and mutual dependence, functioning within a developed market for copper production. During the exploration of the necropolis near Bor Lake in 1997, the remains of burnt skeletons were collected from burial structures 2/97 and 13/97 (Fig. 2; Plans 2 and 3. Anthropological analysis of the cremated remains of the deceased showed that high temperatures were used during the cremation process, which we assume could have only been achieved in metallurgical furnaces. This is confirmed by the fact that the skeletal fragments contain traces of melted metal, as well as finds of bronze slag inside urns and grave structures in the necropolis in Trnjani (Figs. 3 and 4; Tables 1-4. Burial ritual of this kind was not proved by systematic archaeological research of necropolises in the basin of Crni Timok, although anthropological data collected from necropolises linked to metallurgical settlements may indicate some guidelines in the ritual cremation of prominent members of these communities. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Arheologija Srbije

  11. HIV-surveys bij hoog-risicogroepen in Den Haag 2005

    NARCIS (Netherlands)

    Veen MG van; Wagemans MAJ; Burg I van den; Tonino-van der Marel E; Leeuwen AP van; Laar MJW van de; CIE


    Verspreiding van HIV en SOA kan mogelijk optreden doordat hoog-risicogroepen een brug vormen naar de rest van de bevolking in Nederland. Dit blijkt uit de HIV-survey die is uitgevoerd in Den Haag onder prostituees werkzaam in de raamprostitutie, clubs en op de tippelzone en onder migranten

  12. Den udenlandske udtales finurligheder

    DEFF Research Database (Denmark)

    Davidsen-Nielsen, Niels


    Eftertanken. Det er ikke altid nemt at tale om store, internationale kunstnere som Mozart eller Gabriel García Márquez. For hvordan skal den danske mund udtale z'et i Mozart og lægge trykket i García?......Eftertanken. Det er ikke altid nemt at tale om store, internationale kunstnere som Mozart eller Gabriel García Márquez. For hvordan skal den danske mund udtale z'et i Mozart og lægge trykket i García?...

  13. A hypothetical severe reactor accident in Sosnovyj Bor, Russia

    International Nuclear Information System (INIS)

    Lahtinen, J.; Toivonen, H.; Poellaenen, R.; Nordlund, G.


    Individual doses and short-term radiological consequences from a hypothetical severe accident at the Russian nuclear power plant in Sosnovyj Bor were estimated for two sites in Finland. The sites are Kotka, located 140 km from the plant, and Helsinki, 220 km from the plant. The release was assumed to start immediately after the shutdown of the reactor (a 1000 MW RBMK unit) which had been operating at nominal power level for a long time. An effective release height of 500 m was assumed. The prevailing meteorological conditions during the release were taken to present the situation typical of the area (effective wind speed 9 m/s, neutral dispersion conditions). The release fractions applied in the study were of the same order as in the Chernobyl accident, i.e. 100% for noble gases, 60% for iodines, 40% for cesium and 1-10% for other radiologically important nuclides. The release was assumed to last 24 hours. However, half of the nuclides were released during the first hour. No attention was paid to the actual sequence of events that could lead to such release characteristics and time behaviour. The concentration and dose calculations were performed with a modified version of the computer code OIVA developed in Finnish Centre for Radiation and Nuclear Safety. Inhalation dose and external doses from the release plume and from the deposited activity were calculated for adults only, and no sheltering was considered. (11 refs., 4 figs., 6 tabs.)

  14. De invloed van den basentoestand van den grond op de ontwikkeling van de theeplant (Thea sinensis Linn.)

    NARCIS (Netherlands)

    Prillwitz, P.M.H.H.


    Application of slaked lime retarded growth of young tea plants on most soils in pot trials. Application of S, although beneficial to the growth of tea plants, had an adverse effect on the soil, when applied in large amounts. It lowered both the base saturation and the adsorption capacity of the

  15. Den sundhedsvidenskabelige opgave

    DEFF Research Database (Denmark)

    Lindahl, Marianne Pia; Juhl, Carsten Bogh

    troværdigheden af sine resultater. Bogen er opdateret, så den refererer til Microsoft Office 2013, og giver instruktioner og tips til: • Hvordan man bruger Word til hjælp med indholdsfortegnelse, overskrifter og korrektur • Hvordan man bruger Word til hjælp med diagrammer og tabeller• Hvordan man bruger Excel...

  16. Den postmoderne konstruktivismes inkongruenser

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando


    europæiske intellektuelle og akademikere gjorde teorierne og ideerne om underudvikling og afhængighed, der stammede fra Latinamerika, til deres egne. Også i den sidste tid har latinamerikanske intellektuelle, som fx Nestor García Canclini, haft indflydelse i Europa og USA med sin teori om hybriditet og...

  17. Den moderne bevidstheds katedral

    DEFF Research Database (Denmark)

    Ostenfeld Pedersen, Simon


    Interview med idéhistorikeren Dorthe Jørgensen der under overskriften ”Den moderne bevidstheds katedral” blotlægger hendes mangeårige arbejde med Hegel, og hvor hun giver en række relevante bud på en aktualiserende Hegel-læsning centreret omkring felter som metafysik, historiefilosofi og æstetik....

  18. Den kaotiske organisation

    DEFF Research Database (Denmark)

    Helms, Niels Henrik


    Præsentation af den britiske organisationsteoretiker Ralph Stacey: Stacey mener samlet, at organisationer ikke skal ses som systemer, der opstår, når individer interagerer med hinanden. Det er selve interaktionen, der er organisationen. Staceys kernebegreb er temporære processer. Når vi interager...

  19. Den professionelle rolle

    DEFF Research Database (Denmark)

    Præstegaard, Jeanette; Sørensen, Kirsten


    Psykiatri er den disciplin indenfor lægevidenskaben, der beskæftiger sig med at forebygge, diagnosticere og helbrede psykiske sygdomme. I “Lærebog i psykiatri” giver Lene Nyboe sig bud på ergoterapeutisk og fysioterapeutisk kernefaglighed indenfor det psykiatriske område. Behandlingstraditionerne...

  20. Den skjulte religion

    DEFF Research Database (Denmark)

    Rubow, Cecilie


    Kulturbegrebet har længe været genstand for kritik i human- og samfundsvidenskaberne. Studier i Vesteuropa, blandt andet i det danske folkekirkelige felt, viser, at der er flere paralleller at drage til religionsbegrebet. Der er behov for at bevæge sig væk fra den rutineprægede beskrivelse og gøre...

  1. Den danske regionskonstruktion

    DEFF Research Database (Denmark)

    Klausen, Kurt Klaudi; Christoffersen, Henrik

    Region Midtjylland er i centrum for analysen men den omfatter også regionsdannelsen i almindelighed. Der anlægges i analysen på samme tid et politologisk, organisationsteoretisk og økonomisk resonnement. Regionsdannelsen finder sted på baggrund af de setup Strukturreformen har sat, men udfoldes p...

  2. Efterskrift til den reviderede udgave

    DEFF Research Database (Denmark)

    Nielsen, Carsten Fogh


    Opsummering af tendenser og udviklingstræk inden for den nyere forskning i Kants historiefilosofi.......Opsummering af tendenser og udviklingstræk inden for den nyere forskning i Kants historiefilosofi....

  3. Dimensies van onafhankelijkheid: de Surinaamse ervaring

    Directory of Open Access Journals (Sweden)

    P. Meel


    Full Text Available J. Trommelen, Dwars door Suriname. Drie Guyana's in een tegendraads portret H. Breeveld, Jopie Pengel 1916-1970. Leven en werk van een Surinaamse politicus J. Jansen van Galen, J.A. Jansen, Hetenachtsdroom. Suriname, erfenis van de slavernij J. Jansen van Galen, Het Suriname-syndroom. De PvdA tussen Den Haag en Paramaribo M. van Kessel, H. van der Vlist, Tussen twee huizen. Het leven van de Surinaamse Nederlander Jan Veldema G. Oostindie, I. Klinkers, Knellende koninkrijksbanden. Het Nederlandse dekolonisatiebeleid in de Caraïben, 1940-2000, I, 1940-1954, II, 1954-1975, III, 1975-2000 R. Tjin, C. Buma, J. Reichert, Suriname onafhankelijk. 25 November 1975. Srefidensi sranan = Suriname free. 25 November 1975

  4. Den sociale stofmisbrugsbehandling. Del 6

    DEFF Research Database (Denmark)

    Sørensen, Maren; Buchholt Pedersen, Katrine

    Dette er den sjette delrapport i en rapportserie om den sociale stofmisbrugsbehandling i Danmark. Rapportserien bygger på en omfattende undersøgelse, der blev fortaget i perioden december 2007 til maj 2009. Denne delrapport stiller skarpt på resultaterne af den sociale stofmisbrugsbehandling i Da...

  5. Dannelsen af den ansvarlige elev

    DEFF Research Database (Denmark)

    Larsen, Jesper


    Denne artikel handler om den del af lærergerningen, der har at gøre med udarbejdelse af elevplaner. Der tages udgangspunkt i en foucaultsk forståelse, hvor beskrivelsen af den enkelte elev udtrykker et særligt normativt ideal om, hvilke former for elevhed der er de ønskværdige i den danske...

  6. Den sociale stofmisbrugsbehandling. Del 4

    DEFF Research Database (Denmark)

    Sørensen, Maren

    Dette er den fjerde delrapport i en rapportserie om den sociale stofmisbrugsbehandling i Danmark. Rapportserien bygger på en omfattende undersøgelse, der blev fortaget i perioden december 2007 til maj 2009. Denne delrapport stiller skarpt på kvalitetsudvikling og kvalitetsstandarder i den sociale...

  7. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji; Mineta, Katsuhiko; Amano, Taro; Toyoda, Atsushi; Fujiwara, Toru; Naito, Satoshi; Takano, Junpei


    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range

  8. dens festival

    DEFF Research Database (Denmark)

    Agerholm, Frank Juul


    Som den italienske antropolog og folklorist Alessandro Falassi gør opmærksom på i antologien Time out of Time: Essays on the Festival, så er det sparsomt, hvad der er gjort af teoretiske forsøg på definere, hvad en festival er. Det står altså skidt til med et begreb om festivalen, og dette endog...... til trods for, at der er forsket i festivalen som fænomen siden det 19. århundrede – tilmed inden for en række forskellige faglige discipliner såsom religionsvidenskab, sociologi, antropologi, folklore m.fl. Endnu mere sparsomt må det vel så også stå til med bud på, hvad fødens festival er for en...

  9. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz


    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  10. Den der ser, er den, der ses

    DEFF Research Database (Denmark)

    Bjerrum, Troels


    Udgangspunktet for afhandlingen er at undersøge, hvordan unge udsatte mennesker kan opnå personlig forandring ved hjælp af åndedrætstræning og meditation. Afhandlingen indleder med at beskrive de unges liv i en globalisering. Mange unge mennesker uden en social ansvarlig baggrund har ikke lært...... at foretage sig nødvendige samfundsmæssige valg. På grund af nederlag i hjem, skole, uddannelse og erhverv søger unge fællesskaber i ligestillede miljøer svarende til egen negative forventningspraksis. Den unge praktiserer en vanedannende negativ livsførelse, som eskalerer til yderligere socialt forfald. Unge......, der har levet i kriminalitet, misbrug og medmisbrug i lang tid, vil ikke være i stand til at realisere sig positivt pga. en personlig indgroet diskvalificerende forestilling. Afhandlingen forklarer, hvorledes negative oplevelser forbliver spændinger i menneskers krop. Teorier af Maurice Merleau...

  11. Den amoralske liberalisme

    DEFF Research Database (Denmark)

    Skov, Christian Houlberg


    Fra både højre og venstre skydes der i disse år med skarpt mod liberalismen; i denne artikel anmelder Christian H. Skov Against Liberalism af John Kekes, der søger at påvise liberalismens mangler fra et logisk-filosofisk udgangspunkt, med den grundlæggende påstand, at liberalismens to mål, at fre......, at fremelske autonomi og begrænse ondskab, er uforenelige....

  12. Den gamle verdens magi

    DEFF Research Database (Denmark)

    Holck, Jakob Povl

    I denne bog præsenterer forskningsbibliotekar cand.mag., ph.d. Jakob Povl Holck sjældne bøger og andre biblioteksmaterialer fra Herlufsholm-samlingen på Syddansk Universitetsbibliotek i Odense. Bogens form udgør en mosaik af værker i tekst og især billeder med speciel vægt på ’den videnskabelige ...

  13. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji


    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  14. A new approach to the spectral analysis of liquid membrane oscillators by Gábor transformation

    DEFF Research Database (Denmark)

    Płocharska-Jankowska, E.; Szpakowska, M.; Mátéfi-Tempfli, Stefan


    Liquid membrane oscillators very frequently have an irregular oscillatory behavior. Fourier transformation cannot be used for these nonstationary oscillations to establish their power spectra. This important point seems to be overlooked in the field of chemical oscillators. A new approach...... is presented here based on Gábor transformation allowing one to obtain power spectra of any kind of oscillations that can be met experimentally. The proposed Gábor analysis is applied to a liquid membrane oscillator containing a cationic surfactant. It was found that the power spectra are strongly influenced...


    African Journals Online (AJOL)


    den Heer Gouverneur verzoek worde gedaan, dat er voor de Neder- duitsche Hervormde Kerk alhier vooreerst geene aanstellingen van. Predikanten geschieden, dan ten behoeve van hen, die reeds hier zijn, en nog geene aanstelling hebben kunnen bekomen, en dat het, bij ver dere dsipositiën over vacaturen alhier ...

  16. De invloed van den kalktoestand van juvenielen Merapi-aschgrond op eenige kwaliteitseigenschappen van Vorstenlandsche tabak

    NARCIS (Netherlands)

    Middelburg, H.A.


    The influence of lime status of volcanic-ash soil was examined by pot trials in conditions as similar as possible to those of the plantation. Soils used were fine juvenile Merapi ash, the most important soil for tobacco growing, and, as a contrast, weathered laterite. In laterite artificial

  17. Den Danske Netordbog

    DEFF Research Database (Denmark)

    Bergenholtz, Henning; Vrang, Vibeke; Almind, Richard

    Denne danske ordbog er primært tænkt som hjælpeværktøj i forbindelse med tvivl og usikkerhed, når man skriver en dansk tekst. Den Danske Netordbog er en yderst omfattende ordbog med mere end 110.000 forskellige opslagsord og en lang række oplysninger, herunder grammatik, betydning, synonym (ord m...... samme betydning), antonym (ord med modsat betydning), orddannelse (i hvilke andre ord det pågældende ord er en del af), kollokationer (ordforbindelser), idiomer (fast udtryk med en særlig betydning) og ordsprog og citater....

  18. Den humane teknologi

    DEFF Research Database (Denmark)

    Fausing, Bent


    Artiklen undersøger hverdagsæstetikkens forestillinger om teknologi i tv-reklamer, nærmere bestemt to mobiltelefoner fra Nokia. Nokias slogan er som bekendt: "Nokia -connecting people". Hvilken funktion tilskrives denne succes-teknologi via billeder, narrativer, lyde, interaktioner og affekter...... personifikation eller antropomorfisering er vigtig for branding af den ny teknologi. Teknologien bliver betragtet som skaber af en teknotranscendens mod en mere kvalificeret humanitet, som er i kontakt med fundamentale humane værdier som intuition, fantasi og sansning. Det drejer sig i alle tilfælde om kvaliteter...

  19. Den bureaukratiske elite

    DEFF Research Database (Denmark)

    Krarup, Troels


    Artiklen kortlægger ved korrespondanceanalyse karriereveje for 122 topembedsmænd i centraladministrationen. Artiklen har tre anliggender: 1) at opdatere og nuancere billedet af den bureaukratiske elite i Danmark, som det kendes fra tidligere politologiske studier; 2) at positionere analysen i et...... europæisk perspektiv og i forhold til en anden dansk elite, topdirektører; og 3) at eksemplificere visse teoretiske og metodiske fordele ved felt- og korrespondanceanalyser uden så nær anknytning til Bourdieus sociologi, som det almindeligvist ses i magtstudier, bl.a. ved at introducere brug af idealtyper...

  20. Den økonomiske verdensorden

    DEFF Research Database (Denmark)

    Ougaard, Morten


    . Men det er ikke en statisk orden, den har udviklet og forandret sig gennem de sidste 70 år, og det er ikke første gang, den står over for betydelige udfordringer. Derfor er det instruktivt at kaste et blik bagud. De nuværende vanskeligheder skal ses på baggrund af den historie, der har skabt dem, og...

  1. De werkbelasting van huisartsen in internationaal perspectief

    NARCIS (Netherlands)

    Schäfer, Willemijn; van den Berg, Michael; Groenewegen, Petrus


    Abstract: Schäfer WLA, van den Berg MJ, Groenewegen PP. Workload of Dutch general practitioners from an international perspective. Huisarts Wet 2016;59(3):94-101. Background: Relatively more patients are listed with a GP in the Netherlands than in other countries. Moreover, the central role of GPs

  2. Transgenic tobacco plants expressing BoRS1 gene from Brassica ...

    Indian Academy of Sciences (India)

    Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...

  3. Aspects of energy reduction by autogenous copper production in the copper smelting plant Bor

    International Nuclear Information System (INIS)

    Najdenov, Ivan; Raić, Karlo T.; Kokeza, Gordana


    This work presents a comparative analysis of the energy consumption during copper production by the “standard” procedure (roasting in a fluo–solid reactor and smelting in a reverberatory furnace) in the Smelting Plant in Bor with modern autogenous procedures. All forms of expended energy were reduced to primary energy or to the same energy form, i.e., to the energy equivalent of the process (EEP), the raw material and the process materials. In addition, the energy equivalent of the process and waste products (water vapour, thermal energy and similar) were balanced. To complete the consumption of all energy generating products in copper production, they were reduced to conditional fuel (coal equivalent = 29.3 MJ/kg). Additionally, this study suggests replacement of the existing technology by an appropriate autogenous procedure and considers the prospects for further development of mining and metallurgy in Bor. Estimates of development perspectives for copper production should be comprehensive, based on complete and relevant data, as well as on real considerations of future development in world production. -- Highlights: ► “Standard” autogenous copper production in the Smelting Plant, Bor, Serbia. ► Comparation of energy consumption in “standard” with other autogenous procedures. ► All forms of energy are reduced to energy equivalent and conditional fuel. ► Replacement of existing technology with the appropriate autogenous procedure. ► Perspectives of further development of mining and metallurgy in Bor.

  4. Den farefulde gyngeleg

    DEFF Research Database (Denmark)

    Karoff, Helle Skovbjerg


    I lyset af samtidens diskussioner af sikkerhed og det farefulde (Sandseter, 2009) i børns fysiske leg skal artiklen udforske forholdet mellem den interaktive gynge SON-X, legeaktiviteterne og det farefulde. Formålet er at undersøge, hvordan børn håndterer det farefulde og sikkerhed i deres gyngeleg......, og det formål skal udforskes gennem stemningsperspektivet (Karoff, 2010, 2013). Stemningsperspektivet er et livsfilosofisk perspektiv på legeaktiviteterne (Schiller, 1996, Nietzsche, 1996, Huizinga, 1956, Gadamer, 1966), der anskuer legeaktiviteterne som praksis, der har til formål at sætte de...... deltagende i en særlig stemning. En stemning er en måde at være til på i verden, der præges af åbenhed over for øjeblikket, over for andre mennesker og over for nye muligheder for at skabe mening (Heidegger, 2005). Afslutningsvist skal artiklen reflektere over teknologiens rolle – eksemplificeret med den...

  5. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells. (United States)

    Yamauchi, Noboru; Gosho, Tadashi; Asatuma, Satoru; Toyooka, Kiminori; Fujiwara, Toru; Matsuoka, Ken


    In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP) in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM). This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  6. Sygehusene i den islamiske verden i den klassiske tid


    Provencal, Philippe


    Et af de væsentlige punkter, hvor den arabiske medicin udmærker sig i forhold til tidligere tiders medicin var i oprettelsen og organiseringen af regelrette sygehuse. Artiklen beskriver sygehusenes oprindelse, plads og funktion i den klassiske arabiske kultur (750-1500)

  7. 'Den danske model' som tema

    DEFF Research Database (Denmark)

    Caraker, Emmett; Juul, Ida; Klindt, Mads Peter


    Tidsskrift for Arbejdsliv vol. 14, nr. 2, 5-8. Tema: 'Den danske model'. Redigeret af Emmett Caraker, Ida Juul, Mads peter Klindt & Jens Lind. 2011. København. 128 s.......Tidsskrift for Arbejdsliv vol. 14, nr. 2, 5-8. Tema: 'Den danske model'. Redigeret af Emmett Caraker, Ida Juul, Mads peter Klindt & Jens Lind. 2011. København. 128 s....

  8. Dorte Nors "Den store tomat"

    DEFF Research Database (Denmark)

    Michelsen, Jimmi


    Tekstgennemgang og undervisningsforløb til Dorte Nors "Den store tomat". Undervisningsforløbet er henvendt til elever i folkeskolens udskoling......Tekstgennemgang og undervisningsforløb til Dorte Nors "Den store tomat". Undervisningsforløbet er henvendt til elever i folkeskolens udskoling...

  9. Hyldest til den destruktive feminist

    DEFF Research Database (Denmark)

    Hansen, Brian Benjamin


    Den destruktive feminist er kommet for at uddele røvfulde og slikkepinde – og hun er netop løbet tør for slikkepinde.......Den destruktive feminist er kommet for at uddele røvfulde og slikkepinde – og hun er netop løbet tør for slikkepinde....

  10. Den medicinal-industrielle logik

    DEFF Research Database (Denmark)

    Børsen, Tom


    Et kig på medicinalindustrien og den logik der styrer udviklingen af nye lægemidler. Antagelsen er, at der også eksisterer et medicinalindustrielt kompleks, bestående af ledende industrifolk, læger, forskere og regeringsembedsmænd, der alle har kommercielle interesser i den herskende lægemiddeltæ...

  11. Den narrative tilgang

    DEFF Research Database (Denmark)

    Bo, Inger Glavind


    I kapitlet gennemgås en socialkonstruktivistisk forståelse af narrativer. I kapitlet vil jeg gennemgå centrale teoretiske pointer, der samlet set er grundlæggende for en social konstruktivistisk forståelse af narrativer for herved at udfolde forståelsen af den narrative tilgang og desuden...... tydeliggøre, hvordan tilgangen er forbundet med en særlig forståelse af identitetsskabelse. Der er tale om pointer der almindeligvis forbindes med ”små fortællinger” i form af længere identitetsfortællinger og narrative interviews. Kapitlet gennemgår således centrale inspirationskilder og teoretiske pointer...

  12. calvyn oor die leiding van die heilige gees in die verklaring van die

    African Journals Online (AJOL)

    Mittel alters, bis er zur Ruhe kommt bei den kanonischen Schriften der. Urzeit der christlichen Ära (Barth ... (ego tamen dimoveri non possum ab amore compendii, CO 10, 403). Deur die boodskap van die .... Idem ergo spiritus qui per os prophetarum loquutus est, in corda nostra penetret necesse est, ut persuadeat fideliter ...

  13. Bepaling van de kwaliteit van reinigingsprocessen.

    NARCIS (Netherlands)

    Terpstra, P.M.J.


    Ingegaan wordt op de operationalisering van het begrip schoon voor verschillende toepassingen. Daarna worden twee recent ontwikkelde onderzoekmethoden gepresenteerd voor de meting van respectievelijk het reinigingseffect van textiel reinigen en het reinigen van harde vloeroppervlakken en enkele met

  14. Den iscenesatte folkelighed

    Directory of Open Access Journals (Sweden)

    Néstor Garcia Canclini


    Full Text Available Hvad er "det folkelige" og hvad er "folkekultur"? Néstor Garcia Canclini har i denne artikel sat sig for at dekonstruere begrebet "det folkelige" og beskrive den måde, forskellige grupper bruger og misbruger begrebet på. Han analyserer tre fremherskende idéer om folkelighed: folkloristernes romantiske idé om det oprindelige, der blev ødelagt af massekulturen, massemediernes popularitetsbegreb og endelig populisternes - både de højre- og venstreorienteredes - iscenesættelse af folkeligheden. Desuden ser han på to marxistiske skolers opfattelse af forholdet mellem de dominerende og undertrykte klasser og forskellige definitioner af folkelig- hed. Ligesom Anamaria Fadul argumenterer Canclini for nødvendigheden af en ny, tværdiciplinær forskning, som opfanger kompleksitet og flerty- digheder i forholdet mellem de undertrykte og dominerende og ser "det folkelige" som en tragisk komedie med modsætninger og flertydighed snarere end en evigt fremadskrivende episk fortælling. Artiklen er en forkortet udgave af kapitel 5 i Canclinis bog fra 1989: "Culturas Hibridas - Estrategias para entrat y salir de la modernidad. Mexico: Grijalbo.

  15. Evaluation of signal processing for boiling noise detection. Further analysis of BOR-60 reactor noise data

    International Nuclear Information System (INIS)

    Ledwidge, T.J.; Black, J.L.


    The present paper deals with investigations of acoustic signals from a boiling experiment performed on the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is described. (author). 3 refs, 16 figs

  16. De zin van het economische opnieuw beschouwd

    Directory of Open Access Journals (Sweden)

    T. P. van der Kooy


    Full Text Available In 1950 heb ik het hoogleraarschap in de economie aan de juridische faculteit der Vrije Universiteit te Amsterdam aanvaard m et een rede over de zin van het economische. Sinds- dien heeft dit centiaal m elhodologisch vraagstuk van de we- tenschap der economie mij ook verder bezig gehouden. Het is voor een economist een m oeilijk vraagstuk, om dat het tevens een wijsgerig vraagstuk is. Over het algemeen vindt de econo­ m ist daarover weinig in de filosofische liLeratuur. Dit is zeer begrijpelijk, w ant wijsgeren kunnen op zijn best m aar heel sum m ier kennis nem en van wat er in de vakw etenschappen omgaat, terw ijl zij, voor zover mij bekend, in den regel slechts weinig belangstelling voor de economie aan den dag leggen. Omgekeerd zijn econom islen m eestal niet bijzonder filosofisch aangelegd, en hebben zij de handen vol om de storm achtige ontwikkeling van liun eigen literatuur enigzins bij te houden afgezien nog van het l'eit dat zij in den regel vele praktischc beslom m eringen hebben, ten gevolge waarvan zij zich niet ongestoord aan de studie kunnen wijden. Van een behoorlijk sam enspel tussen filosolen en economislen komt over het ge- heel ook niet veel terecht. Wat de wijsgerige kant van m ijn overpeizingen betreft, ben ik dus door de nood gedwongen slechts am ateur. Ik kom daar gaarne voor uit, en ik ben steeds bereid te zwichten voor het beter oordeel der wijsgeren, m its ik dat kan vatten, en in m ijn eigen w erk daar iets mee uit kan richten. Men behoeft nog geen door de wol geverfd prag­ m atist of operationalist te zijn om te weten dat ieder werk zijn eigen eisen stelt.

  17. Cryptococcal Meningitis | van den Ende | South African Medical ...

    African Journals Online (AJOL)

    Cryptococcal meningitis occurred in an elderly Coloured woman in the Northern Cape. She presented with symptoms and signs suggestive of encephalitis 4 weeks after a cholecystectomy. After the administration of cortisone, cryptococcal organisms were isolated in her cerebrospinal fluid. She was first treated with ...

  18. Biblical quotations in Faustus's Capitula | van den Berg | HTS ...

    African Journals Online (AJOL)

    Therefore, the work provides important insight into the Manichaeans' use and appreciation of Scripture. Faustus was well-known to the young Augustine and as a consequence the Capitula could well give us important insights into Augustine's knowledge of and opinions on Scripture as a Manichaean hearer. One problem ...

  19. De aanvoer van arbeiders voor den landbouw in Suriname

    NARCIS (Netherlands)

    Snellen, E.


    Not long after its discovery in the sixteenth century Surinam developed a plantation economy, needing many slaves from Africa. After the abolition of slavery in 1863, agricultural labour became very scarce. The thesis emphasizes the period 1863-1933, when the government of Surinam actively

  20. Macrodystrophia lipomatosa | van den Heever | SA Journal of ...

    African Journals Online (AJOL)

    SA Journal of Radiology. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 18, No 2 (2014) >. Log in or Register to get access to full text downloads.

  1. Noodgevalle in die Mediese Praktyk | van den Berg | South African ...

    African Journals Online (AJOL)

    ... dangers of negligence, and the need for prompt action. To apply these ideas in practice, written summaries of 'plans of action' must be kept in compact, easily available format. Goals for the future are improvement of individual standards, exchange of knowledge, team work, and utilization of available emergency services.

  2. CPD - The learning preferences of general practitioners | Van den ...

    African Journals Online (AJOL)

    Introduction: General Practitioners need to stay up to date and to maintain professional competence. The Health Professions Council of SA has introduced a mandatory recertification system starting in 1999. Insufficient research exists locally to reliably identify the continuing professional development (CPD) habits of GP's in ...

  3. Structure of Bor1 supports an elevator transport mechanism for SLC4 anion exchangers. (United States)

    Thurtle-Schmidt, Bryan H; Stroud, Robert M


    Boron is essential for plant growth because of its incorporation into plant cell walls; however, in excess it is toxic to plants. Boron transport and homeostasis in plants is regulated in part by the borate efflux transporter Bor1, a member of the solute carrier (SLC) 4 transporter family with homology to the human bicarbonate transporter Band 3. Here, we present the 4.1-Å resolution crystal structure of Arabidopsis thaliana Bor1. The structure displays a dimeric architecture in which dimerization is mediated by centralized Gate domains. Comparisons with a structure of Band 3 in an outward-open state reveal that the Core domains of Bor1 have rotated inwards to achieve an occluded state. Further structural comparisons with UapA, a xanthine transporter from the nucleobase-ascorbate transporter family, show that the downward pivoting of the Core domains relative to the Gate domains may access an inward-open state. These results suggest that the SLC4, SLC26, and nucleobase-ascorbate transporter families all share an elevator transport mechanism in which alternating access is provided by Core domains that carry substrates across a membrane.

  4. Basic principles of accounting and control of nuclear materials in the BOR-60 experimental fast reactor

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Gadzhiev, G.I.; Alekseev, I.N.


    Under a contract with the International Atomic Energy Agency, the V.I. Lenin Atomic Reactor Research Institute is currently carrying out a study of ways of organizing a nuclear materials accounting and control system for the BOR-60 fast reactor. Some results of this study are presented in the paper. The special physical and technological features of fast reactors create additional difficulties in safeguards systems and give rise to a number of new possibilities for the illicit removal of nuclear materials. These questions are discussed with reference to the BOR-60 reactor but the conclusions are probably applicable to all fast reactors. The proposed accounting and control system is based on non-destructive measurements of the amount of fissile materials in the operating fuel assemblies and screened bundles of the reactor, on the independent control of the principal facility parameters (a list of which is given) and on an automated information collection and evaluation system. Visual means of inspection can be very effective in fast reactor safeguards systems, especially for controlling storage, but they are not used with the BOR-60 reactor. (author)

  5. Den tidslogiske analyse af determinismeproblemet

    DEFF Research Database (Denmark)

    Øhrstrøm, Peter


    Artiklen diskuterer den filosofiske tidslogik med særligt henblik på A.N. Priors bidrag hertil. Det logiske determinismeproblem benyttes som gennemgående eksempel. Det vises endvidere, hvordan tidslogikken kan udnyttes til at analysere de logisk mulige positioner i en videnskabelig eller videnska...... videnskabsteoretisk debat. Her bruges den videnskabshistorisk betydende diskussion mellem Charles Darwin og Asa Gray som eksempel....

  6. Ensretning i den internationale skatteret

    DEFF Research Database (Denmark)

    Schmidt, Peter Koerver; Bundgaard, Jakob


    I lyset af den seneste tids begivenheder (herunder særligt Luxleaks-sagerne) og tiltag på den internationale skattescene ses der i artiklen nærmere på en række af de forhold, som trækker i retning af øget ensretning af selskabsskattereglerne i store dele af verden. Det gøres gældende, at staternes...

  7. Den guddommelige æstetik

    DEFF Research Database (Denmark)

    Moutamid, Mina El


    I denne artikel anlægges to perspektiver på det æstetiske i et forsøg på at identificere et forhold mellem det æstetiske og det religiøse. Med udgangspunkt i en fænomenologisk karakteristik af den religiøse oplevelse påvises en række lighedspunkter med den æstetiske oplevelse. Desuden defineres d...

  8. Den Blå Drage

    DEFF Research Database (Denmark)

    Ingerslev, Gitte Holten

    Denne publikation i serien Læselyst tjener tre formål. Den evaluerer læseprojektet Den blå drage i efteråret 2004 på Byskolen i Svendborg ? et projekt ledet af forfatteren Josefine Ottesen. Desuden gøres der rede for nogle af de teorier der støtter og begrunder arbejdsmåde og resultater i projektet...

  9. Events i den globale bykonkurrence

    DEFF Research Database (Denmark)

    Østergaard, Katrine


    Paper til ph.d. workshop, d. 9. december 2005. Dette paper beskriver, hvorfor og hvordan events kan bruges som strategi for byplanlægning og byudvikling i den globale bykonkurrence.......Paper til ph.d. workshop, d. 9. december 2005. Dette paper beskriver, hvorfor og hvordan events kan bruges som strategi for byplanlægning og byudvikling i den globale bykonkurrence....

  10. Medarbejderdreven innovation i den offentlige sektor

    DEFF Research Database (Denmark)

    Klitmøller, Anders; Lauring, Jakob; Christensen, Poul Rind


    Denne artikel har til formål at kaste lys over den rolle, medarbejderne spiller for den innovative aktivitet i den offentlige sektor, hvad vi har valgt at kalde medarbejderdreven innovation. Artiklen er baseret på et etnografisk feltstudie i Århus Kommune, nærmere bestemt den nye afdeling...

  11. Hvad karakteriserer den netbaserede vejledning?

    DEFF Research Database (Denmark)

    Kjeldsen, Lars Peter


    Hensigten med artiklen er at bidrage til forståelsen af sider ved den netbaserede vejledning. Fremgangsmåden vil være: •Først at beskrive og diskutere, hvorledes jeg forstår det virtuelle læringsmiljø, herunder en afklaring af, hvad der karakteriserer den netbaserede vejledning. •Dernæst gennem e...... teoretisk afsæt opstille en model for, hvorledes netbaseret vejledning kan bidrage til de studerendes læreproces. • Sidst at give eksempler på hvorledes modellen for netbaseret vejledning kan anvendes i praksis.......Hensigten med artiklen er at bidrage til forståelsen af sider ved den netbaserede vejledning. Fremgangsmåden vil være: •Først at beskrive og diskutere, hvorledes jeg forstår det virtuelle læringsmiljø, herunder en afklaring af, hvad der karakteriserer den netbaserede vejledning. •Dernæst gennem et...

  12. De geologie van den Cimone di Margno en den Monte di Muggio

    NARCIS (Netherlands)

    Buning, W.L.


    Le terrain étudié (fig. 1) est formé de roches métamorphiques pour plus de la moitié; le reste est formé de sédiments variant du Permien au Trias Inférieur, et de roches appartenant à la culmination éruptivocristalline du Cimone di Margno. Le relief du paysage présente en général des pentes douces.

  13. Cracking behavior and microstructure of austenitic stainless steels and alloy 690 irradiated in BOR-60 reactor, phase I.

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y.; Chopra, O. K.; Soppet, W. K.; Shack, W. J.; Yang, Y.; Allen, T. R.; Univ. of Wisconsin at Madison


    Cracking behavior of stainless steels specimens irradiated in the BOR-60 at about 320 C is studied. The primary objective of this research is to improve the mechanistic understanding of irradiation-assisted stress corrosion cracking (IASCC) of core internal components under conditions relevant to pressurized water reactors. The current report covers several baseline tests in air, a comparison study in high-dissolved-oxygen environment, and TEM characterization of irradiation defect structure. Slow strain rate tensile (SSRT) tests were conducted in air and in high-dissolved-oxygen (DO) water with selected 5- and 10-dpa specimens. The results in high-DO water were compared with those from earlier tests with identical materials irradiated in the Halden reactor to a similar dose. The SSRT tests produced similar results among different materials irradiated in the Halden and BOR-60 reactors. However, the post-irradiation strength for the BOR-60 specimens was consistently lower than that of the corresponding Halden specimens. The elongation of the BOR-60 specimens was also greater than that of their Halden specimens. Intergranular cracking in high-DO water was consistent for most of the tested materials in the Halden and BOR-60 irradiations. Nonetheless, the BOR-60 irradiation was somewhat less effective in stimulating IG fracture among the tested materials. Microstructural characterization was also carried out using transmission electron microscopy on selected BOR-60 specimens irradiated to {approx}25 dpa. No voids were observed in irradiated austenitic stainless steels and cast stainless steels, while a few voids were found in base and grain-boundary-engineered Alloy 690. All the irradiated microstructures were dominated by a high density of Frank loops, which varied in mean size and density for different alloys.

  14. Eerste inschatting van vrijkomen van plastics als gevolg van slijtage van Mosselzaad-Invagsystemen (MZI's)

    NARCIS (Netherlands)

    Hartog, E.; Brink, van den A.M.; Kamermans, P.


    IMARES heeft onderzoek uitgevoerd naar het ontstaan en de aanwezigheid van microplastic zwerfvuil afkomstig van mosselzaad invangsystemen (hierna MZI’s genoemd). Deze studie is onderdeel van een opdracht van het ministerie van EL&I, om de ecologische effecten van opschaling van MZI’s in de

  15. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Gardić Vojka R.


    Full Text Available Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj River, which still flow into the Timok River and Danube River. These pollutions are often presented by low pH value, increased content of heavy metal ions, suspended particles and fine particles of flotation tailings, which is deposited in the valleys of these rivers on the area of over 2000 hectares. During the decades of exploitation of ore from the open pit Bor at different locations ("Visoki Planir" - also called “Oštreljski planir”, "Severni planir" dump of ore body "H" (RTH gangue and tailings were delayed. The largest amount of tailings, about 150 million tons, was postponed on location Visoki planir. The effect of the mining waste and the impact of the whole process of processing copper ore to the final products on the environment, was conducted during the 4th study period of the project "Management of mining waste-tailing dump in the Bor region," supported by the Japan Society for the Promotion Science (Eng. Japan Society for the Promotion of Science and the Japan international cooperation Agency and the Ministry of environment, Mining and Spatial planning of the Republic of Serbia. Influence of season on the level of pollutants in soil and water, the impact on water quality in the river Timok and the River Danube, was conducted during first three periods of project. This paper presents the results of the third study period. The third period of research, which was conducted over a period of 17. 10. 2012 to 17. 01.2013 year, included a review of pollution sources and define their

  16. Characterization of BOR-60 Irradiated 14YWT-NFA1 Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maloy, Stuart Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aydogan, Eda [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Tubes of FCRD 14YWT-NFA1 Alloy were placed in the BOR-60 reactor and irradiated under a fast flux neutron environment to two conditions: 7 dpa at 360-370 °C and 6 dpa at 385-430 °C. Small sections of the tube were cut and sent to UC Berkeley for nanohardness testing and focused ion beam (FIB) milling of TEM specimens. FIB specimens were sent back to LANL for final FIB milling and TEM imaging. Hardness data and TEM images are presented in this report. This is the first fast reactor neutron irradiated information on the 14YWT-NFA1 alloy.

  17. Katalytisch verbranden van varkensmest

    NARCIS (Netherlands)

    Hendriks, J.


    Door het verbranden van mest kan het mestvolume worden verkleind. Binnenkort gaat op het Varkensproefbedrijf 'Zuid- en West-Nederland' in Sterksel onderzoek van start om de mogelijkheden van het katalytisch verbranden van varkensmest te bekijken.

  18. den og morderen

    DEFF Research Database (Denmark)

    Hansen, Kim Toft


    forskellige versioner af Forbrydelsen: DR's oprindelige udgave, AMC's udgave The Killing og David Hewsons roman Forbrydelsen, der er baseret på manuskriptet til DR-serien. Grundfortællingen under disse tre versioner relaterer jeg til H.C. Andersens "Historien om en Moder" og tilskrivningen af mening til døden....

  19. Tillid i den finansielle sektor

    DEFF Research Database (Denmark)

    Rimmer, Nina Røhr; Nielsen, Sara Møller; Benediktsdottir, Elisabet


    , der er i kommunikation med kunden, eksempelvis at videreudvikle på definerede Touch-Points i CEM og opbyggelsen/vedligeholdelsen af kundeoplysninger i CRM systemer således, at den samlede kvalitet af ydelsen bliver så personlig som mulig, hvilket falder godt i tråd med Spar Nords værdigrundlag om dels...

  20. Berlusconi og den moderne fyrste

    DEFF Research Database (Denmark)

    Sørensen, Gert

    voksende forbrugermentalitets gennembrud. Tredje del sætter ind over for Berlusconis frontale angreb på de demokratiske principper og samler op omkring Italiens dybe krise. Den gennemgående analytiske figur er hentet fra Machiavellis Fyrsten om magtens mål og med. Dele af bogen er blevet til i samarbejde...

  1. Publikum svinger den retoriske taktstok

    DEFF Research Database (Denmark)

    Hansen, Jette Barnholdt


    Artiklen handler om revyvisen "Man binder os på mund og hånd" af Poul Henningensen med musik af Kai Normann Andersen, som oprindeligt var en del af den kulturradikale revykomedie Dyveke fra 1940, der bla. advokerede for seksuel frigørelse. Visen levede dog hurtigt sit eget liv uden for revyteatret...

  2. Den svage tænkning

    DEFF Research Database (Denmark)

    Dehs, Jørgen


    Interview med Gianni Vattimos. Italiensk politisk kultur, forholdet mellem politikeren og den intelektuelle og Gianni Vattimos program.......Interview med Gianni Vattimos. Italiensk politisk kultur, forholdet mellem politikeren og den intelektuelle og Gianni Vattimos program....

  3. den på glas

    DEFF Research Database (Denmark)

    Meyer, Ion


    Artiklen beskriver den eneste danske samling af præparerede fostre og børn, og hvorfor den blev fremstillet. Den var en del af Museum Saxtorphianum og artiklen diskuterer hvordan disse fostre blev til præparater. Musealiseringen, overgangen fra medicinske studieobjekter til museumsgenstande med s...

  4. Den sociale stofmisbrugsbehandling. Del 1

    DEFF Research Database (Denmark)

    Heltberg, Therese

    Denne rapport er den første delrapport i en undersøgelse af den sociale stofmisbrugsbehandling i Danmark, som SFI har gennemført for Servicestyrelsen i perioden december 2007 til maj 2009. Undersøgelsen omhandler den sociale stofmisbrugsbehandling efter § 101 i Serviceloven, mens undersøgelsen i ...

  5. Peculiarities of 137Cs accumulation by macromycetes in dry bors of Ukrainian Polessye

    International Nuclear Information System (INIS)

    Orlov, O.O.; Kurbet, T.B.; Kalyish, O.B.; Prishchepa, O.L.


    The main ecological peculiarities of dry bor in Ukrainian Polessye were given. Research were carried out in Central Polessie of Ukraine during 1997 - 1999. Results were obtained due to spectrometric measurement of specific activity of 137 Cs in fruit bodies of mushrooms and in the soil. Species composition of macromycetes was divided on homogeneous groups on intensity of 13 7Cs accumulation. Amanita porphyria, A. muscaria and Tricholoma portentosum belong to the group of weak 137 Cs accumulation from the soil (TF = 15 - 20); Amanita pantherina, A. phalloides, Cantharellus cibarius, Boletus edulis, Tricholoma flavovirens and Laccaria laccata - to the group of moderate radionuclide accumulation (TF = 30 - 55). The group of strong 137 Cs accumulation (TF = 100 - 180) consists of Suillus variegates, S. bovines and Hydnum imbricatum; and group of very strong accumulation (TF 200 - 280) - of Xerocomus badius, Lactarius rufus, Russula xerampelina, Cortinarius varius and Paxillus involutus. Cortinarius sanguineus (with TF 400) is an accumulator of 137 Cs. Comparative evaluation of dry bor was given from the point of view of purchase of edible macromycetes in it

  6. Imidacloprid of niet? (interview met Sjef van der Steen)

    NARCIS (Netherlands)

    Kleis, R.; Steen, van der J.J.M.


    Is bijensterfte het werk van neonicotinoïden? Ja, zeggen en denken velen. Volgens hen zijn de neo’s rechtstreeks verantwoordelijk voor de hoge sterfte onder bijen. Nee, toont Wagenings onderzoek aan. Intussen lijkt het met de sterfte voorzichtig de goede kant op te gaan.

  7. Het grootste woordenboek ter wereld | van Wyk | Lexikos

    African Journals Online (AJOL)

    F. Heyvaert, A. Moerdijk, M. Mooijaart, M. Smits en R. Tempelaars (redactie). Het grootste woordenboek ter wereld: Een kijkje achter de kolommen van het Woordenboek der Nederlandsche Taal (WNT), s.j., 434 pp. ISBN 90 75566 96 4. URL: Den Haag: SDU Uitgevers / Antwerpen: Standaard Uitgeverij.

  8. Systematisch implementeren van vernieuwingen. Waar kies je voor?

    NARCIS (Netherlands)

    Guus Munten; Miranda Snoeren; Shaun Cardiff


    Het invoeren of implementeren van vernieuwingen in de gezondheidszorg is ingewikkeld. Iedere verpleegkundige die al eens iets heeft willen veranderen heeft dat waarschijnlijk aan den lijve ondervonden. Ondanks deze moeilijkheden hebben we als professional de uitdagende taak om bij te dragen aan het

  9. Da den moderne jazz kom til Danmark

    DEFF Research Database (Denmark)

    Høyer, Ole Izard; Nielsen, Anders H.U.

    som tog over, deriblandt Erik Moseholm, Bent Axen og Jørn Elniff. Denne bog forklarer, hvordan den moderne jazz kom til Danmark, og hvordan den udviklede det danske jazzmiljø. Den inddrager faktorer som udenlandske musikeres besøg, koncerter og efterfølgende jazzsessions. Hvilken betydning havde disse...... for den danske jazzudvikling? Hvor blev musikken spillet, og hvordan blev den behandlet af medierne og af samfundet? Sammen med beskrivelser af de vigtigste moderne jazzmusikere fra perioden, analyseres og beskrives en række indspilninger af moderne dansk jazz for at undersøge hvornår, og hvilke af de nye...

  10. Verbeteren van functionele fitheid van brandweermensen

    NARCIS (Netherlands)

    van Orden, Claudia Y.D.

    Posterpresentatie over IAG4-project 'Functional Fitness Monitor', een methodiek voor het verbeteren van functionele fitheid van brandweermensen door een combinatie van meten, presenteren van feedback en coaching. Gepresenteerd op Symposium Healthy Work: Good for Business, gehouden op 29 april 2016

  11. Den kulturelle dimension af virksomhedens internationalisering

    DEFF Research Database (Denmark)

    Langhoff, Tine


    Artiklen omhandler den kulturelle dimensions indvirkning på virksomhedens internationalisering og diskuterer mulige internationalisieringsstrategier for virksomheder, der konfronteres med kulturforskelle. Med udgangspunkt i en kritik af den hidtidige forskning på området, hvor det såkaldte psykiske...... distancebegreb har haft en central placering, foreslås det, at man som alternativ til dette begreb skal fokusere på virksomhedens markedsbaserede innovationsevne. Denne betegnes som dens interkultu kompetence og vedrører dens evne til at identificere og udnytte muligheder i fremmede kulturelle sammenhænge. Det...... er herved, at den kulturelle dimension påvirker virksomheden og dens fortsatte udvikling. En empirisk analyse i den danske fødevarebranche afdækker virksomheders interkulturelle kompetence ved hjælp af to spørgsmål: (1) Hvorledes formår virksomheder med begrænsede ressourcer til deres disposition...

  12. Den onde eller det onde?

    DEFF Research Database (Denmark)

    Nielsen, Kirsten


    Artiklen handler om brugen af billeder for den onde (djævelen) og det onde i moderne salmer. Der er en klar tendens til at foretrække et naturbillede som mørket frem for personbilleder. Mørket kan som billede bruges forholdsvis nuanceret og vil i mange tilfælde ikke forudsætte et dybere kendskab ...

  13. Finanční analýza podniku BRISK Tábor, a.s.


    Hašek, Jan


    Diploma is focused on Financial analysis, importance of it, users, implementation analysis on factual company -- BRISK Tábor, a.s., evaluation based on analysis financial statements, ratio indicators, working capital, balance order, scheme of indicators, analysis of financial arm and comparison intercompany.

  14. Finanční analýza podniku IDEAL AUTOMOTIVE Bor, s.r.o.


    Velebová, Štěpánka


    The aim of this bachelor thesis is to identify the financial situation of IDEAL AUTOMOTIVE Bor, Ltd., determine the strenghts and weaknesses of the company, and suggest some ideas of what to do in the future, so that the company could prosper

  15. Monitoring the Effect of Internet Use on Students Behavior Case Study: Technical Faculty Bor, University of Belgrade (United States)

    Niculovic, Milica; Zivkovic, Dragana; Manasijevic, Dragan; Strbac, Nada


    A large number of criteria for evaluating Internet addiction have been developed recently. The research of Internet addiction among students of the Technical faculty in Bor, University of Belgrade has been conducted and its results are presented in this paper. The study included 270 students using criteria of Young's Internet Addiction Test. In…

  16. Metamorphosis of Shell's office buildings in The Hague, Netherlands; Metamorfose Shell Den Haag

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, G.F.A. [Valstar Simonis, Apeldoorn (Netherlands); Van Mierlo, W.J.M. [Shell, Den Haag (Netherlands)


    In a project to renovate the Shell office buildings in The Hague, Netherlands, the new buildings are served by a new power plant based on a heat pump and an underground thermal storage system. Use of a heating curve in the high-temperature heating system of the renovated building sections made it possible to create a link between the new low-temperature heating system and the existing high-temperature heating system. A similar link was created for cooling. [Dutch] Bij de herstructurering van het gebouwencomplex van Shell in Den Haag is voor de nieuwe gebouwen een energiecentrale met een warmtepomp en ondergronds energieopslagsysteem gerealiseerd. Door gebruik te maken van een stooklijn in het hooggestookte verwarmingssysteem van de gerenoveerde bouwdelen, is een koppeling aangebracht tussen het nieuwe Iaagtemperatuur verwarmingssysteem en het bestaande hooggestookte verwarmingssysteem. Ook voor de koeling is een dergelijke koppeling gemaakt.

  17. Konsulenten i den anden nat

    DEFF Research Database (Denmark)

    Kirkegaard, Line

    for i sit deres liv og den eksistensmåde, der hermed muliggøres. Med dette ønsker jeg at bidrage til de eksisterende work-life balance teorier. Min vej ind i teorierne er nemlig, at logikken i mit empiriske materiale forekommer så forskelligt fra de traditionelle work-life balance teorier, at disse ikke...... lader sig forene. Jeg foretage derfor en analyse af den eksisterende litteratur, og rejser i den forbindelse en grundlæggende kritik af work-life balance teorierne, for at operere med falske problemstillinger på en måde, så svaret allerede indgår i de spørgsmål, der stilles. Jeg argumenterer således for......, at det problematiske forhold ved work-life balance teorierne allerede skal søges i konstitueringen af deres problematik, hvor arbejde og fritid indgår som to distinkte og kontrasterende sfærer. Ubalance eller problemer søges således altid i relationen her imellem. I forlængelse heraf argumenterer jeg for...

  18. DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana. (United States)

    Yoshinari, Akira; Fujimoto, Masaru; Ueda, Takashi; Inada, Noriko; Naito, Satoshi; Takano, Junpei


    Boron (B) is essential for plants but toxic in excess. The borate efflux transporter BOR1 is expressed in various root cells and localized to the inner/stele-side domain of the plasma membrane (PM) under low-B conditions. BOR1 is rapidly degraded through endocytosis upon sufficient B supply. The polar localization and degradation of BOR1 are considered important for efficient B translocation and avoidance of B toxicity, respectively. In this study, we first analyzed the subcellular localization of BOR1 in roots, cotyledons and hypocotyls, and revealed a polar localization in various cell types. We also found that the inner polarity of BOR1 is established after completion of cytokinesis in the root meristem. Moreover, variable-angle epifluorescence microscopy visualized BOR1-green fluorescent protein (GFP) as particles in the PM with significant lateral movements but in restricted areas. Importantly, a portion of BOR1-GFP particles co-localized with DYNAMIN-RELATED PROTEIN 1A (DRP1A), which is involved in scission of the clathrin-coated vesicles, and they disappeared together from the PM. To examine the contribution of DRP1A-mediated endocytosis to BOR1 localization and degradation, we developed an inducible expression system of the DRP1A K47A variant. The DRP1A variant prolonged the residence time of clathrin on the PM and inhibited endocytosis of membrane lipids. The dominant-negative DRP1A blocked endocytosis of BOR1 and disturbed its polar localization and B-induced degradation. Our results provided insight into the endocytic mechanisms that modulate the subcellular localization and abundance of a mineral transporter for nutrient homeostasis in plant cells. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email:

  19. Van bescheiden humanist tot vechtjas. Viglius van Aytta en de crisis van 1566-1567

    Directory of Open Access Journals (Sweden)

    F. Postma


    Full Text Available From Modest Humanist to Argumentative Aggressor. Viglius van Aytta and the Crisis of 1566-1567In this essay I examine the dealings of the president of the Privy Council of the Netherlands, Viglius van Aytta (1507-1577 between the presentation of the Request of the Lower Nobility in April 1566 and the departure of Alva and his army from Italy a year later. Since Motley, Fruin and Bakhuizen van den Brink in the nineteenth century reinvented the Dutch Revolt, Viglius, in spite of his intellect and office, has not been held in high esteem. At best he was considered to be mediocre, and at worst a coward. The most recent verdict on Viglius was passed by H.G. Koenigsberger who referred to him in 2001 as ‘an intelligent if unimaginative lawyer from Friesland’. My essay is an attempt to refute this incorrect image. I do this by looking at the way Viglius handled the crisis of 1566-1567 in the first and the second town of the Netherlands, Brussels and Antwerp.

  20. Optimaliseren van een biovergister

    NARCIS (Netherlands)

    van der Bij, Joost; Rademaker, Mark; Visser, Klaas; de Vries, Herman


    Dit rapport beschrijft onderzoek van conversie van biomassa in een Swill-gasser geplaatst bij het Van der Valk restaurant in Cuijk. De Swill-gasser is een biomassa vergister voor restaurant afval. Het onderzoek heeft zich gericht op het optimaliseren van de data acquisitie en op het bepalen van de

  1. Effectieve bestrijding van varroa

    NARCIS (Netherlands)

    Cornelissen, B.; Blacquiere, T.; Steen, van der J.J.M.


    De varroa mijtziekte (Varroa destructor) is de belangrijkste bedreiging van de Europese honingbij. Wintersterfte van honingbijen is in de meeste gevallen toe te schrijven aan deze ziekte. Deze brochure van de WUR biedt informatie over de biologie van varroa, de effecten van varroa op honingbijen en

  2. Mechanical properties and TEM examination of RAFM steels irradiated up to 70 dpa in BOR-60

    Energy Technology Data Exchange (ETDEWEB)

    Gaganidze, E., E-mail: [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Petersen, C.; Materna-Morris, E.; Dethloff, C.; Weiss, O.J.; Aktaa, J. [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Povstyanko, A.; Fedoseev, A.; Makarov, O.; Prokhorov, V. [Joint Stock Company ' State Scientific Centre Research Institute of Atomic Reactors' , 433510 Dimitrovgrad-10, Ulyanovsk Region (Russian Federation)


    Mechanical properties of Reduced Activation Ferritic/Martensitic (RAFM) steels were studied after irradiation in BOR-60 reactor to a neutron displacement damage of 70 dpa at 330-340 deg. C. Yield stress and Ductile-to-Brittle-Transition-Temperature of EUROFER97 indicate saturation of hardening and embrittlement. The phenomenological models for description of microstructure evolution and resulting irradiation hardening and embrittlement are discussed. The evolution of yield stress with dose is qualitatively understood within a Whapham and Makin model. Dislocation loops examined in TEM are considered a main source for low-temperature irradiation hardening. The analysis of the fatigue data in terms of the inelastic strain reveals comparable fatigue behaviour both for unirradiated and irradiated conditions, which can be described by a common Manson-Coffin relation. The study of helium effects in B-doped model steels indicated progressive material embrittlement with helium content. Post-irradiation annealing of RAFM steels yielded substantial recovery of mechanical properties.

  3. New evidence for prehistoric copper metallurgy in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar


    Full Text Available The last three years of archaeological investigations at the site Ru`ana in Banjsko Polje, in the immediate vicinity of Bor, have provided new evidence regarding the role of non-ferrous metallurgy in the economy of the prehistoric communities of north-eastern Serbia. The remains of metallurgical furnaces and a large amount of metallic slags at two neighbouring sites in the mentioned settlement reveal that locations with many installations for the thermal processing of copper ore existed in the Bronze Age. We believe, judging by the finds of material culture, that metallurgical activities in this area also continued into the Iron Age and, possibly, into the 4th century AD. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Archaeology of Serbia: Cultural identity, integration factors, technological processes and the role of the central Balkans in the development of European prehistory

  4. Produktie van pigmenten

    NARCIS (Netherlands)

    Etman EJ; Duesmann HB; Eijssen PHM; LAE


    Dit rapport over de produktie van pigmenten is gepubliceerd binnen het Samenwerkingsproject Procesbeschrijvingen Industrie Nederland (SPIN). In het kader van dit project is informatie verzameld over industriele bedrijven of industriele processen ter ondersteuning van het overheidsbeleid op het

  5. Kosten van allogene stamceltransplantaties

    NARCIS (Netherlands)

    M. van Agthoven (Michel); M.T. Groot (Martijn); C.A. Uyl-de Groot (Carin)


    textabstractAllogene stamceltransplantatie is een topspecialistische procedure die met succes kan worden ingezet in de behandeling van (hematologische) maligniteiten, met name bij leukemie. Van oudsher worden transplantaten van verwante donoren gebruikt, maar met de mogelijkheden om transplantaten

  6. Die grossen Physiker und ihre Entdeckungen von den fallenden Körpern zu den Quarks

    CERN Document Server

    Segrè, Emilio


    Von Galileo Galilei bis zu Richard Feynman und Murray Gell-Mann - von den fallenden Körpern zu den Quarks: Der Physiknobelpreisträger Emilio Segre hat seine ganz persönliche Geschichte der Physik geschrieben. Er erzählt von den großen Gestalten und deren wichtigen Entdeckungen mit großer Anschaulichkeit und Lebendigkeit.

  7. Een revisie van de taxonomie van gifkikkers

    NARCIS (Netherlands)

    Poelman, E.H.


    Recent kwam het lang verwachte ruim tweehonderdvijftig pagina`s tellende manuscript uit met daarin een revisie van de taxonomie van gifkikkers. De auteurs onder leiding van Taran Grant stellen een nieuwe taxonomie voor, die de familie Dendrobatidae met haar tien algemener geaccepteerde genera

  8. Detectie van ziektesymptomen met behulp van fluorescentiebeelden

    NARCIS (Netherlands)

    Loon, van P.C.C.


    Rapport over de positie van de biologische paddestoelenteelt op intersectoraal en (inter)-regionaal niveau. Het overzicht in tabel- en schemavorm van de stromen grondstoffen en producten verduidelijkt de intersectorale positie van de champignonteelt. Dit kan een aanzet zijn bij het signaleren en

  9. Forever Young - den norske tv-serie Skam

    DEFF Research Database (Denmark)

    Jerslev, Anne


    Hvorfor er det lige, at den norske netbaserede ungdomsserie "Skam" er på alles læber for tiden? Svaret er simpelt: Den er nyskabende og supergod, og den taler til en langt bredere målgruppe end den gruppe af teenagepiger, den er rettet mod....

  10. Een geschiedenis van vleesloos eten

    NARCIS (Netherlands)

    Dagevos, H.


    Recensie van de populaire editie van het proefschrift van Dirk-Jan Verdonk: Het dierloze gerecht: een vegetarische geschiedenis in Nederland. Hierin wordt de geschiedenis van het vegetarisme vanaf de tweede helft van de 19e eeuw tot nu beschreven

  11. De beteekenis der persoonsnamen voor onze kennis van het leven en denken der oude babyloniërs en assyriërs

    NARCIS (Netherlands)

    Gemser, Berend


    a. Antiek Naamsbegrip. Als GOETHE in de Faust den hoofdpersoon, sprekende met Margarete in Marthe's tuin over God, zeggen laat: "Nenn es dann, wie du willst,.... Gefühl ist alles; Name is Schall und Rauch, umnebelnd Himmelsglut", dan is dit modern en niet antiek gevoeld. Voor den mensch van de

  12. Cornelis den Hartog: an outstanding aquatic ecologist

    NARCIS (Netherlands)

    Velde, van der G.; Brock, T.C.M.; Kempers, A.J.


    A survey is given of the work and life of Cornelis den Hartog up to the date in 1996 on which he retired from his position as a professor at the University of Nijmegen. Cornelis (Kees) den Hartog made important contributions to aquatic ecology in the widest sense, e.G. On brackish water typology,

  13. Nyliberalisme, universiteter og den akademiske frihed

    DEFF Research Database (Denmark)

    Madsen, Mogens Ove


    Akademisk frihed er uløseligt forbundet med det, der er selve universitetets væsen. New Public Management er dog sevet ind i den offentlige forvaltning og kapitlet giver et signalement af, hvilke konsekvenser dette har haft for universiteterne og den akademiske frihed...

  14. koncernbegrebet og tilbudspligtens indtræden

    DEFF Research Database (Denmark)

    Clausen, Nis Jul; sørensen, karsten engsig


      Med den nye selskabslov og de hertil knyttede ændringer i værdipapirhandelslovens regler om tilbudspligt har man fastholdt ønsket om parallelitet mellem det selskabsretlige koncernbegreb og kriterierne for tilbudspligtens indtræden. Det drøftes, om koncernbegrebet reelt er overført til tilbudsp...

  15. Den tabte fortælling

    DEFF Research Database (Denmark)

    Jørgensen, Kenneth Mølbjerg


    Ledelse er et af nøgleordene i fornyelsen af den offentlige sektor. Vi har imidlertid glemt et væsentligt aspekt af ledelse. Dette skyldes ikke mindst, at omgangsformen i dag er reguleret af information, mens den tidligere var reguleret af fortælleevnen. Evnen til dialog, indlevelse og nærvær er...

  16. Luftstaub über den Meeren

    DEFF Research Database (Denmark)

    Kacunko, Slavko; Kacunko, Sabine; Gorbushina, Ana


    Staub umgibt uns überall und alles wird auch irgendwann zu Staub - ob wir wollen oder nicht. Staub nicht nur zu bekämpfen, sondern zu untersuchen, bildet den Ausgangspunkt zahlreicher Forschungen in den Natur-, Ingenieur- und Kulturwissenschaften. Der vorliegende Band verbindet solche Beiträge au...

  17. Study of the accumulation and distribution of the radioactivity in the cooling circuit of the BOR-60 reactor

    International Nuclear Information System (INIS)

    Kizin, V.D.; Konyashov, V.V.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Yu.V.


    The results of measurements of the radioactivity of the coolant and the deposits in the primary circuit of the BOR-60 reactor during its five years of operation are discussed. The values calculated for the exposure dose rate from the piping system and the contribution of the γ-radiation from the corrosion and fission product nuclides are given. The efficiency of coolant draining from the pipes in reducing the dose rate is estimated. (orig.) [de

  18. Ziekten van het ruggenmerg

    NARCIS (Netherlands)

    Groen, Robertus; Kuks, Joannes; Snoek, Jozef; Kuks, Jan B.M.; Snoek, Jos W.


    Er zijn vele oorzaken voor een myelopathie. Beschadiging van het myelum kan compleet zijn (zoals in het geval van een complete dwarslaesie), maar is vaker incompleet (zoals bij een incomplete traumatische dwarslaesie en de meeste vormen van myelopathie op basis van niet-traumatische oorzaken). Er

  19. Economische gevolgen van ontwapening

    NARCIS (Netherlands)

    Duisenberg, Willem Frederik


    Samenvatting van de gehele studie 4.1. Economie en ontwapening Ontwapening betekent in deze studie de algehele, snelle afschaffing van alle militaire maatregelen in aIle landen. Het negeren van de politieke waarschijnlijkheden die veeleer wijzen op een zeer geleidelijke afschaffing van slechts

  20. Van die Gasredakteur

    African Journals Online (AJOL)

    cherish and teach.'1. Die Fakulteit Geneeskunde van die Universiteit van die Oranje-Vrystaat het pragtig gegroei ge- durende die eerste 21 jaar van sy bestaan. Die entoesiasme, doelgerigtheid, harde werk en inisia- tiewe van 'n groot aantal persone was hiervoor verantwoordelik. 'If we see a bit more clearly than they, it is ...

  1. Gevolgen van hydrocephalus

    NARCIS (Netherlands)

    Tromp, Cornelis Nicolaas


    Hydrocephalus is een aandoening van het centrale zenuwstelsel die de clinicus vrij lang voor grote problemen ten aanzien van de behandeling heeft qesteld. Door de toepassing van de ventriculo-atriale shunttechniek zijn de behandelingsmogelijkheden van hydrocephalus sterk verbeterd. Deze studie

  2. Geochemische bodematlas van Nederland

    NARCIS (Netherlands)

    Mol, G.; Spijker, J.H.; Gaans, van P.; Römkens, P.F.A.M.


    Deze Geochemische bodematlas geeft een uniek overzicht van de chemische samenstelling van de bodem in Nederland. Bodemmonsters van meer dan 350 locaties zijn geanalyseerd op meer dan 40 chemische elementen. De atlas geeft niet alleen informatie over de door de mens beïnvloede toplaag van de bodem,

  3. Neurotoxische effecten van broomcyclohexaan

    NARCIS (Netherlands)

    Velsen; F.L.van; Danse; L.H.J.C.; Vries;; Liefde;


    Kortdurende toediening (4-7 dagen) van broomcyclohexaan (BCH) veroorzaakt in een dosering van 1200 mg/kg lichaamsgewicht (per maagsonde) necrose van gegranuleerde cellen in de korrellaag van de kleine hersenen. In deze doseringen zijn ook gedragsafwijkingen waargenomen d.m.v. een objectieve

  4. Genfortryllelse i den digitale tidsalder

    DEFF Research Database (Denmark)

    Madsen, Theis Vallø

    , hvilket bl.a. kommer til udtryk i en ny vinylplade- og polaroidbillede-interesse. Denne undersøgelse går tilbage til begyndelsen af oplysningstiden, op igennem det 20. århundrede og frem til vores digitale kultur for at beskrive baggrunden og forestillingerne bag denne form for “analog æstetik”.......I den digitale tidsalder bliver uhyre mængder af information, billeder og musik noget nær frit tilgængelige, uendeligt reproducérbare og frigjort fra sit ”her” og ”nu”. I samme stund er der opstået en fornyet interesse for artefakter, der er stoflige, håndgribelige og u- eller anti-digitale...

  5. Denning of grizzly bears in the Yellowstone National Park area (United States)

    Judd, Steven L.; Knight, Richard R.; Blanchard, Bonnie M.


    Radiotelemetry was used to locate 101 grizzly bear (Ursus arctos) dens from 1975 to 1980; 35 dens were examined on the ground. Pregnant females denned in late October, and most other bears denned by mid-November. Duration of denning average 113, 132, and 170 days for males, females, and females with new cubs, respectively. Males emerged from mid-February to late March, followed by single females and females with yearlings and 2-year-olds. Females with new cubs emerged from early mid-April. Den sites were associated with moderate tree cover (26%-75% canopy cover) on 30°-60° slopes. Dens occurred on all aspects, although northerly exposures were most common. Grizzly bears usually dug new dens but occasionally used natural cavities or a den from a previous year. Males usually dug larger dens than females with young. Eight excavated and 2 natural dens of the 35 examined dens were used for more than 1 year.

  6. Interpenetrated Uranyl-Organic Frameworks with bor and pts Topology: Structure, Spectroscopy, and Computation. (United States)

    Liu, Chao; Chen, Fang-Yuan; Tian, Hong-Rui; Ai, Jing; Yang, Weiting; Pan, Qing-Jiang; Sun, Zhong-Ming


    Two novel three-dimensional interpenetrated uranyl-organic frameworks, (NH 4 ) 4 [(UO 2 ) 4 (L 1 ) 3 ]·6H 2 O (1) and [(UO 2 ) 2 (H 2 O) 2 L 2 ]·2H 2 O (2), where L 1 = tetrakis(3-carboxyphenyl)silicon and L 2 = tetrakis(4-carboxyphenyl)silicon, were synthesized by a combination of two isomeric tetrahedral silicon-centered ligands with 3-connected triangular [(UO 2 )(COO) 3 ] - and 4-connected dinuclear [(UO 2 ) 2 (COO) 4 ] units, respectively. Structural analyses indicate that 1 possesses a 2-fold interpenetrating anion bor network, while 2 exhibits a 3-fold interpenetrated 4,4-connected neutral network with pts topology. Both compounds were characterized by thermogravimetric analysis and IR, UV-vis, and photoluminescence spectroscopy. A relativistic density functional theory (DFT) investigation on 10 model compounds of 1 and 2 shows good agreement of the structural parameters, stretching vibrational frequencies, and absorption with experimental results; the time-dependent DFT calculations unravel that low-energy absorption bands originate from ligand-to-uranium charge transfer.

  7. 1x2M steel performance in the BOR-60 steam generator

    International Nuclear Information System (INIS)

    Golovanov, V.N.; Shamardin, V.K.; Kondratiev, V.I.; Kryukov, F.N.; Chernobrovkin, Yu.V.; Bulanova, T.M.; Bai, V.F.

    The results from studies of 1x2M steel characteristics are presented. This steel was used as the material for the BOR-60 steam generator that had been in operation under the steam generating mode for 18,000 hs (35,000 hs in sodium). It was revealed that the pit corrosion depth on the water/steam side evaporative tube surfaces was about 0.25 μm and less and the total corrosion rate was less than 0.06 mm/y. The mechanical properties of the material were essentially similar both in the evaporator and superheater and met all the requirements imposed on. Based on the analysis of data on the decarbonizaton depth in sodium and on the corrosion damage in water and steam it was concluded that 1x2M steel can be successfully used as the steam generator material at the operating temperatures up to 470 deg. C and had sufficiently longer service-life as compared to 18,000 hs. (author)

  8. Acoustic noises of the BOR-60 reactor steam generators when simulating leaks with argon and steam

    International Nuclear Information System (INIS)

    Sokolov, V.M.; Golushko, V.V.; Afanas'ev, V.A.; Grebenkin, Yu.P.; Muralev, A.B.


    Background acoustic noises of stea generators in different operational regimes and noises of argon and steam small leads (about 0.1 g/s) are studied to determine the possibility of designing the acoustic system for leak detection in sodium-water steamgenerators. Investigations are carried out at the 30 MW micromodule steam generator being in operation at the BOR-60 reactor as well as at the 20 MW tank type steam generator. Immersed ransduceres made of lithium niobate 6 mm in-diameter and waveguide transducers made of a stainless steel in the form of rods 10 mm in-diameter and 500 mm long are used as acoustic monitors. It is shown that the leak noise is more wide-band than the background noise of the steam generator and both high and low frequencies appear in the spectrum. The use of monitors of different types results in similar conslusions inrelation to the character of background noises and leak signals (spectral density, signal to-noise ratio) in the ase of similar bandroidths of the transduceres. A conclusion is made that the change of operational regimes leads to changes of background noise level, which can be close to the reaction of

  9. Radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor

    International Nuclear Information System (INIS)

    Ilvonen, M.; Rossi, J.; Salonoja, M.


    The present study is an application of the long range transport and dose model TRADOS developed jointly by the Finnish Meteorological Institute and Technical Research Centre of Finland. The aim of the study is to assess the radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor near St. Petersburg in Russia. Probabilities of reaching different parts of the country, transport time and time spent over Finland by the trajectories are presented. Also breadth of the radioactive cloud and incidence of rain are estimated. The calculated radiation doses are based on one single hypothetical release, in which all noble gases are released, together with 10 % of easily vaporizing elements and 1 % of others. All results are based on the assumption that the probability of the release is 100 %. The dose pathways calculated are cloud gamma, fallout gamma, inhalation, and ingestion of milk, meat, green vegetables, grain and roots. External dose rates have been calculated. The necessity of countermeasures and the ratio of the avertable dose to the costs are also assessed. (13 refs., 156 figs., 12 tabs.)

  10. Spatial and functional city structure with examples of Valjevo, Bor and Knjaževac

    Directory of Open Access Journals (Sweden)

    Spasić Nenad


    Full Text Available Cities represent such social environments which develop under the influence of their resource hinterland, yet at the same time they vigorously affect changes in their immediate or broader surroundings, depending on dynamics of city limits change. From city origins to the present day, interdependences between its spatial and functional structures can be noticed. Historical context plays a significant role in city development, both in terms of its spatial structure formation as well as in terms of development of city functions and territorial distribution of urban services. Spatial structure of a city is also defined by a set of geographical, economic, social functional and other features in their interdependency. Functional structure of a city depends on its size and position it takes in the functional distribution on a regional level as well as it is related to the functional capacity of a city. This paper analyses concrete examples of spatial and functional structures featuring three Serbian towns: Valjevo, Bor and Knjaževac. From the analysis of their common attributes in this respect, the following can be noticed: formation of the case study towns happened around inherited historical city cores, which even now perform a number of public functions; basic road networks significantly influenced formation of spatial patterns of these towns; spatial development of the towns in the last decade or so was slowed down because of economic and social stagnation, which didn't show major influence on change of spatial and functional structures of the towns involved.

  11. Studying the processes of sodium-water interaction in the BOR-60 reactor micromodule steam generator

    International Nuclear Information System (INIS)

    Tsykanov, V.A.; Antipin, G.K.; Borisov, V.V.


    Main results of experimental studies of emergency regimes of micromodule steam generator (MSG) at small and big leaks of water into sodium, realized using the 30 MW MSG, operating in the BOR-o0 reactor, are considered. The aims of the study are as follows: the modelling of macroleak in ''Nadja'' steam generator for the BN-350 reactor; testing the conceptions of alarm signalling and MSG protection; testing under real conditions of new perspective systems of leak detection; gaining the experimence and development of the ways to eliminate the consequences of accident caused by big water leak into sodium; accumulation of knowledge on restoration of MSG operating ability after accident; experimental test of calculational techniques for big leak accidents to use them in future for calculational studies of similar situations at other reactors equipped with sodium-water steam generators; refinement of characteristics of hydrodynamic and thermal effects interaction zone for big leak in real circuit during the plant operation. A series of experiments with the imitation of water leak into sodium by means of argon and steam supply through injection devices, located before the steam superheater module of one of the sections and between evaporator module of the same section, is conducted. The range of steam flow rate is 0.02-0.45 g/s. Duration of steam supply is 100-400 s. A conclusion is made that the results obtained can be used for steam generator of the BN-350 reactor [ru

  12. New approach to the reclamation of the old flotation tailings in Bor

    Directory of Open Access Journals (Sweden)

    Dožić Stevan


    Full Text Available The old flotation tailings of the Bor copper mine have not been reclaimed for several decades, although it is a serious threat to the environment, especially to some parts of the town. To date, there have been no efficacious attempts of solving the problem by indirect rehabilitation, only several cases of direct reclamation. This paper presents some results of the experiment established on a part of the tailings in the vicinity of the town, where various variants of meliorated and sterile substrates were applied in the biological reclamation with several tree and grass species. The analysis shows that, in the rehabilitation of sterile substrate of the copper mine, it is possible to grow several woody species. The best results were achieved by the species that were planted in the fertile soil layer on the sterile copper mine substrate, and on the mixture of soil and waste. Among the woody species, Robinia pseudoaccacia, Fraxinus excelsior and Acer pseudoplatanus showed the best survival percent, growth, and physiological vitality and the poorest were spruce and common oak.

  13. Bioleaching of copper from old flotation tailings samples (Copper Mine Bor, Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Srđan


    Full Text Available Bioleaching of samples taken from depths of 10, 15, and 20 meters from old flotation tailings of the Copper Mine Bor was conducted in shaken flasks using extremely acidic water of Lake Robuleas lixiviant. Yield of copper after five weeks of the bioleaching experiment was 68.34±1.21% for 15 m sample, 72.57±0.57% for 20 m sample and 97.78±5.50% for 10 m sample. The obtained results were compared to the results of acid leaching of the same samples and it was concluded that bioleaching was generally more efficient for the treatment of samples taken from depths of 10 m and 20 m. The content of pyrite in the 20 m sample, which contained the highest amount of this mineral, was reduced after bioleaching. Benefits of this approach are: recovery of substantial amounts of copper, reducing the environmental impact of flotation tailings and the application of abundant and free water from the Robule acidic lake as lixiviant. Results of the experiment showed that bioleaching can be more efficient than acid leaching for copper extraction from flotation tailings with higher sulfide contents. [Projekat Ministarstva nauke Republike Srbije, br. 176016 i br. 173048

  14. The Novo Okno copper deposit of olistostrome origin (Bor, Eastern Serbia

    Directory of Open Access Journals (Sweden)

    Antonijević Ivan


    Full Text Available The copper deposit Novo Okno, uncovered at present, with non-ore and ore clasts of massive sulphides (from 0.5 to 50 m3 in size, has many distinctive features that indicate its olistostrome origin. The deposit is chaotic in structure, unstratified, with the lower surface unconformable over the underlying parent rock of the basin. It is a lens-like body, with the longer axis directed east and west, variable in thickness from 15 to 28 metres, about 335 metres long and less than 140 metres wide. These and other characteristics of the body indicate a unified, reworked, olistostrome copper deposit formed from primary ore bodies of the Bor mineral deposit and vulcanite, destroyed by volcanic explosion into blocks and rocks of Turonian age and extrusion and concurrent deposition on the land surface. Gravitational massive sliding of the consolidated rocks down the slopes of the volcanic relief and chaotic accumulation of ore and non-ore clasts (olistoliths in a marine basin evolved in the Upper Turonian and the Lower Senonian.

  15. Den moderne tyske roman 1909-35

    DEFF Research Database (Denmark)

    Ved siden af klassikken og romantikken er den tidlige modernisme vel nok den betydeligste periode i tysksproget litteratur. Det skyldes ikke mindst den perlerække af romaner, der udkom i første tredjedel af det 20. århundrede, og hvoraf mange i dag fremstår som indiskutable højdepunkter i såvel...... tysk som europæisk roman- og litteraturhistorie. I Den moderne tyske roman 1909-35 behandles en række af disse romaner for første gang samlet på dansk. Bogen består af otte romanfortolkninger samt en indledende artikel om den moderne romans historie og særpræg. Alle artikler er skrevet med et solidt...... interesserede læser. I overensstemmelse med dens formidlende sigte er der kun medtaget fortolkninger af romaner, der foreligger på dansk i en tidssvarende oversættelse. Af hensyn til den litteraturhistoriske bredde er der desuden kun medtaget én roman af samme forfatter.Bogen indeholder analyser af: Robert...

  16. 'n Brief van strooi?: Die Evangelie in Jakobus

    Directory of Open Access Journals (Sweden)

    P. P. A. Kotz�


    Full Text Available Jakobus is 'n juweel. Dit is so jammer dat Luther die brief 'n slegte naam gegee het deur dit "eyn rechte stroern Epistel..." te noem, omdat dit, volgens hom, geen evangeliese inslag het nie ("den sie doch keyn Euangelisch art an yhr hat. So is dit as't ware 'ge�tiketteer' en die naam het bly kleef. Die meeste ondersoeke van die brief begin met die vermelding van Luther se uitspraak en probeer vanaf hierdie punt om die vaandel vir die brief te swaai, hetsy op Protestantse hetsy op Rooms - Katolieke wyse.

  17. Transnational organisatorisk innovation i den offentlige sektor

    DEFF Research Database (Denmark)

    Hansen, Morten Balle


    Artiklen undersøger tre problemstillinger: 1) Hvor udbredt er forskellige former for transnational organisatorisk innovation i den danske offentlige sektor? 2) Hvordan er disse organisatoriske innovationer relateret til hinanden? 3) Er forskelle i deres udbredelse relateret til forskelle mellem den...... forskelle og ligheder mellem statslige og kommunale organisationer. 11 former for organisatorisk innovation, hvoraf mange ofte forbindes med New Public Management (NPM), er inkluderet i de empiriske analyser: privatisering/udlicitering, Bestiller-Udfører-model, kontraktstyring, mål- og rammestyring...... innovationer. Forskellige fortolkninger af den større udbredelse i kommuner end i stat drøftes....

  18. Het planetarium van Hartog van Laun

    Directory of Open Access Journals (Sweden)

    Hans Hooijmaaijers


    Full Text Available The instrument maker Hartog van Laun devised a special table for an orrery, a lunarium and a tellurium. Van Laun made these instruments for educational purposes, but what makes his planetariums so interesting is the great variety and accuracy of demonstrations one can perform with them. In this paper I will deal with Van Laun and his instrument makers business. I will outline the design of the planetarium and some of the firm’s other instruments. Furthermore I will demonstrate that the detailed description of the planetarium made by Professor Jan Hendrik van Swinden boosted the spread of the instrument.

  19. D r . A. van Selms, De verscheurde stad. Oud Jeruzalem waar de ...

    African Journals Online (AJOL)


    Oud Jeruzalem waar de Joden niet kunnen komen. Uitg. J. N. Voorhoeve, Den Haag, s.j. 144 bis. Prys f 7.90. Bevoorreg is die mens wat met so 'n universele kennis van wat hy gaan besoek en sien en dit so paraat tot sy beskikking as wat by Prof. van. Selms die geval is, Bybellande en gewyde plekke gaan besoek en daar.

  20. B. J. van der Merwe . Pentateugtradisies in die prediking van ...

    African Journals Online (AJOL)

    B. J. van der Merwe . Pentateugtradisies in die prediking van Deuterojesaja. Proefschrift ter verkrijging van de graad van Doctor in de Godgeleerdheid aan de Rijkuniversiteit te Groningen. Uitg. J. B. Wolters, Groningen, Djakarta. 1955. 280 bls.

  1. Environmental impact of mining activity in Bor area as indicated by the distribution of heavy metals and bacterial population dynamics in sediment

    Directory of Open Access Journals (Sweden)

    Filimon M. N.


    Full Text Available The environmental impact of inorganic pollution is pronounced in water adjacent to Bor Copper Smelter Complex (RTB Bor, Serbia, with Cu, Zn, Pb, and As being the main determinants of aquatic pollution pattern. Communities of microorganisms present in the sediments are mainly affected by heavy metal pollution. Some groups of bacteria can be considered pollution bio-indicators, due to their sensibility and ability to bioaccumulate heavy metals, thus contributing to reducing pollution. This study investigates the relationships between trace element accumulation and heterogeneity in sediment bacteria community structure found in water streams adjacent to the Bor Copper Smelter Complex (RTB Bor, Serbia. Our results showed no contamination with copper, zinc, nickel, iron, and chromium, but did show a low to moderate contamination with lead and a moderate to high contamination with arsenic in aquatic sediments within the area of interest. Spatial heterogeneity in sediment-associated bacterial communities did not relate significantly to location of sampling sites, except for iron reducing bacteria. Iron reducing bacteria and nitrifying bacteria were the best distinguishing groups of bacteria. However, only iron reducing bacteria were significantly influenced by sampling locations. The iron reducing bacteria has correlated negatively with the degree of sediment contamination with lead, and therefore, we suggest that this group of bacteria could serve as potential bio-indicators of inorganic water contamination in Bor RTB area.

  2. De fysica van polymere materialen

    NARCIS (Netherlands)

    Struik, L.C.E.


    Rede, uitgesproken ter gelegenheid van de aanvaarding van het ambt van buitengewoon hoogleraar in de fysica van polymere materialen aan de Universitelt Twente op donderdag 22 januarì 1987 door L.C.E. Struik.

  3. Mogelijkheden tot productie van beertjes

    NARCIS (Netherlands)

    Scholten, R.; Huiskes, J.


    In opdracht van het Produktschap Vee en Vlees is het project Mogelijkheden tot productie van vleesbeertjes en afzet van vlees en vleesproducten hiervan uitgevoerd. De afzetmogelijkheden voor vlees van beertjes zijn en blijven vooralsnog minimaal

  4. The Evaluation of Alkali Grass (Puccinellia ciliata Bor Populations in Aydin Province of Turkey

    Directory of Open Access Journals (Sweden)

    İlkay Yavaş


    Full Text Available Alkali grass grows in waterlogged, saline and alaline soils. The main problem in these soils is minerals at toxic level. The toxic ions are chloride, sodium and boron. A number of techniques have been investigated for removing toxic metals from the soil. Today, the cost-effective and environmentally technique is phytoremediation, using hyperaccumulator plants. Alkali grass (Puccinellia ciliata Bor is suggested as a hyperaccumulator plant by the combination of more favourable characteristics with salt and waterlogging tolerance, high biomass value and convincing nutritive value for adverse environmental conditions. For this reason, we collected alkali grass and soil samples from five different locations in Aydın-Muğla highway, Turanlar and Sınırteke villages in Germencik-Aydın. In the soil analysis, we observed that K accumulation varies between root, shoot and panicle at least whereas Na and B shows more variation on whole plant portions among locations. Intense aerenchyma development on the root tips of Puccinellia plant was observed and it is determined as radial lysogenic aerenchyma formation. Average plant height and dry matter values were between 47.2-74.4 cm and 15.61-80.85 g/plant according to locations. The highest plant height value was obtained from the first location whereas the highest dry matter yield was detected in the fifth location. In conclusion, plants from fifth location can be regarded as fodder plants in these areas. Our results indicated that alkali grass can be effective for phytoextraction of sodium and boron from contaminated sites.

  5. Van verenigingsondersteuning naar verenigingsontwikkeling

    NARCIS (Netherlands)

    Slender, Hans; Meijburg, Heleen; Boven, Magda; Dijk, Bake; de Jong, Johan


    Sportverenigingen staan momenteel voor grote uitdagingen zoals bijvoorbeeld vermeend consumentgedrag van leden (Van der Roest, 2015), steeds meer eisen vanuit de overheid om bij te dragen aan maatschappelijke vraagstukken (Waardenburg, 2016) en teruglopende ledenaantal in krimpregio’s. Enkele

  6. Teelt van hybride wintertarwerassen

    NARCIS (Netherlands)

    Timmer, R.D.; Paauw, J.G.M.


    Om de mogelijkheden van de teelt van hybride wintertarwerassen onder Nederlandse omstandigheden in beeld te brengen zijn er van 2000-2002 proeven uitgevoerd op het PPO-proefbedrijf te Lelystad. In deze proeven zijn een 4-tal hybriderassen (Hybnos, Hyno-braba, Hyno-esta, Mercury) vergeleken met een

  7. Het presteren van FM

    NARCIS (Netherlands)

    van der Voordt, D.J.M.


    Prestatieafspraken. Prestatiespecificaties. Prestatiecontracten. Het woord prestatie duikt steeds vaker op in de wereld van FM. Maar wat bedoelen we er nu precies mee? En kunnen we de prestaties van FM wel op een betrouwbare en valide manier meten? Een beschouwing vanuit de wereld van een

  8. Handelsstromen van pluimveevlees

    NARCIS (Netherlands)

    Tacken, G.M.L.; Horne, van P.L.M.


    Dit onderzoek geeft inzicht in de goederenstromen van (rauw) pluimveevlees binnen envooral naar Nederland en de daarmee gepaard gaande zoönoserisico's. Het onderzoek biedtinput voor het nog op te zetten controlebeleid, waarmee handhaving van het beleidsvoornemenom het aanbieden van rauw

  9. De Smartcard van 2010

    NARCIS (Netherlands)

    Hartel, Pieter H.; Jacobs, Bart


    Aan de universiteiten van Twente en Nijmegen zijn twee onderzoeksgroepen onder leiding van de auteurs intensief bezig met smartcards. Beide auteurs zijn eerder dit jaar betrokken geweest bij het opstellen van de nieuwe Europese onderzoeksagenda voor smartcards, binnen het zogenaamde zesde kader

  10. Benaderingen van over

    NARCIS (Netherlands)

    Boer, M.G. de


    SAMENVATTING In dit hoofdstuk wordt de relatie tussen de betekenissen van het Nederlandse voorzetsel over en een aantal corpora bestudeerd. Het hoofdstuk begint met een analyse van de voorbeelden uit Uit het leven van Dik Trom (1891); daarna wordt de woordenboekinformatie behandeld en vergeleken

  11. van der Waals

    Indian Academy of Sciences (India)

    University education was beyond reach for van der Waals as he had to work for earning his daily bread ... languages, which was a prerequisite for entering a University those days. van der Waals worked as a school ... take academic examinations at the University yet, van der Waals continued studying at Leiden. University ...

  12. De keuze van Vincent

    NARCIS (Netherlands)

    Stolwijk, Chris


    Official publication to accompany the important exhibition Vincent's Choice, Van Gogh's 'musee imaginaire' at the Van Gogh Museum, Amsterdam marking the 150th anniversary of the artist's birth.Thanks to van Gogh's correspondence, it has been possible to identify the works he knew and admired. The

  13. IWGFR benchmark test on signal processing for boiling noise detection, stage 2: Analysis of data from BOR-60

    International Nuclear Information System (INIS)

    Rowley, R.; Waites, C.; Macleod, I.D.


    Data from boiling experiments in the BOR 60 reactor in USSR has been supplied by IAEA to enable analysis techniques to be compared. The signals have been analysed at RNL using two basic techniques, High Frequency RMS analysis and Pulse Counting analysis and two more sophisticated methods, Pattern Recognition and Pulse Timing Analysis. All methods indicated boiling successfully, pulse counting proved more sensitive than RMS for the detection of the onset of boiling. Pattern Recognition shows promise of a very reliable detector provided the background can be defined. Data from an Ionisation chamber was also supplied and there was good correlation between the neutronic and acoustic signals. (author). 25 figs, 4 tabs

  14. Neutron irradiation of V-Cr-Ti alloys in the BOR-60 fast reactor: Description of the fusion-1 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Rowcliffe, A.F. [Oak Ridge National Laboratory, TN (United States); Tsai, H.C.; Smith, D.L. [Argonne National Lab., IL (United States)] [and others


    The FUSION-1 irradiation capsule was inserted in Row 5 of the BOR-60 fast reactor in June 1995. The capsule contains a collaborative RF/U.S. experiment to investigate the irradiation performance of V-Cr-Ti alloys in the temperature range 310 to 350{degrees}C. This report describes the capsule layout, specimen fabrication history, and the detailed test matrix for the U.S. specimens. A description of the operating history and neutronics will be presented in the next semiannual report.

  15. IAEA/IWGFR benchmark tests on sodium boiling noise detection. Part 2: Decision making and BOR-60 data

    International Nuclear Information System (INIS)

    Brown, C.J.; Hughes, G.; Overton, R.S.; Wey, B.O.


    The present paper deals with the second stage of investigations of acoustic signals from a boiling experiment performed on the KNS I loop at KfK Karlsruhe and first results of analysis of data from a series of boiling experiments carried out in the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is briefly described. (author). 5 refs, 23 figs

  16. Versterking van de loopbaanladder van leraren : wat kunnen we leren van Singapore?

    NARCIS (Netherlands)

    Elffers, L.


    In de Lerarenagenda 2013-2020 is een aantal doelstellingen geformuleerd ten aanzien van de bevordering van de loopbaan en professionele ontwikkeling van leraren. Enerzijds wordt ingezet op het stimuleren van professionalisering van leraren na hun initiële opleiding, anderzijds op het versterken van

  17. Multi-criteria Analysis of Air Pollution with SO(2) and PM(10) in Urban Area Around the Copper Smelter in Bor, Serbia. (United States)

    Nikolić, Djordje; Milošević, Novica; Mihajlović, Ivan; Zivković, Zivan; Tasić, Viša; Kovačević, Renata; Petrović, Nevenka


    This work presents the results of 4 years long monitoring of concentrations of SO(2) gas and PM(10) in the urban area around the copper smelter in Bor. The contents of heavy metals Pb, Cd, Cu, Ni, and As in PM(10) were determined and obtained values were compared to the limit values provided in EU Directives. Manifold excess concentrations of all the components in the atmosphere of the urban area of the townsite Bor were registered. Through application of a multi-criteria analysis by using PROMETHEE/GAIA method, the zones were ranked according to the level of pollution.

  18. Karakterisering van het "Etimologiewoordeboek van Afrikaans" (EWA)

    African Journals Online (AJOL)

    Als etymologisch woordenboek bezit EWA een aantal bijzondere, eigen kenmerken. De selectie van de woorden is bepaald door het beoogde gebruikerspubliek. Als gevolg daarvan bevat EWA verscheidene typen woorden die in traditionele etymologische woordenboeken doorgaans veronachtzaamd worden, zoals ...

  19. Polar bear maternity denning in the Beaufort Sea (United States)

    Amstrup, Steven C.; Gardner, Craig L.


    The distribution of polar bears (Ursus maritimus) is circumpolar in the NOrthern Hemisphere, but known locations of maternal dens are concentrated in relatively few, widely scattered locations. Denning is either uncommon or unknown within gaps. To understand effects of industrial development and propose increases in hunting, the temporal and spatial distribution of denning in the Beaufort Sea must be known. We caputred and radiocollared polar bears between 1981 and 1991 and determined tht denning in the Beaufort Sea region was sufficient to account for the estimated population there. Of 90 dend, 48 were on drifting pack ice, 38 on land, and 4 on land-fast ice. The portions of dens on land was higher (P= 0.029) in later compared with earlier years of the study. Bears denning on pack ice drifting as far as 997 km (x=385km) while in dens. there was no difference in cun production by bears denning on land and pack ice (P =0.66). Mean entry and exit dates were 11 November and 5 April for land dens and 22 November and 26 March for pack-ice dens. Female polar bears captured in the Beaufort Sea appeared to be isolated from those caught eat of Cape Bathurst in Canada. Of 35 polar bears that denned along the mainland coast of Alaska and Canada 80% denned between 137 00'W snf 146 59'W. Bears followed to >1 den did not reuse sites and consecutive dens were 20-1,304 km apart. However radio-collared bears are largely faithful to substrate (pack-ice, land, and land-fast ice) and the general geographic area of previous dens. Bears denning on land may be vunerable to human activities such as hunting and industrial development. However, predictable denning chronology and alck of site fidelity indicate that many potential impacts on denning polar bears could be mitigated.

  20. Leadership pipeline i den offentlige sektor

    DEFF Research Database (Denmark)

    Dahl, Kristian Aagaard; Molly-Søholm, Thorkil

    en rejse ind i hjertet af offentlig ledelse med fokus på lederniveauerne: topchef, funktionel chef, leder af ledere og leder af medarbejdere. Med afsæt i righoldige eksempler og fortællinger fra virkeligheden introduceres læseren for ledelsesteorien den Offentlige Leadership Pipeline, som giver...... enkelte lederniveauer og udvikle ledertalenter. Teorien byder på et detaljeret ledelsesgrundlag, hvorudfra den offentlige organisation kan bygge en professionel værdikæde for ledelse ved at forme lederprofiler, -rekruttering, -uddannelse, -evaluering m.m. Leadership Pipeline i den offentlige sektor er...... baseret på et treårigt dansk praksisorienteret forskningsprojekt med deltagelse af 15 offentlige organisationer, som repræsenterer kommunerne, regionerne og staten. Projektet har videreudviklet en af de sidste 10 års mest indflydelsesrige ledelseteorier i de største private organisationer, Leadership...

  1. Den kontraktstyrede og kontraktstyrende offentlige sektor

    DEFF Research Database (Denmark)

    Schulze, Christiane; Greve, Carsten

    Kontraktbaseret styring har været på den politiske agenda i OECD landene siden de tidlige 1980’erne og i dag er kontrakter et helt centralt element i den moderne regering ((Ejersbo & Greve 2005: 62, Greve 2008a: 4). Internationalt var det især med Reagon-regeringen i USA og Thatcher-regeringen i...... den private sektor og [som] brug af markedsmekanismer”(Greve 2003). Ved siden af privatisering og deregulering iagttages kontrakter som et determinerende element i NPM (Fortin 2000:1). Kontrakter kan helt grundlæggende defineres som en aftale mellem bestiller og leverandør, der angiver vilkårene...

  2. Verslag van de voorstudie: Paddenstoelen bedrijf van de toekomst

    NARCIS (Netherlands)

    Tuijl, van B.A.J.; Bos, A.P.; Sonnenberg, A.S.M.


    Het rapport ‘Paddenstoelenbedrijf van de toekomst’ is het resultaat van een uitgebreid vooronderzoek en geeft de eerste aanzet tot het creëren van gemeenschappelijke visie van de sector op een betere toekomst voor paddenstoelenkwekerijen. Het rapport doet verslag van een reeks interviews en een

  3. Onderzoek naar vermindering van de bijvangst van een boomkortuig

    NARCIS (Netherlands)

    Marlen, van B.; Ybema, M.S.; Duijn, van J.B.


    In het kader van EU-project RECOVERY werden vergelijkende visserij- en selectiviteitsproeven uitgevoerd in 2002 en 2003 aan boord van MS “Tridens” aan 12 m boomkortuigen. De resultaten van een negental vistuigproeven zijn hier gegeven, gericht op het bepalen van het effect van een grote mazen kap

  4. Verdeling van oxytetraxycline (afkomstig van versleping) in diervoeders

    NARCIS (Netherlands)

    Stolker, A.A.M.; Zuidema, T.; Egmond, van H.J.; Jong, de J.; Haelermans, P.J.M.; Hooglugt, J.H.


    De laatste jaren is er een toenemende aandacht voor de mogelijke bijdrage van therapeutisch gebruik van antibiotica in de dierhouderij op de ontwikkeling van antimicrobiële resistentie. Een additionele bron van blootstelling van landbouwhuisdieren aan antibiotica is versleping via diervoeders. In

  5. Selectie van Italiaanse werkwoordsvormen op basis van frequentieonderzoek

    NARCIS (Netherlands)

    Boer, M.G. de


    SAMENVATTING Dit artikel is een vroege recensie (mei 1972) van het LIF, de frequentielijst van IBM Italia uit 1971. De auteur concentreert zich op de verschillen met het project van Juilland, dat als uitgangspunt voor het LIF heeft gefungeerd. Op grond van de gegevens van het LIF is een basislijst

  6. n Oorsig van die huidige stand van navorsing oor die

    African Journals Online (AJOL)


    7 Jun 2011 ... Die eerste maal wat dit as deel van die teks van 1 Johannes aangehaal word, is in die. 4de eeu in 'n Latynse teks, Liber Apologeticus (hf 4). Eers aan die einde van die 16de eeu is dit in 'n amptelike Katolieke uitgawe van die Vulgaat ingesluit. Die doel van die Johannesbriewe. Waarom is die Briewe ...

  7. Biologische effectiviteit van bespuitingen: effecten van druppelgrootte en waterkwaliteit

    NARCIS (Netherlands)

    Zande, van de J.C.; Schans, van der D.A.; Koster, A.T.J.


    Deze rapportage beschrijft de invloed van watervolume, druppelgrootte en kwaliteit van het tankmengsel op de biologische effectiviteit van bespuitingen. Onder kwaliteit van het tankmengsel wordt in dit verband verstaan: temperatuur, hardheid, pH en zoutgehalte (chloor en ijzerzouten) van de

  8. Den empiriske uddannelsesvidenskab og kvalitet i studieaktivitet

    DEFF Research Database (Denmark)

    Keiding, Tina Bering; Qvortrup, Ane


    Bidraget kobler studieaktivitetesmodellen med kvalitetsindikatorer for god undervisning, og viler blandt andet, hvorledes modellen kan støtte samtænkning af forskellige undervisnings- og læringsformater med henblik på øge den aktive læretid......Bidraget kobler studieaktivitetesmodellen med kvalitetsindikatorer for god undervisning, og viler blandt andet, hvorledes modellen kan støtte samtænkning af forskellige undervisnings- og læringsformater med henblik på øge den aktive læretid...

  9. Dragons' Den: promoting healthcare research and innovation. (United States)

    Mazhindu, Deborah; Gregory, Siobhan


    The changing health and social care landscape, and, in particular, the financial challenges affecting the NHS, can present difficulties for staff looking for funding to support innovation and new ways of working. One method of competitive tendering that is becoming more accepted as a way of allocating funds, encouraging staff engagement and developing innovation for research is a format based the BBC television series, Dragons' Den. This article describes how Hounslow and Richmond Community Healthcare NHS Trust, London, has developed a 'Dragons' Den initiative' of annual competitive research funding allocation to ensure that some of the most dynamic practice in the trust is captured.

  10. Das Bild behinderter Menschen in den Medien


    Radtke, Peter


    „Das Bild von Behinderung und behinderten Menschen in den Medien“ - dieses Thema führt sehr leicht zur Schwarz-Weiß-Malerei. Bekanntlich fällt es schwer, es allen recht zu machen. So nimmt es nicht Wunder, dass sich Betroffene und ihre Angehörigen in den Medien sowohl quantitativ als auch qualitativ oftmals nicht angemessen repräsentiert fühlen. [...] In dieser Situation bilden die Medien die wichtigste und oft einzige Informationsquelle über das Leben und die Möglichkeiten von Menschen mit e...

  11. Bijdrage tot de kennis van den groei van Pseudotsuga taxifolia Britton in Nederland in verband met zijn beteekenis voor den Nederlandschen boschbouw

    NARCIS (Netherlands)

    Hoogh, de J.


    Development of the green Douglas fir in the Netherlands in different places with different methods of planting was studied by enquiry, personal research and from the literature. The climate and soil types seemed suitable. Game, insects and fungi caused little damage. The stands studied all derived

  12. 09 Van Coller 03.pmd

    African Journals Online (AJOL)


    29 Jul 2010 ... strangeness, awakening in it a drama whose actors are all those assumptions and operations which make the text the work of another period”. Die spore van Raka: Oor herskrywing en kanonisering. (Deel 2). H.P. van Coller en A. van Jaarsveld. H. P. van Coller is hoof van die Departement. Afrikaans ...

  13. De auteursrechtelijke groeipijnen van Google

    NARCIS (Netherlands)

    Hugenholtz, P.B.


    Het succesverhaal van Google behoort tot de canon van de geschiedenis van onze informatiemaatschappij. In 1998 begonnen in een studentenkamer op de campus van Stanford University, groeide Google in enkele jaren uit tot het orakel van het internet. Zo werd ‘googelen’ de gebruikelijke term voor zoeken

  14. Invoering van algemene vaardigheden: mogelijkheden van een vakoverstijgende aanpak

    NARCIS (Netherlands)

    Leenders, F.J.


    Centrale vraag: Het onderzoek richtte zich op de implementatie van vakoverstijgend vaardighedenonderwijs in de Tweede Fase van het voortgezet onderwijs. Belangrijkste conclusies: De brochure bevat onder meer een beschrijving van vijf scholen waar op verschillende wijze vaardighedenonderwijs

  15. Den udødelige gangster

    DEFF Research Database (Denmark)

    Bjerre, Thomas Ærvold


    Hollywood har igennem et århundrede hyldet de voldspsykopater, som de fleste gangstere nu engang er. Michael Manns Public Enemies er seneste skud på stammen i den lange række af amerikanske gangsterfilm, der tog sin begyndelse i starten af 1930'erne, og som meget hurtig blev til en mytisk...

  16. Den skrøbelige sandhed

    DEFF Research Database (Denmark)

    Pedersen, Peter Ole


    Artiklen retter fokus mod de seneste års udvikling af den aktivistiske dokumentarfilm. Med analytiske punktnedslag hos instruktørerne Michael Moore, Morgan Spurlock, Dylan Avery, Robert Greenwald og Mauro Andrizzi undersøges de forbindelser der eksisterer mellem udtrykket i de populære spillefilm...

  17. Digital kommunikation med den offentlige sektor

    DEFF Research Database (Denmark)

    Berger, Jesper Bull; Andersen, Kim Normann

    , som enten via spørgeskema, e-mail eller telefon har givet os et enestående indblik i deres håndtering af den digitale kommunikation. Publikationen er et såkaldt workingpaper, hvor vi mere end gerne modtager forslag og kommentarer til forbedringer. Der er i publikationen en række aktive links til...

  18. Nyliberalisme, universiteter og den akademiske frihed

    DEFF Research Database (Denmark)

    Madsen, Mogens Ove


    Den akademiske frihed er forbundet med absolut frihed til at frembringe og videreformidle viden. Denne ide med universitetet er blevet udfordret ganske kraftigt i de senere år, ikke kun i Danmark. Stærke rådgivningsinstitutioner som OECD og EU har i en del år anbefalet, at universiteternes opgave...

  19. Tre teorier om den moralske udvikling

    DEFF Research Database (Denmark)

    Bo, Inger Glavind; Andreasen, Brian Kjær

    I artiklen gennemgås tre forskellige men teorihistorisk relaterede perspektiver på forståelsen af moralsk udvikling: Piaget, Kohlberg og Gilligan. I den efterfølgende diskussion af disse teoretikeres respektive positioner påpeges såvel forskelle som ligheder i deres betoning af moralens karakter...

  20. Karakterisering van het Etimologiewoordeboek van Afrikaans (EWA

    Directory of Open Access Journals (Sweden)

    Fons Moerdijk


    Full Text Available

    Samenvatting: Zesendertig jaar na Afrikaanse etimologieë van Boshoff en Nienaber verscheener in 2003 een nieuw etymologisch woordenboek van het Afrikaans: het Etimologiewoordeboek vanAfrikaans (EWA. Tussen die twee woordenboeken bestaat een wezenlijk verschil. Het werk vanBoshoff en Nienaber is vrijwel alleen toegankelijk voor specialisten en niet specifiek bedoeld vooreen breed publiek. EWA is juist allereerst bestemd voor de leek die zich interesseert voor de oorsprongen de geschiedenis van de eigen taal. Daarnaast biedt het ook de etymoloog en historischtaalkundige een hoop gegevens en inspiratie voor nader onderzoek. Als etymologisch woordenboekbezit EWA een aantal bijzondere, eigen kenmerken. De selectie van de woorden is bepaalddoor het beoogde gebruikerspubliek. Als gevolg daarvan bevat EWA verscheidene typen woordendie in traditionele etymologische woordenboeken doorgaans veronachtzaamd worden, zoals afleidingen,samenstellingen, neologismen en gemeenzame spreektaalwoorden. De artikelstructuurwordt gekenmerkt door een hoge graad van uniformiteit en consistentie. Het accent ligt op dezogenaamde etymologia proxima, de etymologie waarbij men één stap teruggaat en de meestdirecte herkomst van het woord biedt. Voorts is speciale aandacht besteed aan polysemie: nietalleen de herkomst van de dominante betekenis van een woord wordt gegeven, maar ook die vanzijn eventuele andere betekenis(sen. Benoemingsmotieven komen ook veelvuldig aan bod. In eeneventuele tweede druk zouden opvallende verschillen in vorm of betekenis altijd verklaard of inieder geval besproken moeten worden. Dat blijft nu nogal eens achterwege. Ook zou voorafgaandaan zo'n volgende editie meer onderzoek naar woordhistorisch materiaal uit primaire bronnenvoor met name de 17de–19de eeuw verricht moeten worden. Het zou mooi zijn als deze eersteuitgave van EWA de aanleiding tot een dergelijk onderzoek zou vormen.


  1. Christian Birch - den korrupte konferensråd

    DEFF Research Database (Denmark)

    Jensen, Mette Frisk


  2. Die Romeinse nastrewing van onsterflikheid deur middel van memoria

    Directory of Open Access Journals (Sweden)

    D. R. Fouché


    Full Text Available Benewens die omvangryke en nasionale manifestasies van die oorspronklike onsterflikheidsgedagte in die Romeinse gemeenskap, vind ons by die Romein op kleiner skaal in groepe of indiwidueel ’n strewe na onsterflikheid langs die weg van memoria. Soos aangetoon sal word, verskil die pogings van die verskillende groepe radikaal van mekaar, hoewel die strewe en einddoel dieselfde bly, naamlik om deur die daarstelling van memoria op die gebied van woord of daad onsterflikheid te bekom.

  3. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells [v1; ref status: indexed,

    Directory of Open Access Journals (Sweden)

    Noboru Yamauchi


    Full Text Available In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM. This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  4. Duurzame inzetbaarheid van ouderen: resultaten van de eerste twee metingen van STREAM

    NARCIS (Netherlands)

    Heuvel, S. van den; Ybema, J.F; Leijten, F.; Wind, A. de


    In deze notitie richten we ons op voorspellers van duurzame inzetbaarheid, waarbij we gebruik maken van de resultaten van de eerste twee metingen van STREAM en van een interviewstudie bij deelnemers aan STREAM. Meer specifiek gaan we na hoe personen met gezondheidsproblemen toch productief kunnen

  5. De democratische kwaliteit van gemeenteraadsverkiezingen’

    NARCIS (Netherlands)

    Boogers, Marcel; Reynaert, Herwig


    Gemeenteraadsverkiezingen horen ertoe bij te dragen dat het lokale beleid overeenkomt met de beleidsvoorkeuren van inwoners. Dat is immers de democratische functie van verkiezingen. De gedachte hierachter is dat als kiezers zich uitspreken over de beleidsprestaties en verkiezingsbeloften van

  6. Premolarized double dens in dente in albinism - A case report

    Directory of Open Access Journals (Sweden)

    Suprabha B


    Full Text Available Dens in dente are known to be associated with many dental abnormalities such as taurodontism microdontia, gemination, and dens evaginatus. This paper describes a rare case of double dens in dente in a lateral incisor with crown morphology similar to a premolar present in a patient with features of albinism. Problems associated with this condition and their management is discussed.

  7. Ueber die arten und den Skelettbau von Culcita

    NARCIS (Netherlands)

    Hartlaub, Clemens


    Das Genus Culcita Agass. zählt durch die merkwürdige Form und die ansehnliche Grösse seiner Arten zu den interessantesten Asteriden, und gut conservirte Exemplare davon gehören zu den Zierden unsrer Museen. Um so bedauerlicher erschien es mir, als ich vor einiger Zeit den Versuch machte die von

  8. Human disturbances of denning polar bears in Alaska

    International Nuclear Information System (INIS)

    Amstrup, S.C.


    Polar bears (Ursus maritimus) give birth in dens of snow and ice. The altricial neonates cannot leave the den for >2 months post-partum and are potentially vulnerable to disturbances near dens. The coastal plain (1002) area of Alaska's Arctic National Wildlife Refuge (ANWR) lies in a region of known polar bear denning and also may contain >9 billion barrels of recoverable oil. Polar bears in dens could be affected in many ways by hydrocarbon development. The distribution of dens on ANWR was documented between 1981 and 1992 and responses of bears in dens to various anthropogenic disturbances were observed. Of 44 dens located by radiotelemetry on the mainland coast of Alaska and Canada, 20 (45%) were on ANWR and 15 (34%) were within the 1002 area. Thus, development of ANWR will increase the potential that denning polar bears are disturbed by human activities. However, perturbations resulting from capture, marking, and radiotracking maternal bears did not affect litter sizes or stature of cubs produced. Likewise, 10 of 12 denned polar bears tolerated exposure to exceptional levels of activity. This tolerance and the fact that investment in the denning effort increases through the winter indicated that spatial and temporal restrictions on developments could prevent the potential for many disruptions of denned bears from being realized. 16 refs., 1 fig., 2 tabs

  9. [Von den Restgütern zu den Sowchosen in Estland 1939-1953. Dokumentensammlung] / Olev Liivik

    Index Scriptorium Estoniae

    Liivik, Olev, 1975-


    Arvustus: Von den Restgütern zu den Sowchosen in Estland 1939-1953 : Dokumentensammlung / Hrsg. von David Feest, Karsten Brüggemann. Berlin : Lit Verlag, 2010. (Schriften der Baltischen historischen Kommission ; Bd. 15)

  10. Anatomisch onderzoek naar het ontstaan en de opbouw van bastknobbels in straatbomen: Het onderzoek is uitgevoerd bij Fraxinus excelsior 'Atlas' en 'Westhofs Glorie', Gelditsia triacanthos 'Inermis' en Acer saccharinum 'Pyramidale'

    NARCIS (Netherlands)

    Kuik, van A.J.; Lammeren, van A.A.M.


    In opdracht van de gemeente Alphen aan den Rijn is een onderzoek opgezet naar de ontwikkeling en opbouw van bastknobbels in een aantal boomsoorten. Deze bastknobbels zijn de laatste jaren in aantal sterk toegenomen en komen op verschillende boomsoorten voor, zowel dicht bij het maaiveld, midden op

  11. Late effecten van kankerbehandeling

    NARCIS (Netherlands)

    Langeveld, Nelia E.


    In dit artikel wordt ingegaan op de lange termijn effecten van kanker op de kinderleeftijd. Vervolgens wordt een kort overzicht gegeven van de belangrijkste late gevolgen die kunnen optreden na een oncologische behandeling met radio- en/of chemotherapie toegepast in de kinderleeftijd. Er wordt kort

  12. Een kwestie van vertrouwen

    NARCIS (Netherlands)

    Bastiaansen, H.J.M.; Wijk, Y.W. van; Wortmann, H.; Bakkers, J.P.


    Generieke Logius-producten en diensten zoals DigiD en Digipoort zijn onderdeel van een ICT-keten waarin veel organisaties samenwerken. Deze diensten moeten continu in de lucht zijn om bijvoorbeeld een uitkering bij UWV te kunnen aanvragen of goederen bij de Douane in te voeren. Als er bij een van de

  13. van der Waals

    Indian Academy of Sciences (India)

    in the world without learning the 'van der Waals equation'. ... theory”. Those days, however, molecules were assumed to be point masses occupying no .... was 36 to obtain his PhD due to the prevailing social conditions. van der Waals died in ...

  14. 'De 'lijmwaarde' van merken

    NARCIS (Netherlands)

    Mossinkoff, Marco


    Marketingwetenschap en -praktijk lijken in een crisis te verkeren: de consument en haar koopgedrag lijken steeds minder voorspelbaar, met alle nadelige gevolgen van dien voor het aanzien van marketing als vakgebied. Bij nadere beschouwing blijkt die onvoorspelbaarheid echter vooral betrekking te

  15. Classificatie van biologische agentia

    NARCIS (Netherlands)

    Klein MR; LIS; cib


    Deze rapportage omvat een inventarisatie van de problematiek rond de classificatie van biologische agentia, die ziekte bij de mens kunnen veroorzaken.

    De constatering is dat de Europese lijst met classificaties verouderd is en geactualiseerd en uitgebreid zou moeten worden. De lijst bevat

  16. De magie van plekken

    NARCIS (Netherlands)

    Hospers, Gerrit J.


    Maakt het in deze tijd eigenlijk nog uit waar we ons bevinden? Sommige experts beweren van niet. Ze bespeuren een death of distance: onder invloed van informatie- en communicatietechnologie zou afstand steeds minder relevant worden. Door mobiele telefonie, internet, Facebook en Skype lijkt het niet


    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. TIEN VAN DO. Articles written in Sadhana. Volume 41 Issue 8 August 2016 pp 817-823. A closed-form solution for a two-server heterogeneous retrial queue with threshold policy · TIEN VAN DO DENES PAPP RAM CHAKKA JINTING WANG JANOS SZTRIK · More Details Abstract Fulltext PDF.

  18. De aantrekkingskracht van gebouwen

    NARCIS (Netherlands)

    Frank van Enckevort; Ronald Beckers


    Hogescholen zijn de laatste jaren flink bezig met de ontwikkeling van gebouwen, met de nodige investeringen. In rap tempo worden er ultramoderne gebouwen neergezet of worden oude gebouwen gerenoveerd. Natuurlijk zijn deze ontwikkelingen in eerste instantie gericht op het nog beter ondersteunen van

  19. Praktijkevaluatie van 'piglet snatching'

    NARCIS (Netherlands)

    Smits, J.M.; Binnendijk, G.P.; Eijck, I.A.J.M.


    Bij piglet snatching worden biggen van een zeug direct bij de geboorte weggevangen en overgelegd naar een zeug op een ander bedrijf. In de praktijk is dit een goede, welzijnsvriendelijke manier om biggen van een bedrijf met een lage ziektevrij-status maar met een hoge genetische waarde over te

  20. Keuzeprocessen van Consumenten

    NARCIS (Netherlands)

    B. Wierenga (Berend)


    textabstractVoor de aanbieder van een voedingsmiddel, of dit nu een merkprodukt a la Mona is of een 'commodity', bijvoorbeeld karnemelk, is het van groot belang te weten welke factoren bepalen of een consument het betreffende produkt zal kiezen dan wel voor een concurrerend alternatief zal opteren.

  1. Kroniek van het mededingingsrecht

    NARCIS (Netherlands)

    Wesseling, R.; Truijens Martinez, J.


    Waar liggen de grenzen van het bereik van het mededingingsrecht? Die vraag komt steeds vaker op. Buiten het mededingingsrecht heeft de Europese Commissie beperkte handhavingsbevoegdheden. Voor de Commissie is een probleem dus al snel een mededingingsrechtelijke kwestie. De Libor-affaire en

  2. Irradiation Microstructure of Austenitic Steels and Cast Steels Irradiated in the BOR-60 Reactor at 320°C (United States)

    Yang, Yong; Chen, Yiren; Huang, Yina; Allen, Todd; Rao, Appajosula

    Reactor internal components are subjected to neutron irradiation in light water reactors, and with the aging of nuclear power plants around the world, irradiation-induced material degradations are of concern for reactor internals. Irradiation-induced defects resulting from displacement damage are critical for understanding degradation in structural materials. In the present work, microstructural changes due to irradiation in austenitic stainless steels and cast steels were characterized using transmission electron microscopy. The specimens were irradiated in the BOR-60 reactor, a fast breeder reactor, up to 40 dpa at 320°C. The dose rate was approximately 9.4x10-7 dpa/s. Void swelling and irradiation defects were analyzed for these specimens. A high density of faulted loops dominated the irradiated-altered microstructures. Along with previous TEM results, a dose dependence of the defect structure was established at 320°C.

  3. A Study of the Optimal Model of the Flotation Kinetics of Copper Slag from Copper Mine BOR (United States)

    Stanojlović, Rodoljub D.; Sokolović, Jovica M.


    In this study the effect of mixtures of copper slag and flotation tailings from copper mine Bor, Serbia on the flotation results of copper recovery and flotation kinetics parameters in a batch flotation cell has been investigated. By simultaneous adding old flotation tailings in the ball mill at the rate of 9%, it is possible to increase copper recovery for about 20%. These results are compared with obtained copper recovery of pure copper slag. The results of batch flotation test were fitted by MatLab software for modeling the first-order flotation kinetics in order to determine kinetics parameters and define an optimal model of the flotation kinetics. Six kinetic models are tested on the batch flotation copper recovery against flotation time. All models showed good correlation, however the modified Kelsall model provided the best fit.

  4. Preliminary analysis of levels of arsenic and other metalic elements in PM10 sampled near Copper Smelter Bor (Serbia

    Directory of Open Access Journals (Sweden)

    Renata Kovačević


    Full Text Available In this paper, the levels of twenty one elements (Ag, Al, As, B, Ba, Ca, Cd, Cr, Cu, Fe, K, Mg, Mn, Mo, Na, Ni, Pb, S, Se, Sr and Zn in PM10 are presented, as well as SO2 concentration, measured at the sampling site in an urban area of the town of Bor (40,000 inhabitants in eastern Serbia. The sampling site was located in a densely populated city center about 0.65 km away from one of the largest copper mines and copper smelters in Europe. For the first time PM10 was collected using the European standard sampler, during a preliminary campaign in duration of 7 days in early spring 2009. PM10 were sampled on PTFE membrane filters and element concentrations were quantified by GF AAS and ICP AES. Concentration levels and correlations within trace elements, PM10 and SO2 indicated that industrial activities underpinned with meteorological conditions of low wind speed (calm are the main factors that influence air pollution in a densely populated area. It was evident that both PM10 mass concentration and SO2 concentration once exceeded the daily limit values during a measuring period of seven days. Strong relationship was found between PM10 and Mn, Mg, Ca and B daily average concentrations. On the other hand, SO2 correlated strongly with As, Pb, Cd, Cu and S daily average concentrations. These results confirm the relationship between emissions of SO2 from the Copper Smelter Bor and calm meteorological conditions (wind speed less than 0.5 m/sec with the concentration levels of carcinogenic substances of arsenic, lead and cadmium in ambient air.

  5. Proeven van tekstkritiek. Een onderzoek betreffende de tekstgeschiedenis van de Renout van Montalbaen en de Perceval

    NARCIS (Netherlands)

    Hogenhout-Mulder, Maaike Janna


    In dit proefschrift wordt een poging gedaan de tekstgeschiedenis te achterhalen van twee Middelnederlandse tekstfragmenten: een gedeelte uit de RENOUT VAN MONTALBAEN en een gedeelte uit de PERCEVAL. ... Zie: Twee tekstfragmenten als object van onderzoek

  6. Hogere verwachtingen van technologie dan van elkaar?

    NARCIS (Netherlands)

    Dr. Stijn Verhagen


    Boekbespeking van Sherrie Turkle, 2011, Alone Together: Why We Expect More from Technology and Less from Each Other. New York: Basic Books. Mails, sms’jes, instant messages, tweets, Skype, voicemails, Facebookberichten – via smartphones en andere apparaten zijn we vrijwel non-stop in contact met

  7. Lichtdoorlatendheid van kasdekken onder verschillende omstsndigheden

    NARCIS (Netherlands)

    Bot, G.P.A.


    Aandacht voor lichtonderschepping; bewolkingsgraad; direkte straling; diffuse straling en gevolgen van veranderingen in kaskonstruktie of materiaaleigenschappen ten aanzien van de lichtdoorlatendheid. Bij vergelijking van de lichttransmissie van diverse kasdekken dient te worden uitgegaan van

  8. Jamie Oliver i den gode smags tjeneste

    DEFF Research Database (Denmark)

    Leer, Jonatan


    det gode liv er i stigende grad blevet en central del af genren i dag, hvor særligt kogebogsforfatternes privatliv og livsstil – altså et selvbiografisk element – er blevet et bærende narrativ i mange kogebøger. Med sådanne iscenesættelser og dramatiseringer af forestillinger om det gode liv bevæger...... den gode sags tjeneste først og fremmest tjener til at skabe et positivt billede af tv-kokken/kogebogsforfatteren som etisk individ (og brand) på bekostning af de gastronomisk nødstedte. Det skal nævnes, at jeg i min læsning af Jamies kogebogs-kampskrift har ladet mig inspirere af den russisk...

  9. Stephen Schwartz og den folkelige lyd

    DEFF Research Database (Denmark)

    Kreutzfeldt, Jacob


    Stephen Schwartz døde i foråret 2013. I denne artikel forsøger Jacob Kreutzfeldt, der gennemførte en række interviews med Schwartz gennem hans sidste år, at indkredse den æstetiske grundholdning, der prægede hans arbejde med radiomontagen i DR.......Stephen Schwartz døde i foråret 2013. I denne artikel forsøger Jacob Kreutzfeldt, der gennemførte en række interviews med Schwartz gennem hans sidste år, at indkredse den æstetiske grundholdning, der prægede hans arbejde med radiomontagen i DR....

  10. Dens Evaginatus: A Problem-Based Approach

    Directory of Open Access Journals (Sweden)

    A. Ayer


    Full Text Available Dens evaginatus is an uncommon developmental anomaly of human dentition characterized by the presence of tubercle on the occlusal surface of mandibular premolars and lingual surface of anterior teeth. Due to occlusal trauma this tubercle tends to fracture thus exposing the pathway to the pulp chamber of teeth. This case report is about the presentation of dens evaginatus in mandibular premolars bilaterally; among them tooth 44 was associated with chronic apical periodontitis. Fractured tubercle of three premolars was sealed with composite resin. Root canal treatment was performed with tooth 44. Routine endodontic treatment did not result in remission of infection. Therefore, culture and sensitivity tests were performed to identify the cause and modify treatment plan accordingly. Triple antibiotic paste was used as an intracanal medicament to disinfect the root canal that resulted in remission of infection.

  11. Bepaling van de optredende temperaturen bij tunnelcompostering van geitenmest

    NARCIS (Netherlands)

    Melse, R.W.; Sauvage, de G.J.; Roest, H.I.J.


    Het doel van het project is om inzicht te krijgen in de composteerbaarheid van geitenmest en het hiermee samenhangende temperatuursverloop . Bepaald dient te worden welke temperaturen tijdens het composteren van geitenmest worden bereikt om op basis daarvan een inschatting te kunnen maken van de

  12. Kleinschalige raffinage van bietenblad : eerste verkenning van de moglijkheden

    NARCIS (Netherlands)

    Wolf, de P.L.; Visser, de C.L.M.; Keijsers, E.R.P.; Meesters, K.P.H.; Heesakkers, J.W.M.; Aerts, M.


    Doelstelling van de eerste fase van het onderzoek was ‘het verkennen van kleinschalige keten(s) voor de raffinage van bietenblad’, met aandacht voor de technologische en economische haalbaarheid. Deze verkenning vormt de basis voor de volgende fase, waarin kansrijke opties verder worden uitgewerkt

  13. Inclusie door interprofessionele samenwerking. : Resultaten van de proeftuinen van PACT.

    NARCIS (Netherlands)

    Doornenbal, Jeannette; Fukkink, Ruben; van Yperen, Tom; Balledux, Mariëlle; Spoelstra, Jolanda; Verseveld, Marloes


    Deze rapportage gaat over de resultaten van de PACT-proeftuinen waaraan in opdracht van Het Kinderopvangfonds van 2015 tot 2017 is gewerkt. PACT-proeftuinen zijn innovatieve praktijken waarin door middel van interprofessionele samenwerking tussen de kinderopvang, het basisonderwijs en de zorg wordt

  14. Digitale incunabelen : Over het belang van het archiveren van websites

    NARCIS (Netherlands)

    Voerman, Gerrit; Keyzer, Andreas; den Hollander, Franciscus

    'Het geheugen van Nederland verpulvert'. Zo luidde de noodkreet van ruim twintig grote bibliotheken in het voorjaar van 1998. In een advertentie in enkele landelijke dagbladen vroegen deze bibliotheken om honderden miljoenen guldens voor het restaureren, fotograferen en digitaliseren van boeken en

  15. Digitale incunabelen : Over het belang van het archiveren van websites

    NARCIS (Netherlands)

    Voerman, Gerrit; Keyzer, Andreas; den Hollander, Franciscus


    'Het geheugen van Nederland verpulvert'. Zo luidde de noodkreet van ruim twintig grote bibliotheken in het voorjaar van 1998. In een advertentie in enkele landelijke dagbladen vroegen deze bibliotheken om honderden miljoenen guldens voor het restaureren, fotograferen en digitaliseren van boeken en


    African Journals Online (AJOL)


    oordele aan die eerste drie hoofstukke van sy Evangelie, het Lukas onder „van ..... Simon te onderskei van Simon Petrus, hoef ons nie erns te maak nie. .... op hulle beurt vereenselwig met Mosa van Jos. .... i&) Lukas der Arzt. Leipzig, 1906.

  17. Verheerlijken, kraken en verguizen: burgerlijke en antiburgerlijke fans rond het Amsterdamse standbeeld van Vondel tussen 1867 en 2010

    NARCIS (Netherlands)

    Jongsma, J.; Rock, J.


    This article examines the functions of the statue of early modern Dutch playwright Joost van den Vondel, since its unveiling in 1867 (in the Amsterdam Vondelpark) until the present day. Building on studies of literary memory culture and fandom, we argue that the statue can be understood as a product

  18. Den danske fødevaresektor

    DEFF Research Database (Denmark)

    Bosselmann, Aske Skovmand; Gylling, Morten


    Den danske fødevaresektor har et højt niveau for så vidt angår miljø og bæredygtighed. Der kan være et potentiale for vækst og beskæftigelse i at bruge dette relativt høje niveau til at give danske virksomheder adgang til attraktive eksportmarkeder, hvor fødevarer, der er dokumenteret bæredygtige...

  19. Open Access og Den Bibliometriske Forskningsindikator

    DEFF Research Database (Denmark)

    Dorch, Bertil


    I sine "Anbefalinger til implementering af Open Access i Danmark" foreslår det nationale Open Access Udvalget blandet andet, at Den Bibliometriske Forskningsindikator (BFI) bør koordineres med en national Open Access-politik. I dette paper, der er baseret på et blogindlæg, fremfører forfatteren...... fire grunde til, hvorfor han synes det er en dårlig idé at koble Open Access til BFI....

  20. Injury Biomechanics of C2 Dens Fractures


    Yoganandan, Narayan; Pintar, Frank; Baisden, Jamie; Gennarelli, Thomas; Maiman, Dennis


    The objective of this study is to analyze the biomechanics of dens fractures of the second cervical vertebra in the adult population due to motor vehicle crashes. Case-by-case records from the Crash Injury Research and Engineering Network (CIREN) and National Automotive Sampling System (NASS) databases were used. Variables such as change in velocity, impact direction and body habitus were extracted. Results indicated that similarities exist in the two databases despite differences in sampling...

  1. Simultaneous Occurrence of Dens Invaginatus and Fusion

    Directory of Open Access Journals (Sweden)

    Amit Mhapuskar


    Full Text Available Although Dens invaginatus and fusion are well-known and well established dental anomalies, they are rarely seen in supernumerary teeth. In this article, simultaneous occurrence of Dens invaginatus and fusion between maxillary lateral incisor and a supernumerary tooth is described. Dens invaginatus is clinically significant due to the possibility of the pulpal involvement; pulpitis, necrotic pulps and chronic periapical lesions are often associated with this anomaly without clinical symptoms. Fusion has a negative impact on the aesthetics, especially when it occurs in maxillary anterior teeth. It is difficult to clinically make differential diagnosis between fused teeth and geminated teeth, especially when these anomalies take place together with hypodontia or supernumerary tooth. It has been found that sequel of such teeth may result in delayed eruption, ectopic eruption or even impaction of permanent teeth; hence proper diagnosis by clinical and radiographic methods and intervention at appropriate time is of paramount importance. The accurate knowledge of variations in morphology of tooth and pulp cavity greatly assists the dentist in planning successful treatment options.

  2. Digital kommunikation med den offentlige sektor

    DEFF Research Database (Denmark)

    Berger, Jesper; Andersen, Kim Normann


    Denne rapport sammenfatter hovedresultaterne af en undersøgelse gennemført i juni måned 2013 om besvarelse af e-mail og digital post i den statslige, regionale og kommunale sektor. Allerede med eDag3 1. nov. 2010 skulle alle myndigheder have oprettet en digital postkasse, som borgerne kunne skrive...... til. I denne undersøgelse sættes der fokus på myndighedernes besvarelse af den digitale post. Digital post blev bl.a. etableret som et alternativ til almindelig e-mail for at det offentlige kan kommunikere med borgere og virksomheder på en sikker måde, dvs. uden at uvedkommende kan få adgang til...... følsomme oplysninger. Fokus for undersøgelsen er hvordan håndterer myndighederne besvarelserne i den digitale postkasse: svarer de på digital post og e-mail, hvor hurtigt svarer de og er svarene brugbare? Undersøgelsen medtager myndighedernes besvarelse af digital post og e-mail, dels for at kunne...

  3. Digital kommunikation med den offentlige sektor

    DEFF Research Database (Denmark)

    Berger, Jesper Bull; Andersen, Kim Normann

    Denne rapport sammenfatter hovedresultaterne for styrelser og statslige organisationer af en undersøgelse gennemført i sommeren 2013 om besvarelse af e-mail og digital post i den statslige, regionale og kommunale sektor. Allerede med eDag3 1. nov. 2010 skulle alle myndigheder have oprettet en...... digital postkasse, som borgerne kunne skrive til. I denne undersøgelse sættes der fokus på myndighedernes besvarelse af den digitale post. Digital post blev bl.a. etableret som et alternativ til almindelig e-mail for at det offentlige kan kommunikere med borgere og virksomheder på en sikker måde, dvs....... uden at uvedkommende kan få adgang til følsomme oplysninger. Fokus for undersøgelsen er hvordan håndterer myndighederne besvarelserne i den digitale postkasse: svarer de på digital post og e-mail, hvor hurtigt svarer de og er svarene brugbare? Vi har også undersøgt besvarelse af e-mail, dels...

  4. Seksuele dienstverlening door mannen in Den Haag: Ontwikkelingen op het internet

    Directory of Open Access Journals (Sweden)

    Paul van Gelder


    Full Text Available Seksuele dienstverlening door mannen in Den Haag: Ontwikkelingen op het internet Met de legalisering van het prostitutiebedrijf en de snelle opkomst van het internet zijn mannelijke seksuele dienstverleners in Nederland uit het zicht geraakt. De meeste boysclubs sloten hun deuren. Deze zaken, samen met de aangescherpte handhaving op openbare ontmoetingsplaatsen, vormen redenen voor deze groep om online te gaan. In 2009 is er in Den Haag een onderzoek uitgevoerd naar deze specifieke doelgroep, met speciale aandacht voor het internet. Mogelijke veranderingen in de behoeften en vragen bij mannelijke seksuele dienstverleners zijn ook onderzocht. In hoeverre zijn zij op het internet bereikbaar voor informatie, advies of hulp? Bij het online verrichten van onderzoek en veldwerk blijkt het signaleren wel goed uit te werken maar is het nog zoeken naar een “praatpaal-functie”. Male sexual services in The Hague: developments on the internet Since the legalization of prostitution and the rapid rise of the internet, male providers of sexual services got out of sight in the Netherlands. Most boysclubs had to close down. These matters, along with the tighter controls at cruising areas are reasons why this group has turned to the internet to offer their services. In 2009, a research was carried out on the nature and extent of male sexual services in the region of The Hague, with a special focus on the internet. Possible changes in the needs and problems of male sexual providers were also explored. To what extent can they be reached by means of the internet, in order to provide them with information, advise or assistance? On the basis of the research data it can be concluded that the internet can be an important tool in the signalling and finding of male sexual providers. Getting more acquainted with them and gaining their trust, however, is still rather hard to realize.

  5. Die opleiding van bedryfsielkundiges aan die universiteit van Fort Hare

    Directory of Open Access Journals (Sweden)

    W. Botha


    Full Text Available Die Departement Bedryfsielkunde aan die Universiteit van Fort Hare is 'n relatiewe jong departement en het eers in 1965 tot stand gekom. Voor hierdie datum is Bedryfsielkunde as 'n kort kursus deur die departement van suiwer Sielkunde aangebied en een van die destydse dosente, Dr. W. Backer, het die inisiatief geneem om 'n selfstandige departement van Bedryfsielkunde in die Fakulteit van Ekonomiese Wetenskappe op die been te bring.

  6. Betrekkingen tusschen de constitutie van organische verbindingen en den invloed van het hydroxyl-ion bij hydrolyse

    NARCIS (Netherlands)

    Weber, A.P.


    Rates of saponification ofα-chlorotoluene,αα-dichlorotoluene andα,α,αtrichlorotoluene and of their ortho, meta, and para isomers of halogen, nitro methyl and carboxylic derivatives in neutral, alkaline or acid medium were measured. The velocity of the hydrolysis in the different ranges of pH could

  7. Economische gevolgtrekkingen, voortvloeiende uit een analyse van den djati-opstand en van het djati-boschbedrijf op Java

    NARCIS (Netherlands)

    Beekman, H.A.J.M.


    Beekman tried to define the financial rotation of teak high forest in a clearance felling system, allowing for modifying factors. For practical reasons only one site of quality (IV) in one forest district was considered. This district had been used for timber production for 20 years. Through its

  8. Controle van spectrofotometers in ziekenhuislaboratoria

    NARCIS (Netherlands)

    Ham; W.A.van den; Steentjes; G.M.; Buitenhuis; S.G.; Terlingen; J.B.A.


    In dit rapport worden de resultaten beschreven van een onderzoek dat door twee medewerkers van het Laboratorium voor Klinische Chemie en Hematologie werd ingesteld naar de toestand van 22 fotometers in ziekenhuislaboratoria. Onderzocht werden: - juistheid van de golflengte-instelling - juistheid

  9. Siektes van peroksisome - 'n oorsig

    African Journals Online (AJOL)

    (x 14 SOO). Peroksisoomsiektes2. ,3,5.6. Ongeveer 12 genetiese siektes wat as gevolg van foute in die ontwikkeling of in die samestelling van peroksisome antstaan, is reeds beskryf. Volgens die omvang van die biogenetiese fout en die graad van verlies aan peroksisoomfunksies word hierdie sindrome in 3 groepe.

  10. Preventie van slaapgebrek en vermoeidheid

    NARCIS (Netherlands)

    Simons, R; Valk, P.


    Korte schets van de bijdrage aan het Europese Fit-to Fly project ( Early Warning Systems sensoren) van TNO Defensie en Veiligheid en hun eigen onderzoek naar fase-verschuiving van de slaap en strategisch gedoseerde slaapperioden. De eisen die een missie aan het personeel stelt, de verstoring van het

  11. Algemene principes van palliatieve zorg

    NARCIS (Netherlands)

    de Graeff, A; Jobse, A.; Teunissen, SCCM; Verkuijlen, S.; Vissers, K.C.P.; Zylicz, Z; Gilsing, M.


    Palliatieve zorg is een benadering die de kwaliteit van leven verbetert van patiënten (kinderen en volwassenen) en hun naasten die te maken hebben met een levensbedreigende aandoening, door het voorkomen en verlichten van lijden door middel van vroegtijdige signalering en zorgvuldige beoordeling en

  12. Burnout : de stand van zaken

    NARCIS (Netherlands)

    Taris, T.; Houtman, I.L.D.; Schaufeli, W.


    Dit artikel geeft een overzicht van de stand van zaken in het onderzoek naar burnout. Burnout is een syndroom van extreme vermoeidheid (uitputting), afstand nemen van het werk (distantie) en weinig vertrouwen in het eigen kunnen (verminderde competentie), waarbij de oorzaken voor deze aspecten

  13. Microbewerking met behulp van lasers

    NARCIS (Netherlands)

    Ezendam, M.M.M.


    Het bewerken van materialen met behulp van lasers staat momenteel enorm in de belangstelling, en terecht. De ontwikkeling van bestaande en nieuwe typen lasers staat alles behalve stil. Ontwikkelingen bevinden zich met name in het gebied van hogere vermogens, betere bundelkwaliteit en hogere

  14. Bestrijding van duist in wintertarwe

    NARCIS (Netherlands)

    Timmer, R.D.


    Duist, en speciaal resistente duist, is één van de grootste problemen in het graantelend gebied het Oldambt. De wintertarwegewassen ondervinden sterke concurrentie van de groeiende duistpopulatie, hetgeen ten koste gaat van de opbrengst. De inzet en kosten van de toegepaste herbiciden nemen toe

  15. Ingredienten voor kwaliteitsborging van modelonderzoek

    NARCIS (Netherlands)

    Grinsven JJM van; Haan BJ de; Braat LC; MNV; LBG; CIM


    In dit rapport wordt een aanzet gepresenteerd tot harmonisatie van de kwaliteitsborging van modelonderzoek in het RIVM. Het rapport komt voort uit initiatieven van leden van het Intersectoraal Modellen Overleg. Het rapport is in eerste instantie bedoeld voor onderzoekers die modellen

  16. De eeuw van de Beeldenstorm

    Directory of Open Access Journals (Sweden)

    F. Postma


    Full Text Available P. van Boheemen, N.P.J. van der Lof, E. van Meurs, Het boek in Nederland in de 16e eeuw S. Groenveld, Ketters en papen onder Filips II. Het godsdienstig leven in de tweede helft van de zestiende eeuw R. Kistemaker, M. Jonker, De smaak van de elite. Amsterdam in de eeuw van de Beeldenstorm W.Th. Kloek, Kunst voor de Beeldenstorm. Noord-Nederlandse kunst ca 1525-1580, [I], Inleiding, [II, Catalogus] J.R. ter Molen, A.P.E. Ruempol, A.G.A. Dongen, Huisraad van een molenaarsweduwe. Gebruiksvoorwerpen uit een 16e eeuwse boedelinventaris M. de Roever, B. Bakker, Woelige tijden. Amsterdam in de eeuw van de Beeldenstorm I.M. Veldman, Leerrijke reeksen van Maarten van Heemskerck

  17. Ondersteuning van mobiele hulpverleners

    NARCIS (Netherlands)

    Huis in 't Veld, M.M.A.; Streefkerk, J.W.


    TNO onderzoekt hoe mobiele hulpverleners beter ondersteund kunnen worden. Wat is de visie van TNO? Twee praktijkvoorbeelden geven inzicht. In het project "Decision Support Tools" zijn twee typen beslisondersteuningsconcepten ontwikkeld en getest, een Simulatie tool (CFSim) en een Critical Thinking

  18. Ontwerpen van productkwaliteit

    NARCIS (Netherlands)

    Boxtel, van A.J.B.; Stigter, J.D.; Entius, S.D.J.


    Bij het ontwerpen van productie- en voedselbereidingsapparatuur worden fysische grootheden als uitgangspunt genomen. Het ligt echter meer voor de hand om de berekeningen op de beoogde producteigenschappen te baseren. Tot nu toe zijn de rekenmethoden voor complexere producten ontoereikend. Wageningen

  19. Effectief leren van multimedia

    NARCIS (Netherlands)

    Kester, Liesbeth


    Kester, L. (2012, March). Effectief leren van multimedia [Effective learning from multimedia]. Keynote presented at a miniconference Learning Sciences of the Open University of the Netherlands, Eindhoven, the Netherlands.

  20. Ellis Van Creveld syndrome

    Directory of Open Access Journals (Sweden)

    Shilpy S


    Full Text Available Ellis Van Creveld syndrome is a rare disorder and is a form of short-limbed dwarfism. It is an autosomal recessive disorder characterized by tetrad of disproportionate dwarfism, post-axial polydactyly, ectodermal dysplasia and heart defects. This case report presents a classical case of a seven-year-old boy with Ellis Van Creveld syndrome presented with discrete clinical findings.

  1. Space Van system update (United States)

    Cormier, Len


    The Space Van is a proposed commercial launch vehicle that is designed to carry 1150 kg to a space-station orbit for a price of $1,900,000 per flight in 1992 dollars. This price includes return on preoperational investment. Recurring costs are expected to be about $840,000 per flight. The Space Van is a fully reusable, assisted-single-stage-to orbit system. The most innovative new feature of the Space Van system is the assist-stage concept. The assist stage uses only airbreathing engines for vertical takeoff and vertical landing in the horizontal attitude and for launching the rocket-powered orbiter stage at mach 0.8 and an altitude of about 12 km. The primary version of the orbiter is designed for cargo-only without a crew. However, a passenger version of the Space Van should be able to carry a crew of two plus six passengers to a space-station orbit. Since the Space Van is nearly single-stage, performance to polar orbit drops off significantly. The cargo version should be capable of carrying 350 kg to a 400-km polar orbit. In the passenger version, the Space Van should be able to carry two crew members - or one crew member plus a passenger.

  2. De toekomst van flex : een onderzoek van tno naar flexstrategieën van Nederlandse bedrijven

    NARCIS (Netherlands)

    Verbiest, S.E.; Goudswaard, A.; Wijk, E.B. van


    In 2020 zal het personeelsbestand van organisaties voor 30% uit flexkrachten bestaan. Op dit moment is dat 25%. Dit blijkt uit een onderzoek van TNO onder 900 ondernemingen in opdracht van de ABU (Algemene Bond Uitzendondernemingen). Het blijkt dat met name organisaties die al gebruikmaken van

  3. De trek van kruiden van volgroeid wortelmateriaal : handleiding van A tot Z in beknopte vorm

    NARCIS (Netherlands)

    Wijk, van C.A.P.


    Deze teelthandleiding richt zich op de trek van vooral dragon, krulpeterselie, rucola en munt, uitgaande van wortelmateriaal dat in de vollegrond wordt geteeld. Deze forcering richt zich zowel op aanbod van kruiden in potjes als de meermalige oogst van het gesneden product in een kas of een

  4. Dens evaginatus and dens invaginatus in a double tooth: A rare case report

    Directory of Open Access Journals (Sweden)

    Gaurav Sharma


    Full Text Available The presence of dens invaginatus (DI and dens evaginatus (DE on same tooth is a rare phenomenon. However, when these dental anomalies occur on a double tooth, it becomes an extremely rare phenomenon. The authors report a rare case of DI and DE on fused permanent maxillary central incisor with supernumerary tooth in a 40-year-old male. The present article also focuses on the differentiating fusion from gemination and also reviews preventive and management strategies for tooth with complex dental anatomy.

  5. Plaatsen van beschaafd vertier

    Directory of Open Access Journals (Sweden)

    James Kennedy


    Full Text Available Plaatsen van beschaafd vertier [Places of civilised amusement] by Jan Hein Furnée, which appeared as a PhD thesis in 2007 and was adapted and extended into a book in 2012, is regarded by historians of the Low Countries as an impressive tour de force. In a stimulating manner Furnée demonstrates with this profound urban history that for the elite of The Hague leisure activities played an important role in acquiring status and maintaining their position. His study is based on extensive and systematic research into a great variety of sources, from census registers, membership lists of clubs and societies to address books. This gives the reader an extraordinarily detailed picture of the changing social relations in the upper echelons of society in The Hague in the latter half of the nineteenth century. The sophisticated use of both qualitative and quantitative methods can serve as a model for other historians in the field of urban history. In a lively fashion Furnée shows that the inhabitants of The Hague grasped at all kinds of pastimes in order to distinguish themselves from others, and when possible to increase their own status through their participation in elegant societies, theatre visits or supporting the proposed zoo: but the book also makes statements about status and class, the history of gender and of politics at the end of the nineteenth century. Plaatsen van beschaafd vertier van Jan Hein Furnée dat in 2007 als proefschrift en in 2012 bewerkt en uitgebreid als boek verscheen, staat onder historici van de Lage Landen bekend als een imponerende tour de force. Op prikkelende wijze laat Furnée in deze diepgravende stadsgeschiedenis zien dat vrijetijdsbesteding voor Haagse elites een belangrijke rol speelde in standsvorming en handhaving van hun positie. Zijn studie is gebaseerd op uitgebreid en systematisch onderzoek van veelsoortige bronnen, van volkstellingsregisters, ledenlijsten van verenigingen en sociëteiten tot adresboeken

  6. Mobility and natural attenuation of metals and arsenic in acidic waters of the drainage system of Timok River from Bor copper mines (Serbia) to Danube River. (United States)

    Đorđievski, Stefan; Ishiyama, Daizo; Ogawa, Yasumasa; Stevanović, Zoran


    Bor, Krivelj, and Bela Rivers belong to the watershed of Timok River, which is a tributary of transboundary Danube River. These rivers receive metal-rich acidic wastewater from metallurgical facilities and acid mine drainage (AMD) from mine wastes around Bor copper mines. The aim of this study was to determine the mobility and natural attenuation of metals and arsenic in rivers from Bor copper mines to Danube River during the year 2015. The results showed that metallurgical facilities had the largest impact on Bor River by discharging about 400 t of Cu per year through highly acidic wastewater (pH = 2.6). The highest measured concentrations of Cu in river water and sediments were 40 mg L -1 and 1.6%, respectively. Dissolution of calcite from limestone bedrock and a high concentration of bicarbonate ions in natural river water (about 250 mg L -1 ) enhanced the neutralization of acidic river water and subsequent chemical precipitation of metals and arsenic. Decreases in the concentrations of Al, Fe, Cu, As, and Pb in river water were mainly due to precipitation on the river bed. On the other hand, dilution played an important role in the decreases in concentrations of Mn, Ni, Zn, and Cd. Chemically precipitated materials and flotation tailings containing Fe-rich minerals (fayalite, magnetite, and pyrite) were transported toward Danube River during the periods of high discharge. This study showed that processes of natural attenuation in catchments with limestone bedrock play an important role in reducing concentrations of metals and arsenic in AMD-bearing river water.

  7. SHB1/HY1 Alleviates Excess Boron Stress by Increasing BOR4 Expression Level and Maintaining Boron Homeostasis in Arabidopsis Roots

    Directory of Open Access Journals (Sweden)

    Qiang Lv


    Full Text Available Boron is an essential mineral nutrient for higher plant growth and development. However, excessive amounts of boron can be toxic. Here, we report on the characterization of an Arabidopsis mutant, shb1 (sensitive to high-level of boron 1, which exhibits hypersensitivity to excessive boron in roots. Positional cloning demonstrated that the shb1 mutant bears a point mutation in a gene encoding a heme oxygenase 1 (HO1 corresponding to the HY1 gene involved in photomorphogenesis. The transcription level of the SHB1/HY1 gene in roots is up-regulated under excessive boron stimulation. Either overexpressing SHB1/HY1 or applying the HO1 inducer hematin reduces boron accumulation in roots and confers high boron tolerance. Furthermore, carbon monoxide and bilirubin, catalytic products of HO1, partially rescue the boron toxicity-induced inhibition of primary root growth in shb1. Additionally, the mRNA level of BOR4, a boron efflux transporter, is reduced in shb1 roots with high levels of boron supplementation, and hematin cannot relieve the boron toxicity-induced root inhibition in bor4 mutants. Taken together, our study reveals that HO1 acts via its catalytic by-products to promote tolerance of excessive boron by up-regulating the transcription of the BOR4 gene and therefore promoting the exclusion of excessive boron in root cells.

  8. Droht den "kleinen Sprachen" das Aussterben?

    Directory of Open Access Journals (Sweden)

    Anita Lemić


    Full Text Available Die Prozesse der Globalisierung sind die Ursache für viele Änderungen in der Weltgemeinschaft, vor allem die Entfernung von Unterscheidungsmerkmalen (in Bezug darauf, dass „zwischen vielen ethnischen Zeichen, das was dauernd ist, ist die Dichotomisierung/Differenzierung eines „Wir-und-die-Anderen“ (Grbić, 2003, 93-64. Diese Zeichen wirken als Zeichen der Resozialisierung, die die bestehenden Identitäten löschen und sich an der Schaffung neuer Strukturen beteiligen. Die Zeit der Romantik in Europa ermöglichte die Schaffung von Nationalstaaten und ihr Hauptmerkmal war die Nationalsprache. Diese Art der sozialen Differenzierung hatte das Ziel, die Illusion einer vollständig homogenisierten Gesellschaft zu schaffen und damit den Prozess der Zerstörung der „kleinen“ Sprachen zu beginnen. Sprache und Kultur erwiesen sich als Grundlage der Gemeinschaftserhaltung. Die Homogenisierung ermöglicht Aktivitäten mit dem Ziel, einem Individuum zu helfen, sich als Individuum und als Mitglied der Gemeinschaft zu behaupten. Keine dieser beiden Identitäten kann ohne die Wechselwirkung mit der Umgebung erreicht werden. Die sprachliche Interaktion mit anderen Mitgliedern ist das Schlüsselsegment, das Menschen von anderen Lebensformen unterscheidet. Durch den Austausch von Erfahrungen mit anderen kommt der Mensch auf allen Ebenen voran und mit der Erfindung der Schrift öffnete er die Tür zur Entwicklung der Zivilisation. In dieser Arbeit beschäftigen wir uns mit der Frage der „Prestige“-Sprachen, die auf der Grundlage der Macht der Gemeinschaft der Muttersprachler ihren Bereich weit über die Grenzen des eigenen Landes hinaus erweitern und so eine politische und wirtschaftliche Vormachtstellung schaffen, aber auch mit den Auswirkungen jener Sprachen auf die Dekonstruktion oder möglicherweise vollständige Ausrottung der Sprachen, die auf diese Weise an Einfluss verlieren, unmodern werden und sich die Frage der Notwendigkeit ihrer

  9. Den danske ROSE-undersøgelse

    DEFF Research Database (Denmark)

    Andersen, Annemarie Møller; Allerup, Peter; Arnvig, Birgitte

    ROSE (Relevance of Science Education) er en international komparativ undersøgelse af 15-åriges holdninger til og interesse for naturfagsundervisning, naturvidenskab og teknologi med deltagelse af ca. 40. lande. Dataindsamlingen til den danske del af ROSE-undersøgelsen blev gennemført i 2003....... Antologien giver et overblik over  og forskellige perspektiver på de danske 15-åriges besvarelser af de ca. 280 spørgsmål i det danske ROSE-skema....

  10. Transnational organisatorisk innovation i den offentlige sektor

    DEFF Research Database (Denmark)

    Hansen, Morten Balle

    Artiklen undersøger tre problemstillinger: 1) Hvor udbredt er forskellige former for transnational organisatorisk innovation i den danske offentlige sektor? 2) Hvordan er disse organisatoriske innovationer relateret til hinanden? 3) Er forskelle i deres udbredelse signifikant relateret til...... innovation og dels på forskelle og ligheder mellem statslige og kommunale organisationer. Elleve former for organisatorisk innovation, hvoraf mange ofte forbindes med New Public Management (NPM), er inkluderet i de empiriske analyser: Privatisering/udlicitering, Bestiller-Udfører model, Kontraktstyring, Mål...

  11. Fusion og koncentration i den danske svineslagterisektor

    DEFF Research Database (Denmark)

    Hansen, Henning Otte


    Strukturudviklingen i den danske slagterisektor er gået hurtig i de seneste ti-år. Koncentrationen steg kraftigt efter midten af 1980‘erne, men i de sidste 10-15 år er udviklingen i et vist omfang stagneret eller endog vendt, og koncentrationen har været faldende. En evt. fusion mellem Danish Crown...... og Tican vil sandsynligvis ikke opveje dette fald i koncentration. De historiske erfaringer fra sektoren viser endvidere, at virksomheder efter en fusion ofte taber markedsandele. Markedet for svinekød er blevet langt mere internationaliseret i de senere år, og dette alene vil øge konkurrencen....

  12. Zoologien i den klassiske islamiske kultur


    Provencal, Philippe; Aarab, Ahmed


    Denne artikel bringer en oversigt over forskning i den zoologiske videnskab, således som denne er kommet til udtryk i tekster skrevet på klassisk arabisk fra anden halvdel af 700-tallet til 1400-tallet. I lyset af nyere forskning og med eksempler hentet fra de arabiske tekster selv, bliver en ny bedømmelse af disse teksters faglige indhold foreslået. This article brings a survey of research on the science of zoology in the Classical Arabic/Islamic Culture as revealed in texts on this subje...

  13. Energy. The century of my mother; Energie. De eeuw van mijn moeder

    Energy Technology Data Exchange (ETDEWEB)

    Linde, M.


    The mother of the author is an expert in the field of energy, and works at Clingendael International Energy Programme CIEP in The Hague, Netherlands. This collection of essays looks forward to the energy supply situation in 2050. [Dutch] De moeder van de auteur is deskundige op het gebied van energie en onder meer werkzaam bij Clingendael International Energy Programme CIEP in Den Haag. In deze bundel essays kijkt de auteur vooruit en beschrijft de situatie in het jaar 2050 m.b.t. de energievoorziening.

  14. Denning behaviour of non-gravid wolves, Canis lupus (United States)

    Mech, L.D.; Phillips, M.K.; Smith, D.W.; Kreeger, T.J.


    Wild wolves (Canis lupus) that had produced pups in earlier years but were not currently pregnant, and ovariectomized captive wolves, dug dens during and after the whelping season even though they produced no pups. These observations suggest that den digging is not a function of pregnancy or of ovarian estrogen or progesterone. We hypothesize that increasing prolactin in spring elicits or mediates den-digging behavior.

  15. Psigologiese benadering van pastorale arbeid

    Directory of Open Access Journals (Sweden)

    D. J. Strümpfer


    Full Text Available In die spreektaal van ons Afrikaanse kerke is ons lief om die bedienaar van die Woord aan te dui as „die predikant”, „die leraar” of „die dominee”. Miskien plaas ons met hierdie semantiese gebruik van terme wat lering en proklamering impliseer, ’n ongelukkige klem op die preekamp. Daarteenoor, het ons semanties miskien iets te leer van die Pinkstersektes wat die benaming „pastoor” verkies, of die Amerikaanse ge­ bruik van die term „the pastor”. Ons is wel lief om te praat van „ons herder en leraar”. Veelal word die herderlike, of pastorale, deel van die taak van die bedienaar van die Woord egter in sy eie gedagtes, asook in die gedagtes van sy gemeentelede, deur die leraarskap op die agtergrond gedwing. Al te dikwels word hy deur gemeentelede beskou as iemand wat op Sondag op die kansel gesien moet word en wat niks met die res van hul lewens te doen het nie. Herstel van die pastoraat sal deel moet wees van die proses om die ontkerstening van die hedendaagse lewe teen te gaan.

  16. Den skjulte Oldtid – den nye udstilling på Nationalmuseet

    DEFF Research Database (Denmark)

    Ingemann, Bruno


    Enhver udstilling konstruerer sin besøgende! Man skal som besøgende have bestemte forudsætninger, en vis viden, kende bestemte kategorier, have en bestemt form for nysgerrighed – og det er udstillingen som skaber dette særsprog med dets muligheder for at udelukke eller inkludere den besøgende. De...

  17. Konservatismen og den højreradikale terror

    DEFF Research Database (Denmark)

    Skov, Christian Houlberg


    Den norske højreekstremist Anders Behring Breiviks terror mod det norske samfund har herhjemme ledt til en voldsom debat om blandt andet forbindelsen mellem tonen i debatten og terrorangrebet og forholdet mellem den siden 2001 meget omtalte kulturkonservatisme og Anders Breiviks terrorhandling....... Essayet Konservatismen og den højreradikale terror forsøger dels at skabe klarhed over fronterne i debatten, dels at rette en kritik mod såvel tendensen til at afskrive handlingen som uforståelig som af tendensen til at slå den bredere højrefløjs kritik af multikulturalismen i hartkorn med Breiviks...

  18. Mozart, Karl Barth, og den kristne troslæren

    DEFF Research Database (Denmark)

    Petersen, Nils Holger


    En diskussion af Karl Barths teologiske brug af W.A.Mozart i den kirchliche Dogmatik med kontekstuel inddragelse af en til en vis grad tilsvarende overordnet diskussion af Mozart, skrevet af en samtidig musiker, den fremtrædende Mozart-dirigent Ferenc Fricsay. ......En diskussion af Karl Barths teologiske brug af W.A.Mozart i den kirchliche Dogmatik med kontekstuel inddragelse af en til en vis grad tilsvarende overordnet diskussion af Mozart, skrevet af en samtidig musiker, den fremtrædende Mozart-dirigent Ferenc Fricsay. ...

  19. On the re-emergence of motion and innovations in the Gábor Bódy's intermedia experiments

    Directory of Open Access Journals (Sweden)

    Kamil Lipiński


    Full Text Available The article explores the main cases of Hungarian neo-avant-garde cinema in terms of re-emergence of visual material and the introduction of electronic innovations resulting in the transformation of reality. Among the research conducted in Béla Balázs Studio based on reframing the perception limits in the 1960s and the 1970s, the most innovative were Gábor Bódy's intermedia experiments. Along with launching K/3 subgroup within BBS, Bódy directed its objectives to reduce the material derived from reality and to visually intervene into media image electronically transforming the landscape of his films. Innovatively adapting the Sándor Weöres's verse, the film Narcissus and Psyche (1983 aimed at using hyper-real aesthetics to reframe the film reality. Starting from 1980, Bódy founded an international magazine Infermental to disseminate the advent of the video and electronics by creating a community drew on sharing news about emerging media image.

  20. Digital kommunikation med den offentlige sektor

    DEFF Research Database (Denmark)

    Berger, Jesper Bull; Andersen, Kim Normann

    til. I denne undersøgelse sættes der fokus på myndighedernes besvarelse af den digitale post. Digital post blev bl.a. etableret som et alternativ til almindelig e-mail for at det offentlige kan kommunikere med borgere og virksomheder på en sikker måde, dvs. uden at uvedkommende kan få adgang til...... følsomme oplysninger. Fokus for undersøgelsen er hvordan håndterer myndighederne besvarelserne i den digitale postkasse: svarer de på digital post og e-mail, hvor hurtigt svarer de og er svarene brugbare? Undersøgelsen medtager myndighedernes besvarelse af digital post og e-mail, dels for at kunne...... sammenligne de to digitale kanaler og for at kunne sammenligne med en tidligere undersøgelse af digital kommunikation med det offentlige. Herudover er der tidligere gennemført en undersøgelse af e-mail svar og svartider i New Zealand og Australien. De danske resultater fra e-mail undersøgelsen, men ikke...

  1. De auteursrechtelijke aansprakelijkheid van intermediairs, het kabelpiratenarrest revisited in de tijd van Internet

    NARCIS (Netherlands)

    Dommering, E.J.; Verkade, D.W.F.; Visser, D.J.G.


    Het kabelpiratenarrest vestigde de auteursrechtelijke aansprakelijkheid van de kabelexploitant voor het verspreiden van gestolen films die clandestien na de uitzendingen van de reguliere omroepen werden uitgezonden met gebruikmaking van de centrale antenne-inrichting van KTA. Zouden wij de

  2. Praktijkkennis van leerkrachten als ontwerpers van een ICT rijke leeromgeving

    NARCIS (Netherlands)

    Boschman, Ferry; McKenney, Susan; Voogt, Joke


    Ormel, B., Pareja, N., & McKenney, S. (2011, 8-10 June). Praktijkkennis van leerkrachten als ontwerpers van een ICT rijke leeromgeving. Presentation at the ORD annual meeting, Maastricht, The Netherlands.

  3. Richtlijnen voor selectie en weergave van residugehaltes van bestrijdingsmiddelen

    NARCIS (Netherlands)

    van den Velde-Koerts T; van Hoeven-Arentzen PH; Ossendorp BC; CSR


    Residubeoordelingen van bestrijdingsmiddelen worden uitgevoerd om wettelijke residulimieten (MRLs = maximum residue limits) vast te leggen. MRLs worden afgeleid uit de resultaten van die residuproeven met bestrijdingsmiddelen die volgens kritisch "Good Agricultural Practice" zijn

  4. A study of women in atypical careers / Jolene van den Berg


    Van den Berg, Jolene


    As a result of structural changes in the global economy, many organisations are faced with changing workforce demographics. The global workforce is changing not only in terms of age and race, but also in terms of gender (International Labour Office, 2009). This change is referred to as the feminization of labour, and it poses many challenges to organisations as women are entering careers that have previously been predominated by men such as medicine, pharmacy, accounting, engineering and mini...

  5. Örn B. Bodvarsson & Hendrik Van den Berg, The Economics of Immigration: Theory and Policy


    DOUGLAS, Kacey


    Abstract. The Economics of Immigration: Theory and Policy (Second edition)is designed as a survey book that addresses all facets of immigration. Though there is a great amount of information regarding immigration, the complexity of the topic has resulted in an absence of any comprehensive book the covers a wide range of issues. The book covers immigration theory, empirical evidence regarding those theories, special issues in immigration, and immigration policy throughout the world. Designed a...

  6. Bijdrage tot de natuur- en Ontleedkundige Kennis van den Manatus Americanus

    NARCIS (Netherlands)

    Vrolik, W.


    Vreemd is het, maar intusschen door de geschiedenis der wetenschap steeds bevestigd, dat er enkele diersoorten zijn, hoewel niet bepaald tot de zeldzame behoorende, tot wier kennis men niet dan met groote moeite en als het ware stuksgewijze geraakt. Dat onder deze vooral de Lamantinen behooren, zal

  7. Review: Will van den Hoonaard (Ed. (2002. Walking the Tightrope: Ethical Issues for Qualitative Researchers

    Directory of Open Access Journals (Sweden)

    Rod Gerber


    Full Text Available This publication basically represents a collection of former conference papers and some other contributions mainly by North American social scientists on the dilemmas that qualitative researchers encounter when they submit research applications to research ethics committees. Collectively, the contributions demonstrate the tensions that exist in the policy and practice of applied research ethics in qualitative research. Thirteen chapters are included in this volume. They focus on the themes of: differentiating between ethics and morality; dealing with ethics committees and policies; research processes; research ethics trends; and, ethical issues when submitting research applications. The emphasis is on research policy in a North American context (Canada and the United States, but can be relevant for qualitative researchers in other parts of the world. One challenge to this context is that it does not capture the essence of some European perspectives, especially those from Continental Europe. However, it does raise the issue of ethics in qualitative research to a high level. URN: urn:nbn:de:0114-fqs040214

  8. Behandeling van pijn bij kanker met systemisch toegediende opioïden

    NARCIS (Netherlands)

    Enting, R H; van der Rijt, C C; Wilms, E B; Lieverse, P J; de Wit, R; Smitt, P A


    The World Health Organization guidelines for cancer pain relief have been proven efficacious in 90% of the patients with cancer pain. The patient's self-report of pain is the focus of treatment. When initiating treatment, controlled-release preparations of opioids are generally favoured, and are

  9. Herbal weight-loss products: how informed are we? | van den Berg ...

    African Journals Online (AJOL)

    Outcome measures: Structured telephonic interviews were conducted with 25 dietitians and 46 pharmacists to ascertain whether or not they had heard of the individual ingredients listed in non-prescription, weight-loss products and if they knew if each of these ingredients were scientifically proven to induce weight loss.

  10. Boze burgers: politieke mobilisatie tegen de gemeentelijke herindeling van Den Haag en omgeving

    NARCIS (Netherlands)

    Verhoeven, I.


    Anger is a common emotion expressed by Dutch citizens who mobilize in response to policy interventions by the state. In this article, I argue that this anger and involvement should not be analysed in isolation but as a relational phenomenon. During a political decision-making process, the different

  11. C-reactive protein as a predictor of severity of appendicitis | van den ...

    African Journals Online (AJOL)

    At these threshold values CRP (sensitivity 51.4%, specificity 85.7%, p-value < 0.001, positive predictive value 80.2%, negative predictive value 61%, positive likelihood ratio 3.6 and diagnostic odds ratio 6.35) proved to be much better than WCC (sensitivity 43%, specificity 73.8%, p-value = 0.022, positive predictive value ...

  12. Onderrig van Generasie Y

    Directory of Open Access Journals (Sweden)

    Elza Venter


    Full Text Available Generasie Y-leerders is jongmense wat ongeveer tussen 1977 en 2000 gebore is. Hierdie leerders het voor skerms grootgeword, ongeag of dit televisie-, rekenaar- of selfoonskerms was. Hulle is gebore in ’n samelewing waar inligting, opvoeding en vermaak net ’n klik ver was. Navorsers meen dat dié leerders se kritiese denke en ander kognitiewe vaardighede geaffekteer is omdat hulle ’n aansienlike hoeveelheid tyd daaraan bestee het om woorde en beelde passief te absorbeer, eerder as om met insig te lees. Leerders uit die generasie is dikwels ongemotiveerd en onbetrokke by hul eie leerervaring omdat hulle hul gelyktydig op ’n menigte digitale toestelle vermaak, terwyl die opvoeder hulle aandag probeer kry. Hulle verkies multitaakverrigting eerder as om op een taak of persoon op ’n slag te fokus en stel dikwels meer belang in wat op die skerm voor hulle aangaan as in wat die onderwyser hulle kan bied. Opvoeders op sekondêre en tersiêre vlak moet kennis hiervan neem en opnuut dink oor hulle onderrig- en leerstrategieë. Die klem in hierdie navorsing val op leerders, studente en opvoeders op sekondêre en tersiêre vlak. Die navorsing is deur die toepassing van ’n literatuuroorsig gedoen. Die hoofnavorsingsvraag van die studie is: ‘Hoe kan Generasie Y-leerders beter deur opvoeders by hulle eie leer in die klaskamer of lesinglokaal betrek word?’ Die twee subvrae is: (1 ‘Wat is sommige van die eienskappe van Generasie Y-leerders wat leer beïnvloed?’ en (2 ‘Watter onderrigstrategieë kan gebruik word om Generasie Y-leerders meer by hulle eie leer te betrek?’ Die outeur van hierdie artikel wil poog om opvoeders deur die literatuurstudie van riglyne in hierdie verband te voorsien.

  13. Analise van die Tswanaraaisel

    Directory of Open Access Journals (Sweden)

    S. A. Swanepoel


    Full Text Available ’n Strukturele, stilistiese en funksionele bcskrywing van die Twanaraaisel bring mee dat daar aan die volgende aspekte aandag gegee moet word: •\tWat is ’n raaisel en lioe word dit in Tswana genoem. •\tTot watter studiegebied en literere genre hoort die raaisel en watter subvorme kan vir Tswana onderskei word. •\tHoe sien die struktuur van Tswanaraaisels daar uit. •\tDeur wie, waar, wanneer en hoe word Tswanaraaisels voorgedra. •\tWatter stilistiese kenmcrke kan in Tswanaraaisels onderskei word. •\tWatter funksies vervul raaisels in ’n Tswanagcmeenskap.

  14. De verleidelijkheid van het grote gebaar : Het werk van Dogma

    NARCIS (Netherlands)

    Teerds, P.J.


    In vier portacabins op het parkeerterrein van de Delftse Faculteit Bouwkunde is nog tot volgende week de tentoonstelling 11+1 projects te zien, een overzichtstentoonstelling van het intrigerende werk van het Brusselse bureau Dogma. Met de tentoonstelling zet de faculteit na de brand in 2008 weer een

  15. ʼn Kritiese evaluering van wetgewing wat die gesondheid van ...

    African Journals Online (AJOL)


    gereguleer wat "basiese watervoorsiening" omskryf as "die voorgeskrewe minimum standaard van watervoorsieningsdienste wat nodig is vir die betroubare voorsiening van ʼn toereikende hoeveelheid en gehalte water aan huishoudings, met inbegrip van informele huishoudings, om lewe en persoonlike higiëne te steun".

  16. Prediking aan die hand van die metafoor van fiksieskryf

    African Journals Online (AJOL)


    HTS 64(3) 2008 siening van die self en waarheid. In die pre-moderne paradigma kan die dominante metafoor verstaan word aan die hand van 'n spieël wat die lig uit 'n transendente oorsprong weerkaats, terwyl die moderne paradigma uitgedruk word met die metafoor van 'n lamp wat 'n eie, oorspronklike lig binne die self.

  17. "Die beiteltjie" van N.P. van Wyk Louw en

    African Journals Online (AJOL)


    belangrike kenmerk van die postmodernisme is, wil ek dit nie tot abso- lute kenmerk verhef nie. Een van die .... oorgang vanaf 'n epistemologiese ingesteldheid tot 'n ontologiese ingesteldheid demonstreer en ..... the neglected and a whole range of phenomena which have been denied a history. Die formulering van die ...

  18. Kwantificatie van de invloed van regen op de verkeerdoorstroming

    NARCIS (Netherlands)

    Calvert, S.C.; Van Stralen, W.; Molin, E.J.E.


    Kwantificatie van de invloed van regen op de verkeerdoorstroming Het is bekend dat het weer invloed heeft op het verkeer op snelwegen, en in het bijzonder filevorming. Op de eerste plaats wordt de wegcapaciteit tijdelijk beïnvloed door een verandering in rijgedrag van bestuurders. Ten tweede

  19. Toepassing van de basisvrachtbenadering op fosfaat van compost; advies

    NARCIS (Netherlands)

    Ehlert, P.A.I.


    Bij het vormgeven van het stelsel van gebruiksnormen is een maatschappelijke discussie ontstaan over de aanvoer van fosfaat met grond in compost en zwarte grond. Deze deskstudie gaat in op vragen die hierbij gesteld zijn. Het aandeel grond in compost en zwarte grond en de hoeveelheid fosfaat daarin

  20. Beheersing van valse meeldauw in de akkerbouwmatige teelt van peterselie

    NARCIS (Netherlands)

    Mheen, van der H.J.C.J.; Lamers, J.G.


    In 2007 en 2008 heeft PPO-agv in opdracht van het Productwschap Akkerbouw onderzoek gedaan naar de beheersing van valse meeldauw in de akkerbouwmatige teelt van peterselie. Diverse fungicidentoepassingen zijn in staat om de peterselie (in meer of mindere mate) tegen valse meeldauw te beschermen.

  1. Die ontwikkeling van menslike potensiaal in die Republiek van Suid ...

    African Journals Online (AJOL)

    Erna Kinsey

    Dit het dus ook te doen met lewenstandaard, aangesien lewenstandaard `n bepalende faktor is met betrekking tot die optimale ontwikkeling van menslike potensiaal. Ander minder materiële aspekte van menslike potensiaal het te doen met menslike vryheid, waaronder vryheid van spraak, beweging en keuse ter sake is.

  2. De afschaffing van de bezwaarfase bij boetebesluiten van de ACM

    NARCIS (Netherlands)

    Jans, J.H.; Outhuijse, A.

    Per 1 maart 2013 ontstaat door samenvoeging van de NMa, de OPTA en de Consumentenautoriteit, de Autoriteit Consument en Markt. Om de ACM slagvaardig te laten functioneren, wordt voorgesteld het handhavingsinstrumentarium m.b.t. het markttoezicht van de ACM te vereenvoudigen. Eén van de voorstellen

  3. Invioed van de zuurtegraad van varkensurine op de ammoniakemissie

    NARCIS (Netherlands)

    Eizing, A.; Aarnink, A.J.A.


    Dit rapport beschrijft het effect van een lagere urine-pH op de ammoniakemissie in een varkensstal. Het onderzoek is uitgevoerd in een modelopstelling met de zogenaamde stalsimulator, waarbij de invloed van de urine-pH op de ammoniakemissie werd onderzocht. Hiervoor werd de urine van vleesvarkens op


    African Journals Online (AJOL)

    aanslag op die sogenaamde "Intentional Fallacy", heelwat verder. n. Mens sou hier eintlik ook op die invloed van Lacan se toepassing van. De Sacs sure op Freud moet wys, en op Macherey se Theory of Literary. Production. Barthes is naamlik besig om repressie teen te werk, en die teks as produksieproses in stede van ...

  5. 'n Voordrag van Adrianus van Seims oor hermeneutiek | Boshoff ...

    African Journals Online (AJOL)

    A lecture on hermeneutics by Adrianus van Seims This article is the content of a lecture on hermeneutics given by A van Seims. After a few opening words on the introduction to the lecture and its content, the presentation is reproduced in its entirety. Van Seims considers that hermeneutics is concerned not only with ...

  6. Implementatie van de Surviving Sepsis Campaign bundels : Monitoring van ervaringen

    NARCIS (Netherlands)

    Lilian Vloet; J. Schouten; N. Stevens; A. Rensen; A. Willems; F. Zeegers


    Sepsis komt vaak voor in ziekenhuizen. Ernstige sepsis is verantwoordelijk voor 10 - 20% van alle Intensive Care (IC) opnames en is de belangrijkste doodsoorzaak op niet-cardiale IC?s. De gemiddelde mortaliteit van volwassenen met ernstige sepsis op de IC is 33% en van volwassenen met septische

  7. Kwaliteitskosten door niet nuchter afleveren van vleesvarkens

    NARCIS (Netherlands)

    Huiskes, J.


    Voor het maken en verkopen van kwaliteitsham moet de vleeskwaliteit van het karkas na het slachten goed zijn. De vleesvarkenshouder speelt een belangrijke rol in het vormen van de juiste omstandigheden voor het verkrijgen van de gewenste vleeskwaliteit.

  8. Samenstelling van de vluchtige olie van Origanum vulgare L. ssp. vulgare gedurende de ontwikkeling van de plant

    NARCIS (Netherlands)

    Maarse, Henk


    INLEIDING EN DOEL VAN HET ONDERZOEK Vele onderzoekers hebben de laatste jaren de vorming van de verbindingen in vluchtige olien van planten bestudeerd door het bepalen van de verandering in de samenstelling van de vluchtige olie tijdens de groei van de plant. Lemli (68) wees als eerste op de

  9. Nederlands pensioenstelsel verre van af

    NARCIS (Netherlands)

    Boot, A.


    Het Nederlandse pensioenstelsel wordt verblijd met een nieuw type pensioeninstelling, de API (Algemene Pensioeninstelling). In optimale vrijheid moet deze kunnen functioneren met een toezichtregime dat aansluit op zowel dat van verzekeraars als dat van pensioenfondsen. Het pensioenstelsel is daarmee

  10. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock


    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at:

  11. Trump, NATO og den europæiske sikkerhedsarkitektur

    DEFF Research Database (Denmark)

    Ringsmose, Jens; Henriksen, Anders

    Manglende klarhed i den amerikanske linje over for det NATO, landet indtil nu har taget føringen i, vil få konsekvenser for Europa og for Danmarks muligheder og valg. Denne rapport ser på konsekvenserne for den europæiske sikkerhedsarkitektur....

  12. Vildsvin uønsket i den danske natur

    DEFF Research Database (Denmark)

    Andersen, Camilla Brasch; Bald, Caroline; Uttenthal, Åse


    Vildsvin ønskes fortsat ikke etableret i den danske natur, da de udgør en smitterisiko for husdyr og mennesker. det er helt essentielt for bekæmpelsen, at lodsejere og jægere deltager aktivt. de skal lokalisere de vildsvin, der allerede findes i den danske natur, og nedlægge dem....

  13. Empirisme, rationalisme og den moralske følelse

    DEFF Research Database (Denmark)

    Nielsen, Carsten Fogh


    Sammenlignende diskussion af David Humes og Immanuel Kants syn på følelsernes rolle for den moralske dom......Sammenlignende diskussion af David Humes og Immanuel Kants syn på følelsernes rolle for den moralske dom...

  14. Laika – den første hund i rummet

    DEFF Research Database (Denmark)

    Alstrup, Aage Kristian Olsen



  15. Synteserapport & 1. Indenrigspolitiske forhold i Den Islamiske Republik Iran

    DEFF Research Database (Denmark)

    Pedersen, Claus Valling

    Rapport til Udenrigsministeriet om de indenrigspolitiske forhold i Iran samt et syntese af hele rapporten: Iran som regional og international medspiller i den globale verdensorden samt Irans indenrigspolitik......Rapport til Udenrigsministeriet om de indenrigspolitiske forhold i Iran samt et syntese af hele rapporten: Iran som regional og international medspiller i den globale verdensorden samt Irans indenrigspolitik...

  16. Forårets konflikter godt for den danske model

    DEFF Research Database (Denmark)

    Scheuer, Steen


    Den store vinder ved forårets konflikter var den danske model for aftaler på arbejdsmarkedet. De offentlige fagforeninger fik sig en lærestreg, da regeringen og Folketinget til de flestes overraskelse lod de lovlige konflikter løbe i ugevis. For hermed tvang man parterne, og især forbundene, til...

  17. "Den lille havfrue" som digital pop op-bog

    DEFF Research Database (Denmark)

    Mygind, Sarah


    Anmeldelse af: DIGITAL POP OP-BOG H. C. ANDERSEN OG BOOKS & MAGIC DEN LILLE HAVFRUE Bog og App til iOS & Android 5......Anmeldelse af: DIGITAL POP OP-BOG H. C. ANDERSEN OG BOOKS & MAGIC DEN LILLE HAVFRUE Bog og App til iOS & Android 5...

  18. Nye militære trends i den syriske borgerkrig

    DEFF Research Database (Denmark)

    Engen, Torben Toftgaard; Kjellund, Jon


    I den flerårige syriske borgerkrig har der fundet tre nye militære trends sted, der peger imod, at fremtidens landmilitære kampplads vil være væsensforskellig fra indsatserne i Irak og Afghanistan. Denne rapport analyserer de tre trends inden for digitaliseringen af den hybride krigsførelse og ka...

  19. Samarbejdets betydning i den ’klassiske udlicitering’

    DEFF Research Database (Denmark)

    Lindholst, Andrej Christian


    Hvilken betydning har ’samarbejde’ i kontraktstyringen mellem offentlige myndigheder og private entreprenører inden for de ’klassiske’ udbudsområder? I både den administrative praksis og den politologiske litteratur betragtes en effektiv anvendelse af udlicitering på de klassiske udbudsområder of...

  20. Maatskaplike aspekte van geriatriese sorg

    Directory of Open Access Journals (Sweden)

    D. Louw


    Full Text Available Dit is maar enkele dekades gelede dat Westerse gemeenskappe bewus geword het van die besondere behoeftes van die relatief groot en nog steeds groeiende persentasie bejaardes in hulle midde. Nie alleen het die liggaamlike behoeftes van liggaamlike afgetakelde bejaardes die aandag getrek nie maar die gemeenskappe het ook bewus geword van die maatskaplike behoeftes van ouerwordendes in ’n tydperk wat gekenmerk is deur die dramatiese veranderings in die lewenswyses van ons mense — veranderinge wat in baie opsigte ’n negatiewe invloed gehad het op die lewensomstandighede van ’n groot groep bejaardes. Welsynsbeplanners het besef dat hulle in hulle beplanning spesiale voorsiening moes maak vir die lewensbehoeftes van hierdie groep in die gemeenskap en dat hulle in die verband ’n groot agterstand het om in te haal. Geneeshere wat belang begin stel het in die gesondheidsbehoeftes van bejaardes het ook besef dat gevestigde geneeskundige praktyke geensins voldoen aan die spesifieke behoeftes van ’n groot groep bejaardes nie en dat groot aanpassings gemaak moes word met betrekking tot hulle benaderings en metodes van behandeling van hierdie pasiente.

  1. Effect van Moddus op graszaad

    NARCIS (Netherlands)

    Borm, G.E.L.


    Het onderzoek was de eerste jaren gericht op het verkrijgen van een brede toelating van de groeiregulator Moddus in graszaadgewassen en in de laatste jaren op het optimaliseren van de toepassing hiervan. Moddus kan goed worden ingezet in graszaadgewassen, maar het optimale toepassingtijdstip is

  2. Energie- en eiwitbehoefte van schapen

    NARCIS (Netherlands)

    Sebek, L.B.J.; Gosselink, J.M.J.


    In 2004 is een literatuuronderzoek uitgevoerd om een betere onderbouwing en eventuele aanpassing van de behoeftenormen voor schapen mogelijk te maken. Op basis van deze literatuurstudie is aanpassing van de normen mogelijk. Het rapport levert echter geen ‘kant-en-klare’ voedernormen voor schapen,

  3. Implementatie van EU-handhavingsvoorschriften

    NARCIS (Netherlands)

    Adriaanse, P.C.; Barkhuysen, T.; Boswijk, P.; Habib, K.; Kruif, C. de; Luchtman, M.J.J.P.; Ouden, W. den; Prechal, A.; Steunenberg, B.; Vervaele, J.A.E.; Voermans, W.J.M.; Vries, S.A. de; Widdershoven, R.J.G.M.


    Na een verkennend onderzoek op twaalf beleidsterreinen naar aard, wijze en variatie van de EU/EG-beïnvloeding van nationale handhaving, zijn aan de hand van ‘beïnvloedingsscores’ acht beleidsterreinen geselecteerd voor nadere analyse. In het onderzoek staan de volgende vragen centraal:Hoe is de

  4. Van wie zijn zij? De ambtenaren

    NARCIS (Netherlands)

    Peters, Jit


    Aan de hand van actuele voorbeelden gaat Jit Peters tijdens zijn afscheidscollege in op de toegenomen macht van ambtenaren. De loyaliteit van de ambtenaar is volgens hem nu te veel gericht op het ondersteunen van de eigen minister. Als tegenwichten van de macht van de ambtenaar staat Peters stil bij

  5. Van de leestafel

    NARCIS (Netherlands)

    Hedrén, M.


    Door middel van allo-enzymstudies toont de Zweedse auteur aan dat D. praetermissa een permanente tetraploide hybride is die is ontstaan uit D. incarnata en D. maculata/ fuchsii, een resultaat dat eerdere studies gebaseerd op morfologische eigenschappen ondersteunt. Daarnaast noemt de auteur het

  6. Pythagoras Meets Van Hiele. (United States)

    Flores, Alfinio


    Develops the Pythagorean Theorem in the context of the Van Hiele levels by presenting activities appropriate for each level. Activities point to preparatory development (level 0), give 3 different versions of Euclid's proof (levels 1, 2, and 3), give some generalizations of the theorem (level 3), and explore the Pythagorean relationship in other…

  7. Beheersing van het Schmallenbergvirus

    NARCIS (Netherlands)

    Poel, van der W.H.M.


    Schmallenbergvirus (SVB) werd in 2011 voor het eerst in Europa gezien en veroorzaakte een epidemie van aangeboren afwijkingen, vooral misvormde ledematen en hersenafwijkingen, bij kalveren en lammeren. Het ging om een niet eerder gevonden virus, dat om die reden aanvankelijk moeilijk onderkend kon

  8. Van Bahrein tot Bitcoin

    NARCIS (Netherlands)

    Lodder, A.R.


    Door het internet kan de burger rechtstreeks contact krijgen met zijn publiek zonder hulp van derden als omroepen, kranten, uitgevers, muziekindustrie, etc. Bij al deze communicaties is prominent (Youtube) of minder prominent (Wordpress) een derde partij betrokken die de communicatie faciliteert.

  9. Van Gogh's Sunflowers (United States)

    Daddino, Michelle


    In this article, the author describes an art project wherein kindergarten students painted sunflowers. These beautiful and colorful sunflowers were inspired by the book "Camille and the Sunflowers" by Laurence Anholt, which does an amazing job of introducing young children to the art and life of Vincent van Gogh.

  10. Het importeren van honingbijen

    NARCIS (Netherlands)

    Cornelissen, B.


    Er wordt in de wereld volop gehandeld in bijen en bijenproducten. De globalisering is niet aan de bijenteelt voorbij gegaan. Producten als honing en propolis, maar ook raszuivere koninginnen worden over heel de wereld gemaakt en verspreid. Met deze wereldwijde verplaatsing van bijen kunnen ook

  11. Najaarsteelt van leeuwebek (Antirrhinum)

    NARCIS (Netherlands)

    Krogt, van der T.M.


    Een sortiment handelsrassen dat ook in de voorjaarsteelt gebruikt wordt, is getoetst op de gebruiksmogelijkheden in het najaar. Met enkele kultivars is een temperatuurproef gedaan. In de twee daaropvolgende jaren is een gekombineerde zaaitijden-rassenproef genomen, waarbij gebruik werd gemaakt van

  12. Bacteriologisch Onderzoek van slachtdieren

    NARCIS (Netherlands)

    Engel HWB; van Leusden FM; Erne EHW


    Door zes vleeskeuringsdiensten en het RIVM werd gezamenlijk onderzoek verricht naar het in de Vleeskeuringswet omschreven "Bacteriologisch Onderzoek" (BO) bij slachtdieren. Doel was na te gaan of er verschillen zouden zijn in de aantallen positieve resultaten van het BO tussen de diensten

  13. Kalibemesting van zetmeelaardappelen

    NARCIS (Netherlands)

    Wijnholds, K.H.


    Het is bekend dat kali een grote invloed kan hebben op het OWG en het uitbetalingsgewicht. Bij een stikstofgift die op het ras is afgestemd, is het effect van een hogere kaligift op het uitbetalingsgewicht bij de oogst echter vrij gering. Na bewaring is er een lichte trend aanwezig dat een hogere

  14. [Identification of Dens Draconis and Os Draconis by XRD method]. (United States)

    Chen, Guang-Yun; Wu, Qi-Nan; Shen, Bei; Chen, Rong


    To establish an XRD method for evaluating the quality of Os Draconis and Dens Draconis and applying in judgement of the counterfeit. Dens Draconis, Os Draconis and the counterfeit of Os Draconis were analyzed by XRD. Their diffraction patterns were clustered analysis and evaluated their similarity degree. Established the analytical method of Dens Draconis and Os Draconis basing the features fingerprint information of the 10 common peaks by XRD pattern. Obtained the XRD pattern of the counterfeit of Os Draconis. The similarity degree of separate sources of Dens Draconis was high,while the similarity degree of separate sources of Os Draconis was significant different from each other. This method can be used for identification and evaluation of Os Draconis and Dens Draconis. It also can be used for identification the counterfeit of Os Draconis effectively.

  15. Kosmetisk kirurgi og den transformérbare krop -en analyse af den amerikanske tv-serie Nip/Tuck

    DEFF Research Database (Denmark)

    Jerslev, Anne


    En analyse af krops- og kønsiscenesættelser i den amerikanske tv-serie om kosmetisk kirurgi Nip/Tuck......En analyse af krops- og kønsiscenesættelser i den amerikanske tv-serie om kosmetisk kirurgi Nip/Tuck...

  16. Beoordeling van het gedrag van bestrijdingsmiddelen in de verzadigde zone van de bodem

    NARCIS (Netherlands)

    Linden, van der A.M.A.; Beek, van C.G.E.M.; Boesten, J.J.T.I.; Leistra, M.; Meinardi, C.R.; Puijker, L.M.


    In het MeerJarenPlan-Gewasbescherming van 1991 is de mogelijkheid gegeven om door middel van onderzoek in de verzadigde fase van de bodem aan te tonen dat bestrijdingsmiddelen, die kunnen uitspoelen naar de verzadigde zone, alsnog voor toelating in aanmerking kunnen komen als de omzettingssnelheid

  17. Beoordeling van het gedrag van bestrijdingsmiddelen in de verzadigde zone van de bodem

    NARCIS (Netherlands)

    Linden AMA van der; Beek CGEM van; Boesten JJTI; Leistra M; Meinardi CR; Puijker LM; LBG


    In het MeerJarenPlan-Gewasbescherming van 1991 is de mogelijkheid gegeven om door middel van onderzoek in de verzadigde fase van de bodem aan te tonen dat bestrijdingsmiddelen, die kunnen uitspoelen naar de verzadigde zone, alsnog voor toelating in aanmerking kunnen komen als de

  18. Databank van de lithografische opbouw en morfologische ontwikkeling van de uiterwaarden van de Midden-Waal

    NARCIS (Netherlands)

    Hebinck, K.A.


    In de uiterwaarden zijn de komende decennia veel ingrepen gepland. Een goede kennis van de sedimentatiedynamiek en morfologische ontwikkeling van de uiterwaarden is daarbij een vereiste. Daartoe is een digitale databank (op CD bij dit rapport) opgesteld van de opbouw en geomorfologische ontwikkeling

  19. Fluorescentievingerafdruk van Aardappel, Melganzenvoet en Mais : Eerste resultaten van plantonderscheid met behulp van fluorescentie

    NARCIS (Netherlands)

    Groot, T.T.; Nieuwenhuizen, A.T.


    Als het spectrum van één “soort” (gewas) vergeleken wordt met de rest (onkruid) neemt het onderscheid van het “gewas” af tot 70%. Het lijkt dus nodig ook de spectra van alle soorten onkruid in het veld te kennen om een goed onderscheid mogelijk te maken. De doelstelling voor deze metingen is een

  20. Die nabyheid van die Koninkryk

    Directory of Open Access Journals (Sweden)

    W.J. Snyman


    Full Text Available Vanweë die belangrikheid daarvan volg hier ’n breër bespreking van die proefskrif van dr. Tjaart van der Walt oor die nabyheid van die Koninkryk as wat in ’n gewone resensie kan geskied. Die vraagstuk wat onder oë gesien word is so oud as die kerk en die teologie, soms minder en soms meer op die voorgrond. Tans kan gesê word, staan dit in die middelpunt. Daarby is dit nie maar ’n akademiese vraagstuk nie, maar ’n vraagstuk waarvoor elke nadenkende leser van die Skrif te staan kom.

  1. Afbouw van het Wsw-bestand: actualisatie op basis van Wsw-gegevens ultimo 2013

    NARCIS (Netherlands)

    Berden, C.; Tempelman, C.


    In opdracht van het ministerie van Sociale Zaken en Werkgelegenheid heeft SEO Economisch Onderzoek onderzoek gedaan naar de verdeling van het Participatiebudget over gemeenten. Een onderdeel van dit onderzoek vormde het voorspellen van de afbouw van het huidige zittend bestand in de Wsw op basis van

  2. Invloed van minerale olie op de bestrijding van Phytophthora infestans in pootaardappelen

    NARCIS (Netherlands)

    Spits, H.G.; Bus, C.B.


    De invloed van toevoeging van olie aan een fungicide op de werking van het fungicide is afhankelijk van het gebruikte fungicide. Gezamenlijk spuiten van olie en Aviso DF, Curzate M en mogelijk ook Acrobat, verhoogt de curatieve werking van deze fungiciden. Gezamenlijk spuiten van olie en Aviso DF,

  3. Pengaruh Perbedaan Kelas Umur terhadap Produktivitas Getah Pinus merkusii Jungh et de Vriese Ras Lahan Jawa melalui Penyadapan Getah Metode Bor

    Directory of Open Access Journals (Sweden)

    Agus Sukarno


    Full Text Available Pinus merkusii Jungh et de Vriese merupakan tanaman asli Indonesia, yang sebaran alaminya di Aceh, Tapanuli dan Kerinci. Penyadapan getah dengan metode bor pada kelas umur yang berbeda belum pernah dilakukan. Tujuan penelitian untuk mengetahui perbedaan produksi getah pinus di antara  kelas umur. Penelitian dilakukan di RPH Oro-oro Ombo, BKPH Pujon, KPH Malang pada tanaman pinus kelas umur III, IV,  V  dan VI  dengan ketinggian tempat antara 1.100 m –1.250 m dari permukaan air laut.  Waktu penelitian bulan September sampai dengan Nopember 2010.  Jumlah pohon yang disadap di setiap kelas umur sebanyak 150 - 160 pohon dengan dua lubang per pohon.  Penyadapan getah menggunakan bor mesin, kantong plastik tahan minyak diikatkan pada ujung pipa untuk menampung getah.  Pemungutan getah dilakukan sehari setelah penyadapan. Analisis  data  menggunakan  one way anova, apabila terdapat perbedaan yang nyata,  dilakukan uji lanjut dengan orthogonal polynomial. Produksi getah di antara kelas umur, menunjukkan perbedaan yang nyata. Produksi getah kelas umur III (36,5 g/ 2 lubang/1 hari meningkat pada kelas umur IV (62,9 g/2 lubang/1 hari dan menurun pada kelas umur V  (24,61 g/2 lubang/1 hari.  Produksi getah pada kelas umur VI (38,3 g/ 2 lubang/1 hari hampir sama dengan kelas umur III. Hasil uji lanjut orthogonal polynomial  menunjukkan respons  bersifat kuadratik (p=0,09 antara produksi getah dengan kelas umur. Kata Kunci: Pinus, kelas umur, getah, metode bor

  4. Die identifisering van maatstawwe vir die navorsingsprestasie van akademici

    Directory of Open Access Journals (Sweden)

    H. A. Labuschagne


    Full Text Available Identification of criteria for academic research performance. At South African universities, the achievement of objectives is usually measured in terms of so-called "process criteria" (e.g. pass rates, instead of performance criteria which reflect the quality of academic personnel. Stimulated by the need to identify valid indices of research performance, as a component of academic performance, this study investigated the dimensionality of several criteria, identified from empirical and literature studies. It was found that various valid criteria could be represented by six constructs, viz.: the stature of the researcher as scientist; scientific contributions; enhancement of own profession; community development; participation in research projects; and giving advice to persons or institutions outside the university. Opsomming By Suid-Afrikaanse universiteite word doelwitbereiking gewoonlik aan die hand van sogenaamde "prosesmaat-stawwe" (bv. slaagsyfers in plaas van prestasiemaatstawwe wat die gehalte van akademiese personeel weerspieel, gemeet. Na aanleiding van 'n behoefte aan die identifisering van geldige rigtingwysers vir navorsingsprestasie as 'n komponent van akademiese prestasie, is daar ondersoek ingestel na die dimensionaliteit van verskillende maatstawwe wat vooraf deur middel van empiriese- en literatuurstudies geidentifiseer is. Daar is gevind dat verskeie geldige maatstawwe deur ses konstrukte verteenwoordig word, te wete: die statuur van die navorser as wetenskaplike, wetenskaplike bydraes, uitbouing van eie professie, gemeenskapsontwikkeling, deelname aan navorsingsprojekte en advieslewering aan persone of instellings buite die Universiteit.

  5. Die gebruik van parallelplaatreologie vir die bepaling van die intrinsieke viskositeit van poli-etileentereftalaat

    Directory of Open Access Journals (Sweden)

    O. C. Vorster


    Full Text Available Die bepaling van die intrinsieke viskositeit van poli-etileentereftalaat word bemoeilik deur die feit dat daar tans slegs twee metodes in gebruik is. In die eerste metode word die bepaling deur middel van oplossingsviskometrie gedoen, maar die toksisiteit van die oplosmiddel, asook die tydperk wat dit neem om die bepaling te doen, is ’n probleem. Die tweede metode word beperk deur die kompleksiteit en beskikbaarheid van die apparatuur in Suid-Afrika. In hierdie studie word ’n alternatiewe metode, gebaseer op parallelplaatreologie, voorgestel wat albei hierdie probleme oorkom en die resultate sodoende verkry, word vergelyk met dié wat met bestaande metodes verkry is.

  6. Ellis-van Creveld

    Directory of Open Access Journals (Sweden)

    Dhandabani Jayaraj


    Full Text Available Ellis-van Creveld (EVC syndrome is an autosomal recessive disorder that is also known as chondro-ectodermal dysplasia. The common manifestations of this syndrome are short ribs, postaxial polydactyly, growth retardation, and ectodermal and cardiac defects. The present case report is about an 8-year-old boy who had the features of bilateral hexadactyly, knocked knees, cardiac problems, congenital absence of incisors, fused upper and lower labial frenulum, and mulberry molars.

  7. Leren van ver weg

    NARCIS (Netherlands)

    Switzer, Andrew


    Van de week kreeg ik in mijn klushuis in de Bijlmer bezoek over de vloer: een onderzoekster uit het verre São Paulo die samen met collega’s aan een project over zel ouw werkt. Wie aan zel ouw in Brazilië denkt, komt al snel uit op de favela’s en het valt te betwijfelen of er vraag is naar dit soort

  8. Endodontic, surgical and periodontal treatment of dens invaginatus. Case report. (United States)

    Castellarin, M; Demitri, V; Politi, M


    The aim of this paper is to propose a single stage global treatment of endodontic, periapical and periodontal lesions in a lateral maxillary incisor with dens invaginatus. A 24 year-old woman presenting a lateral maxillary incisor with dens invaginatus in association with periapica1 and periodontal lesions underwent simultaneous surgical, endodontic and periodontal regenerative procedures. At 2, 6, 12, 18 months follow-up the radiographic healing appeared to be improved and the periapical lesion healed completely 1 year after surgical intervention. Surgery in association with endodontic and periodontal procedures represents the treatment of choice to maximize long term prognosis in cases of dens invaginatus with chronic periapical and periodontal lesions.

  9. Distribución y abundancia anual de Ceratium dens (Peridinales: Ceratiaceae en el golfo de California, México

    Directory of Open Access Journals (Sweden)

    Roberto Cortés Altamirano


    Full Text Available La distribución de Ceratium dens en el Golfo de California se baso en tres campañas oceanográficas, su abundancia mensual (1995-96 en la Bahía de Mazatlán, y en tres fenómenos de mareas rojas presentadas en esta misma área. Se analizaron 52 muestras de fitoplancton recolectadas con red bongo con luz de malla de 64 µm y 120 muestras de agua con botella van Dorn en dos estaciones de recolecta y de tres eventos de marea roja en la Bahía de Mazatlán. Todas las muestras fueron contadas por el método del microscopio invertido. Los resultados indican que C. dens está presente en la región alta del Golfo de California y alrededor de Cabo San Lucas. En el ciclo 1995-96 la variación en la Bahía mostró dos períodos de máxima abundancia en primavera y otoño. Las abundancias presentaron una gran variación, en mar abierto fueron de 1-14 céls. l-1, en zonas costeras de 20-360 céls. l-1, y durante periodos de marea roja en 1985, 1989 y 1997 sus abundancias extremas fueron 144 000-256 000 céls. l-1, 100 000-400 000 céls. l-1 y 189 000-592 000 céls. l-1, respectivamente. Durante la marea roja, C. dens varía grandemente, a veces sustituida por Skeletonema costatum o Pseudonitzchia spp y Ceratium furca.. C. dens, aparenta tener una afinidad por los ambientes de alta productividad.Ceratium dens distribution in the Gulf of California was based on three oceanographic campaigns, monthly abundance (1995-96 and during three red tide events in Mazatlán Bay. 52 phytoplankton samples with a Bongo net and 64 µm mesh light, during the year 120 water samples with a van Dorn bottle were collected in two sampling stations and from three red tide events. All samples were counted by the inverted-microscope method. The results showed that C. dens was present in the upper Gulf of California and surroundings of Cabo San Lucas. Two peaks were observed during spring and autumn in Mazatlán Bay during 1995-1996. The highest densities (20-360 cells. . l-1 were

  10. Injury biomechanics of C2 dens fractures. (United States)

    Yoganandan, Narayan; Pintar, Frank; Baisden, Jamie; Gennarelli, Thomas; Maiman, Dennis


    The objective of this study is to analyze the biomechanics of dens fractures of the second cervical vertebra in the adult population due to motor vehicle crashes. Case-by-case records from the Crash Injury Research and Engineering Network (CIREN) and National Automotive Sampling System (NASS) databases were used. Variables such as change in velocity, impact direction and body habitus were extracted. Results indicated that similarities exist in the two databases despite differences in sampling methods between the two sources (e.g., CIREN is not population based). Trauma is predominantly associated with the frontal mode of impact. Majority of injuries occur with change in velocities below current federal guideline thresholds. No specific bias exists with respect to variables such as age, height, weight, and gender. Because similar conclusions can be drawn with regard to vehicle model years, design changes during these years may have had little effect on this injury. To ameliorate trauma, emphasis should be placed on the frontal impact mode and entire adult population. Because of clinical implications in the fracture type (II being most critical) and lack of specific coding, CIREN data demonstrates the need to improve injury coding in the AIS and application in the NASS to enhance occupant safety and treatment in the field of automotive medicine.

  11. Radiomontagen og dens radiofoniske rødder. Om hørebilledet, den litterære tekstmontage, featuren og den moderne radiomontage

    Directory of Open Access Journals (Sweden)

    Ib Poulsen


    Full Text Available Radiomontagen og dens genrevarianter, hørebilledet og featuren har tidligere har tidligere været genstand for interesse fra især den æste- tiske og tekstanalytisk orienterede radioforskning. I denne artikel sæt- tes genren ind i en bredere kontekst, sociokulturelt og medie- og insti- tutionshistorisk. Ledetrådene i den diakrone fremstilling er dels spørgs- målet om genrens historiske og genremæssige rødder, dels en kombi- neret tekstanalytisk og receptionsæstetisk tilgang, der søger at ind- kredse de positioneringer af lytteren, radiomontagen og dens varianter tilbyder. Artiklen er baseret på grundige arkivstudier i DR og på inter- views med nogle af de ’montører’, som har bidraget til udviklingen af montagen, der i kraft af sin radiofoniske spændvidde mest vedholdende og varieret har forsøgt at udforske menneskets livssituation i den moder- ne verden, samtidig med at lytteren er blevet tilbudt en lytteposition, der prioriterer refleksion og eftertanke.

  12. Onderzoek naar de effecten van snoezelen op het gedrag van demente verpleeghuisbewoners en de werkbeleving van verzorgenden.

    NARCIS (Netherlands)

    Weert, J. van; Peter, J.; Dulmen, S. van; Ribbe, M.; Bensing, J.


    Het effect van snoezelen in de 24-uurszorg op de stemming en het gedrag van demente ouderen is nooit eerder onderzocht. Ook is in geen van de eerdere studies het effect onderzocht van snoezelen op de werkbeleving van verzorgenden. Uit onderzoek is bekend dat in verpleeghuizen waar geen

  13. Rituele van plesier: Dolf van Coller se Die Bieliebalies

    Directory of Open Access Journals (Sweden)

    J. van Wyk


    Full Text Available Rituals of pleasure: Dolf van Coller’s Die Bieliebalies This article is an analysis of Dolf van Coller's Die Bieliebalies (1993, read as a hedonist text. It has many points of similarity with what Bakhtin (1984 called grotesque realism, and with Nietzsche’s views as expounded in The birth of tragedy (1956. By comparing Van Caller's text to that of Bakhtin and Nietzsche, a counter-discourse to contemporary moral discourses such as feminism is explored. Van Coller’s use of laughter as a relativising mechanism is very liberating in the context where petty morality intervenes dogmatically in the field of literature and other spheres of life.

  14. Vidensledelse og den sociale dimension i deling af viden

    DEFF Research Database (Denmark)

    Lauring, Jakob


    imidlertid et alternativt syn på viden som i højere grad inddrager den sociale dimension ved vidensdeling - den socialkonstruktivistiske opfattelse. I denne artikel vil jeg beskæftige mig med den socialkonstruktivistiske opfattelse af viden og beskrive, hvorledes denne synsvinkel kan rette fokus mod nogle...... meget væsentlige problemstillinger ved organisatorisk adfærd, som man ofte kommer til at ignorere, hvis man i for høj grad baserer ledelsen på en funktionalistisk opfattelse af viden. Delingen af viden er en aktuel udfordring for anvendelse af viden i forretningssammenhæng. Det er hovedsageligt det, som...... gør vidensbegrebet interessant i forhold til ledelse af virksomheder. - Fokus på de sociale barrierer for deling af viden Jeg vil i det kommende illustrere, hvilke betydninger den sociale dimension i deling af viden kan have for videnledelse. Det vil jeg gøre gennem beskrivelser af to forskellige...

  15. Plug-welding of ODS cladding tube for BOR-60 irradiation. Welding condition setting. Device remodeling and welding

    International Nuclear Information System (INIS)

    Seki, Masayuki; Ishibashi, Fujio; Kono, Syusaku; Hirako, Kazuhito; Tsukada, Tatsuya


    Irradiation test in BOR-60 at RIAR to judge practical use prospect of ODS cladding tube at early stage is planned as Japan-Russia a joint research. RIAR does fuel design of fuel pin used for this joint research. JNC manufactures ODS cladding tube and bar materials (two steel kind of martensite and ferrite), upper endplug production. They are welded by pressurized resistance welding, and are inspected in JNC Tokai, transported to RIAR. And RIAR manufactures vibration packing fuel pin. On the upper endplug welding by pressurized resistance welding method, we worded on the problems such as decision of welding condition by changing the size and crystallization of cladding tube and the design of endplug, and the chucking device remodeling to correspond to the long scale cladding tube welding system (included handling) and of quality assurance method. Especially, use of long scale cladding tube caused problem that bending transformation occurred in cladding tube by welding pressure. However, we solved this problem by shortening the distance of cladding tube colette chuck and pressure receiving, and by putting the sleeve in an internal space of welding machine, losing the bending of cladding tube. Moreover, welding defects were occurred by the difference of an inside state, an inside defect and recrystallization of cladding tube. We solved the problem by inside grinding for the edge of tube, angle beam method by ultrasonic wave, and ultrasonic wave form confirmation. Manufacturing process with long scale cladding tube including heat-treatment to remove combustion return and remaining stress was established besides, Afterwards, welding of ODS cladding tube and upper endplug. As the quality assurance system, we constructed [Documented procedure (referred to JOYO)] based on [Document of the QA plan] by OEC. Welding and inspection were executed by the document procedure. It is thought that the quality assurance method become references for the irradiation test in JOYO in the

  16. Toepassing van finite difference- en finite element methoden voor het oplossen van een aantal stationaire grondwaterstromingsproblemen

    NARCIS (Netherlands)

    Wesseling, J.G.


    In dit verslag worden de oplossingsmethoden met de bijbehorende zelfontwikkelde FORTRAN computerprogramma's van de volgende stationaire grondwaterstromingsgevallen gegeven: - Analyse van de grondwaterstroming in een horizontaal vlak over een gedeelte van de Astense Aa, waar van plaats tot plaats

  17. Advies voor de toepassing van ground-penetrating radar bij de inventarisatie van de grondwaterdynamiek

    NARCIS (Netherlands)

    Knotters, M.


    Ground-penetrating radar (GPR) biedt mogelijk een nauwkeurig alternatief voor arbeidsintensieve metingen van de grondwaterstand in boorgaten. De GPR-metingen kunnen als hulpinformatie dienen bij geostatistische interpolatie van grondwaterstanden. Op basis van literatuurstudie en verkenning van het

  18. Bepaling van enkele neurotransmitters, monoaminen, en metabolieten, met behulp van Continuous Flowapparatuur

    NARCIS (Netherlands)

    Eigeman L; Schonewille F; Borst M; van der Laan JW


    Bij het onderzoek in de psychofarmacologie kan kennis van de effecten van stoffen op de omzettingssnelheid van neurotransmitters een belangrijk aspect zijn. Met de huidige psychofarmaca lijken vooral de klassieke neurotransmitters zoals de monoaminen, noradrenaline, dopamine en serotonine van

  19. Kansen voor conflictbemiddeling : Verslag van een onderzoek naar de toepassingsmogelijkheden van conflictbemiddeling

    NARCIS (Netherlands)

    Geveke, Henk; Plant, Ernelies; Thieme, Marianneke; Verberk, Marielle


    In opdracht van het Platform ADR, een klankbordgroep en denktank op het gebied van alternatieve geschilbeslechting, is onderzoek verricht naar de toepasbaarheid van een specifieke vorm van Alternative Dispute Resolution (ADR): conflictbemiddeling (mediation). De onderzoeksopdracht was als volgt: het

  20. Chloroplast DNA haplotype samenstelling van eikenopstanden (categorie "van bekende origine") van de Rassenlijst van Bomen; een aanvullende methode voor identificatie van autochtoniteit

    NARCIS (Netherlands)

    Buiteveld, J.; Boerwinkel, M.C.; Bovenschen, J.; Kranenborg, K.G.; Vries, de S.M.G.


    Tegenwoordig kan autochtoon materiaal op de Rassenlijst van Bomen geplaatst worden in de categorie `van bekende origine¿ en heeft daardoor een `officiële¿ status. Identificatie van autochtone opstanden blijft echter nog een lastige zaak. Momenteel worden autochtone opstanden geïdentificeerd met de

  1. Uddrag af Ph.d.-afhandlingen Den groteske modernisme

    DEFF Research Database (Denmark)

    Lübker, Henrik


    Om forholdet mellem "det groteske" og "den groteske modernisme" eksemplificeret i en læsning af E.A. Poes "The Fall of the House of Usher" og flere af Francis Bacons malerier.......Om forholdet mellem "det groteske" og "den groteske modernisme" eksemplificeret i en læsning af E.A. Poes "The Fall of the House of Usher" og flere af Francis Bacons malerier....

  2. CIOs mangler fundamentale egenskaber for at lede den digitale transformation

    DEFF Research Database (Denmark)

    Bjørn-Andersen, Niels


    CIOs er dårligt rustet til at gå i spidsen for digital disruption og innovation, advarer den internationale topforsker Joe Peppard med afsæt i analyse af mere end 200 CIO-s personligheder......CIOs er dårligt rustet til at gå i spidsen for digital disruption og innovation, advarer den internationale topforsker Joe Peppard med afsæt i analyse af mere end 200 CIO-s personligheder...

  3. Malaysia. Kan den politiske fred fortsætte?

    DEFF Research Database (Denmark)

    Fleming, Daniel; Søborg, Henrik


    Der er valg i det muslimske Malaysia den 8. marts 2008. Et land med klar etnisk opdeling, men også med stor politisk stabilitet. Hvordan hænger det sammen?......Der er valg i det muslimske Malaysia den 8. marts 2008. Et land med klar etnisk opdeling, men også med stor politisk stabilitet. Hvordan hænger det sammen?...

  4. Den danske stat og det naturlige fædreland

    DEFF Research Database (Denmark)

    Glenthøj, Rasmus


    forsøgte på engang at være loyale over for både det statsborgerlige fædreland, der inkluderede hele den danske stat, og deres naturlige fædreland Norge, som de følte sig forbundet til gennem deres nationalitet og opvækst. Danskerne opererede med den samme dualistiske fædrelandsopfattelse, hvor de både...

  5. Den europæiske sukkersektor - efter reformerne

    DEFF Research Database (Denmark)

    Hansen, Henning Otte


    Med reformerne af EU’s sukkerpolitik ændredes vilkårene for hele den europæiske sukkersektor. Resultatet ses nu i form af stærkere struktur- og produktivitetsudvikling og dermed en stigende international konkurrenceevne.......Med reformerne af EU’s sukkerpolitik ændredes vilkårene for hele den europæiske sukkersektor. Resultatet ses nu i form af stærkere struktur- og produktivitetsudvikling og dermed en stigende international konkurrenceevne....

  6. Analysis of copper losses throughout weak acid effluent flows generated during off-gas treatment in the New Copper Smelter RTB Bor

    Directory of Open Access Journals (Sweden)

    Dragana Ivšić-Bajčeta


    Full Text Available The previous inadequate treatment of off-gas in RTB Bor in Serbia has resulted in serious pollution of the environment and the possibly high losses of copper through the effluent flows. The project of New Copper Smelter RTB Bor, besides the new flash smelting furnace (FSF and the reconstruction of Pierce-Smith converter (PSC, includes more effective effluent treatment. Paper presents an analysis of the new FSF and PSC off-gas treatment, determination of copper losses throughout generated wastewaters and discussion of its possible valorization. Assumptions about the solubility of metals phases present in the FSF and PSC off-gas, obtained by the treatment process simulation, were compared with the leaching results of flue dusts. Determined wastewaters characteristics indicate that the PSC flow is significantly richer in copper, mostly present in insoluble metallic/sulfide form, while the FSF flow has low concentration of copper in the form of completely soluble oxide/sulfate. The possible scenario for the copper valorization, considering arsenic and lead as limiting factors, is the separation of the FSF and PSC flows, return of the metallic/sulfide solid phase to the smelting process and recovery from the sulfate/oxide liquid phase.

  7. Bepaling van 14C in afvalwater

    NARCIS (Netherlands)

    Hiemstra YS; Kwakman PJM; Nissan LN; Aldenkamp FJ; LSO


    In opdracht van de Hoofdinspectie Milieuhygiene van het ministerie van VROM heeft LSO een methode ontwikkeld om 14C in afvalwater van nucleaire installaties te bepalen. De methode meet organisch gebonden-14C en anorganisch-14C in de vorm van carbonaat (14CO32-) in afvalwater. Het rapport

  8. De syntaxis van de Italiaanse preposities

    NARCIS (Netherlands)

    Boer, M.G. de


    SAMENVATTING In dit hoofdstuk wordt een inventaris opgesteld van de Italiaanse preposities die voorkomen in een corpus bestaande uit de romans La Ciociara van Moravia en Il Gattopardo van Tomasi di Lampedusa. Achtergrond voor de herkenning van preposities is de Extended Standard Theory van de

  9. Hoge resolutie typering van Coxiella burnetii

    NARCIS (Netherlands)

    Janse, I.; Bossers, A.; Roest, H.I.J.; Rotterdam, van B.


    Dit rapport beschrijft het onderzoek wat uitgevoerd is in het kader van het project ‘Hoge Resolutie Typering Coxiella burnetii’’. Het doel van dit project was om de genoomsequenties van een aantal Nederlandse isolaten van de bacterie Coxiella burnetii, de veroorzaker van Q-koorts, in kaart te

  10. Studentopinie als onderdeel van Cursuskwaliteit : Quickscan

    NARCIS (Netherlands)

    Elzinga, Hanny; Groenewoud, Jan; Ike, Paul; Loth, Betram; Reitsma, Sieuwke; Schotanus, Janke; Schuurman, Mieke; Steur, Jessica


    In het kader van dit onderzoek is een quickscan (15 vragen) opgesteld met als doel die informatie te verzamelen die nodig is om een eerste indicatie te krijgen van de kwaliteit van een cursus (vak). De quickscan is gebaseerd op literatuuronderzoek en best practices van de faculteiten van de

  11. Effectiviteit van markting management support systemen


    Bruggen, Gerrit; Smidts, Ale; Wierenga, Berend


    textabstractVerhoogt het gebruik van marketing management support systemen de kwaliteit van marketingbeslissingen? En zo ja, onder welke omstandigheden? Aan de hand van een experimenteel laboratoriumonderzoek met het simulatiespel MARKSTRATonder 80 marketing managers en 160 studenten, kan de eerste vraag positief worden beantwoord. Omstandigheden als tijdsdruk, ervaring in het nemen van marketingbeslissingen en de analytische capaciteiten van de gebruikers vormen een belangrijk aandachtspunt ...

  12. Barcode van DNA. Democratisering van de taxonomie door digitaal identificatiesysteem

    NARCIS (Netherlands)

    Bakker, F.T.


    Het herkennen van biologische soorten aan de hand van een gestandaardiseerde DNA-barcode heeft de laatste tijd een enorme vlucht genomen. Gedreven door aan de ene kant de biodiversiteitscrises en de mogelijke global change, en aan de andere kant zowel razendsnelle technologische vooruitgang als ook

  13. De invloed van bodemreiniging op de biologische beschikbaarheid van metalen

    NARCIS (Netherlands)

    Adema DMM*; Boer JLM de; Gestel CAM van; Jong P de*


    Er werd onderzoek uitgevoerd met als doel het uitlooggedrag en de biologische beschikbaarheid van metalen in verontreinigde gronden voor en na reiniging te bepalen. Dit (deel)rapport beschrijft de resultaten van het onderzoek naar de biologische beschikbaarheid. Op zes locaties in Nederland

  14. Dutch Water Mining: Potentie van een zuiverend landschap van overvloed

    NARCIS (Netherlands)

    Os, van E.; Kruijs, A.; Bomas, B.; Poelman, M.; Pater, de M.; Bokhoven, van D.


    De blauwalg in het Volkerak - Zoommeer zorgt jaarlijks voor veel overlast. In de zomerperiode zijn giftig water en stank een hinderlijk fenomeen voor iedereen. Met de techniek Dutch Water Mining verdwijnt de overlast van blauwalgen. Voor de omliggende landbouwbedrijven ontstaat de zekerheid van een

  15. Betekenis van Legionella-soorten voor preventiebeleid van leidingwaterinstallaties

    NARCIS (Netherlands)

    Versteegh JFM; Brandsema PS; Lodder WJ; de Roda Husman AM; Schalk JAC; van der Aa NGFM; IMG; LZO; EPI


    Het RIVM adviseert om de huidige normstelling voor het preventiebeleid van Legionella te handhaven en niet uitsluitend op Legionella pneumophila te richten. Als andere Legionella-soorten worden aangetroffen kan er ook groei van Legionella pneumophila optreden. Als er dan geen maatregelen worden

  16. Het dichtwerk van Jan van Foreest (1585-1651)

    NARCIS (Netherlands)

    Vries, M. de


    The dissertation consists of an edition of Jan van Foreest's Greek poems and the greater part of those written in Latin, provided with translations and a succinct commentary in Dutch. A number of the Latin poems appears in print for the first time ever. Jan van Foreest (1586-1651) studied arts at

  17. Prestatiemeting ten tijde van economische crisis: de aanpak van DSM

    NARCIS (Netherlands)

    van Rinsum, M.; den Dekker, R.; Maas, V.


    Deze studie besteedt aandacht aan de gevolgen van de financiële crisis voor het prestatiemeetsysteem van een onderneming. Vanwege de financiële crisis hebben veel ondernemingen naast langetermijndoelstellingen ook een aantal kortetermijndoelstellingen geformuleerd die betrekking hebben op hun

  18. Stabilisatie en samenstelling van het glycosidenmengsel van Folia digitalis

    NARCIS (Netherlands)

    Tattje, Derk Hendrik Evert


    Na een korte inleiding wordt een omschrijving van het begrip stabilisatie gegeven en besproken hoe deze stabilisatie, dit is het irreversibel inactiveren van de enzymen, in het algemeen tot stand kan worden gebracht. Tevens wordt nagegaan of ook door verschillende oplosmiddelen reeds bij gewone

  19. Verzuring van bodem en grondwater als gevolg van atmosferische depositie

    NARCIS (Netherlands)

    Hoeks, J.


    In het kader van de Tweede-Kamer-rapportage over verzuring door atmosferische depositie heeft het ICW een bijdrage geleverd aan het deelrapport over effecten op bodem en grondwater. Deze ICW-notitie is hier nu nader uitgewerkt, waarbij vooral aandacht wordt besteed aan de methode om effecten van

  20. die rol van die unieverdedigingsmag in die onderdrukking van die

    African Journals Online (AJOL)

    agv regeringsoptrede nie.39. Siotsom. In die geskiedenis van die Unieverdedigings- mag word die gebeure random die 1914-staking oorskadu deur die Rebellie en Suid-Afrika se deelname aan die Eerste Wereldoorlog. Tog was dit 'n belangrike mylpaal in die geskiedenis van die organisasie, omdat dit sy eerste optrede ...

  1. Vergelyking van twee metodes vir die bepaling van vitamien A ...

    African Journals Online (AJOL)

    Vergelyking van twee metodes vir die bepaling van vitamien A. J.J. Erasmus. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's ...

  2. Invloed van waterconditioners en hulpstoffen op de effectiviteit van gewasbeschermingsmiddelen

    NARCIS (Netherlands)

    Zeeland, van M.G.


    In 2005 heeft de gebruikerscommissie naar aanleiding van de literatuurstudie over hulpstoffen drie aanbevelingen voor verder onderzoek geformuleerd. In 2006 zijn twee daarvan in onderzoek genomen, namelijk: wordt door toevoegen van waterconditioners (Easi-mix, Intake, X-change) aan hard water de

  3. Die konteks vir die keuse van geriefsvoedsel van bepaalde ...

    African Journals Online (AJOL)


    70. Die konteks vir die keuse van geriefsvoedsel van bepaalde beroepsvroue *. Martha Kok en Priscilla Botha. ABSTRACT. The purpose of this research is to understand and describe the context in which career women choose, purchase and use convenience food (CF). A person is rarely isolated from or unaffected by.

  4. Grizzly bear denning chronology and movements in the Greater Yellowstone Ecosystem (United States)

    Haroldson, Mark A.; Ternent, Mark A.; Gunther, Kerry A.; Schwartz, Charles C.


    Den entrance and emergence dates of grizzly bears (Ursus arctos) in the Greater Yellowstone Ecosystem are important to management agencies that wish to minimize impacts of human activities on bears. Current estimates for grizzly bear denning events use data that were collected from 1975–80. We update these estimates by including data obtained from 1981–99. We used aerial telemetry data to estimate week of den entry and emergence by determining the midpoint between the last known active date and the first known date denned, as well as the last known date denned and the first known active date. We also investigated post emergence movement patterns relative to den locations. Mean earliest and latest week of den entry and emergence were also determined. Den entry for females began during the fourth week in September, with 90% denned by the fourth week of November. Earliest den entry for males occurred during the second week of October, with 90% denned by the second week of December. Mean week of den entry for known pregnant females was earlier than males. Earliest week of den entry for known pregnant females was earlier than other females and males. Earliest den emergence for males occurred during the first week of February, with 90% of males out of dens by the fourth week of April. Earliest den emergence for females occurred during the third week of March; by the first week of May, 90% of females had emerged. Male bears emerged from dens earlier than females. Denning period differed among classes and averaged 171 days for females that emerged from dens with cubs, 151 days for other females, and 131 days for males. Known pregnant females tended to den at higher elevations and, following emergence, remained at higher elevation until late May. Females with cubs remained relatively close (grizzly bear populations in the southern Rocky Mountains. 

  5. De beoordeling van arbeidsongeschiktheid in Engeland

    NARCIS (Netherlands)

    Zuidam, W.; Cremer, R.; Brenninkmeijer, V.; Boer, W. de


    In het kader van een studie naar verschillende vormen van claimbeoordeling in 14 landen bezochten Wendy Zuidam en Roel Cremer Engeland om daar de privaat uitgevoerde arbeidsongeschiktheidsbeoordeling in kaart te brengen. In dit artikel wordt verslag gedaan van hun bevindingen.

  6. Medische begeleiding produktiepersoneel uit oogpunt van produktbescherming

    NARCIS (Netherlands)

    Boot R; Bremer VHP; Hannik CA; Middelkoop-Selman YB; van Steenis G


    Dit rapport bevat globale richtlijnen betreffende gezondheidsaspecten van personeel, binnen het RIVM betrokken bij de bereiding van biologische prudkten voor humane toepassing, gericht op bescherming van deze produkten. In het rapport : a) wordt het betreffende produktiepersoneel (PP) nader

  7. Genetiese parameters van speenkafrf^ eienskappe by ...

    African Journals Online (AJOL)

    Genetiese en. Omgewingsparameters van 'n VIeisraskudde. Ph.D.-tesis,. Univ. van die Oranje-Vrystaat. VAN MARLE, J., 1964. Untersuchungen tiber Einfltisse von. Umwelt und Erbanlage auf die Gewichtsentwicklung von. Fleischrinden unter extensiven Weidebedingungen der. Versuchstation Armoedsvlakte in Stidafrika.

  8. 3D-computersimulatie van het verhardingsproces

    NARCIS (Netherlands)

    Eijk, van R.J.; Brouwers, H.J.H.


    De ontwikkeling van geavanceerde meettechnieken heeft het mogelijk gemaakt de structuur van cement en zijn hydratatieproducten te volgen en zo meer inzicht te krijgen in het ingewikkelde hydratatieproces. De beschikbaarheid van rekenkracht en vernieuwde kennis over de hydratatieproducten en

  9. Effectiviteit van markting management support systemen

    NARCIS (Netherlands)

    G.H. van Bruggen (Gerrit); A. Smidts (Ale); B. Wierenga (Berend)


    textabstractVerhoogt het gebruik van marketing management support systemen de kwaliteit van marketingbeslissingen? En zo ja, onder welke omstandigheden? Aan de hand van een experimenteel laboratoriumonderzoek met het simulatiespel MARKSTRATonder 80 marketing managers en 160 studenten, kan de eerste

  10. Inventory of Materials to be Used in Explosive Effects Mitigating Structures (Inventarisatie van materialen te gebruiken in constructies ter afscherming van explosie-effecten) (United States)


    F +31 15 284 39 91 TNO-rapportnummer TNO-DV 2008 A357 Opdrachtnummer Datum november 2008 Auteur (s) ir. O.C. van der Jagt...een keramisch materiaal (ZrSiO.*). TNO-rapport | TNO-DV 2008 A357 32/44 K, 04 035 0.3 0 25 02 0 15 01 005 0 O a 0 X A • • Theory ...47] Molinari. A., et al., Modeling plastic shocks in periodic laminates with gradient plasticity theories . Journal of the Mechanics and Physics of

  11. Afscheid van de stapelmarkt

    Directory of Open Access Journals (Sweden)

    J.W. Veluwenkamp


    Full Text Available C. Lesger, Handel in Amsterdam ten tijde van de Opstand. Kooplieden, commerciële expansie en verandering in de ruimtelijke economie van de Nederlanden ca. 1550-ca. 1630 Farewell to the Staple Market, Jan Willem VeluwenkampLesger argues that Amsterdam's essential function in international trade in the seventeenth century was turnover promotion through price stabilisation. Claiming that the relevant mechanism involved information provision rather than stockpiling, he convincingly bids farewell to the historiographical tradition of the Amsterdam staple market and introduces Amsterdamas the centre of information provision. I contest two aspects of Lesger's argument. Unlike him, I do not think that information provision was decisive in Amsterdam's commercial expansion around 1600: Prior to 1585, information exchange and expansion were characteristic for Antwerp too. The Amsterdam acceleration essentially involved the penetration of Asia and the Atlantic area, which was mainly provoked by the war. In addition, I think that Lesger underestimates the Dutch intermediate trade. On the one hand, Dutch industry-related import and export were more significant than he indicates. On the other hand, he attaches too little meaning to the fact that Dutchmen dominated international commerce even when they did not steer all commodity flows via the Dutch Republic.

  12. De metafoor van het washandje. Column

    Directory of Open Access Journals (Sweden)

    Yolan Koster-Dreese


    Full Text Available In hun artikel ‘Kwaliteit en Zorg’ van ruim tien jaar geleden stellen Van Houten en Prins (1995 dat de thans vigerende zorgtaal in meer algemene zin kan worden aangeduid als ‘zorg-Taylorisme’: een scientific management-benadering van zorg. Met de introductie van de ‘zorgmarkt’ is een benadering ontstaan die grote overeenkomsten vertoont met die scientific management-benadering uit het begin van de vorige eeuw, zo menen Van Houten en Prins.

  13. Overleving van pathogenen bij mestverwerking

    NARCIS (Netherlands)

    Hoeksma, P.; Rutjes, S.; Aarnink, A.J.A.; Blaak, H.; Buisonjé, de F.E.


    In de producten van verschillende mestverwerkingsprocessen zijn de concentraties gemeten van een aantal pathogenen. De resultaten laten zien dat mechanische scheiding vrijwel geen effect heeft op het aantal pathogenen. Vergisting heeft weinig effect op virussen en grampositieve bacteriën, maar

  14. Die binding van die konfessie

    Directory of Open Access Journals (Sweden)

    P. J. Coetzee


    Full Text Available Ons moet waak teen twee uiterstes. Aan die een kant het die dogma as onversoenlike vyand die dogmatisme en aan die ander kant die antidogmatisme — dit hou enersyds die gevaar in van verabsolutering (oorskatting, en ander- syds die gevaar van relativisme (onderskatting.

  15. Fractioneren van gras en luzerne

    NARCIS (Netherlands)

    Kasper, G.J.


    Gewasfractionering is de mechanische scheiding van gewassen in een aantal fracties voor een betere benutting van het oorspronkelijke materiaal. Het is een proces waarbij de bladrijke plant sterk gekneusd en samengeperst wordt. Hierdoor ontstaat een relatief eiwitrijke en een vezelarme sapfractie en


    African Journals Online (AJOL)

    1 Aug 1978 ... dan ook aangebied, Agv die probleem wat ont- staan het met die gebrek aan goedgekeurde poste vir die Afdeling en as gevolg van die ver- wagte vertraging met die ondersoek van die. DOS-span, het die Afdeling Logistiek en Afde- ling Personeel oorleg gepleeg en laasgenoemde het ingestem dat die ...

  17. prosesseringsmetodes op die voedingswaarde van

    African Journals Online (AJOL)

    gebring is, kon geen betekenisvolle verskille tussen die drie monsters gevind word nie. Volgens Opstvedt (1976) kan ME waardes ook dien as 'n kriteria van proteien- kwaliteit, hoofsaaklik a.g.v. die verhoogde stikstofuit- skeiding in die urine wat sal plaasvind a.g.v. beskadiging van aminosure. De Groote (1968) het gevind ...

  18. De stijl van gewoon proza

    NARCIS (Netherlands)

    Fagel-de Werd, Suzanne


    Ook gewóón proza heeft stijl. Dat is de argumentatieve stelling die in de titel van dit proefschrift verborgen zit. Vaak wordt stijl gelijkgesteld met het gebruik van stijlfiguren en wordt daarnaast aangenomen dat er dus ook zoiets bestaat als proza zonder stijl. Dat ook ‘gewoon’ proza stijl heeft

  19. Integrale diergezondheid : beheersing van leverbot

    NARCIS (Netherlands)

    Neijenhuis, F.; Verkaik, J.C.; Verwer, C.M.; Smolders, E.A.A.; Wagenaar, J.P.


    Leverbotinfecties zijn in toenemende mate een knelpunt in de diergezondheid van melkvee en andere herkauwers. Bestrijding en/of behandeling van leverbot kent de volgende beperkingen: de besmettingscyclus is complex, beschikbare geneesmiddelen zijn in Nederland nagenoeg niet inzetbaar bij dieren die

  20. De materiaaleigenschappen van houtachtige materialen

    NARCIS (Netherlands)

    Kuilen, J.W.G. van de


    Naast gezaagd hout en gelamineerd hout is een uitgebreid palet aan houtachtige (plaat)materialen ontwikkeld, waarvan triplex en Oriented Strand Board tot de meest gebruikte behoren. Een van de eerste typen plaatmateriaal ontwikkeld op basis van hout is triplex. Daarna zijn vele typen platen

  1. De prijsgevoeligheid van huishoudelijk watergebruik.

    NARCIS (Netherlands)

    Kooreman, P.


    Het kabinet wil het mogelijk maken dat huishoudens een rekening krijgen voor waterverbruik, rioolrechten en zuiveringsheffing. De hoogte van die rekening moet geheel afhankelijk zijn van de hoeveelheid water die het huishouden verbruikt. De achterliggende gedachte hierbij is dat dit mensen ertoe zal

  2. Aernout van Buchel in Napels

    NARCIS (Netherlands)

    de Jong, Jan; Kemper, J.A.R.


    Aernout van Buchel a Napoli Il 18 ottobre 1587, dopo un viaggio in Germania, il giovane studioso olandese Aernout van Buchel (Buchellio/Arnoldus Buchellius) da Utrecht arrivò in Italia. Il suo scopo fu visitare Roma ed esaminare, con i propri occhi, i monumenti e le iscrizioni dell’Antichità. Fin da

  3. Huisverkoop van biologisch vlees : handboek

    NARCIS (Netherlands)

    Heijden, van der C.H.T.M.


    Voor biologische boeren die willen beginnen met de verkoop van biologisch vlees aan huis, is het 'Handboek Huisverkoop Biologisch Vlees' samengesteld. Het handboek bevat o.a. marketingtips en een overzicht van de wet- en regelgeving. Het is opgesteld door Wageningen UR in samenwerking met Biologica

  4. Management control van ondersteunende diensten

    NARCIS (Netherlands)

    Vosselman, E.G.J.


    In dit artikel worden alternatieve inrichtingstypen van ‘management control’-systemen voor ondersteunende (facilitaire) diensten algeleid. Daaraan voorafgaand wordt de ‘management control’-functie in algemene zin beschreven. Het oorspronkelijke ‘management control’ raamwerk van Anthony (1988) wordt

  5. Meningen van kinderen over natuurverlies

    NARCIS (Netherlands)

    Mabelis, A.A.


    Ongeveer 400 leerlingen van basisonderwijs en middelbaar onderwijs (MAVO en MAVO/VBO) in de regio Amerongen-Veenendaal werden geenqueteerd over hun gevoelens m.b.t. natuurverlies (uitsterven van soorten; bossterfte) en milieuverontreiniging (water-, bodem- en luchtverontreiniging; kernramp). Verder

  6. Broeigedrag en -sukses van tuinduiwe

    Directory of Open Access Journals (Sweden)

    Pieter le Roux


    Full Text Available Broei-aktiwiteite van tuinduiwe (Columba livia in die Bloemfonteinse stadsgebied vind dwarsdeur die jaar plaas met ’n afname gedurende die laat somermaande wanneer seisoenale reënval in die streek ’n hoogtepunt bereik. Nesstrukture is relatief primitief en word gekenmerk deur ’n losse samestelling van nesmateriaal op opgehoopte, droë voëlmis. Broeisels van twee eiers is die mees algemene grootte en die eiers word gewoonlik binne twee dae ná mekaar gelê. Beide ouers is by die broeiproses van meer as twee weke betrokke, waartydens die eiers ’n progressiewe afname in massa ondergaan. Pas uitgebroeide neskuikens is met geel dons bedek en is grootliks hulpeloos. Egte vere begin eers ná die eerste week te voorskyn kom, en vanaf die derde week kan individue wankelrig rondbeweeg. Afgesien van die eerste paar dae na uitbroei, handhaaf neskuikens van seldsame enkeleier-broeisels deurgaans ’n laer liggaammassa as dié van normale broeisels. Die broeisukses van 247 broeipare vir hierdie studie is 34%. Eierverlies is hoër as die mortaliteitsyfer van neskuikens, en word veral deur klimaatsfaktore soos reënval geaffekteer. Predasie blyk die belangrikste faktor te wees wat die mortaliteitsyfer van neskuikens beïnvloed. Antagonistiese interaksie tussen krans- en tuinduiwe, asook moontlike intraspesie-aggressie, speel egter ook ’n beduidende rol.

  7. Filosofiese tendense in die wordinggeskiedenis van ons verstaan van die fisiese natuur

    Directory of Open Access Journals (Sweden)

    D. F. M. Strauss


    Full Text Available Die ontstaan van ’n lang tradisie van natuurwetenskaplike denke is in antieke Griekeland te vind – die bakermat van die Westerse beskawing en die bron van geartikuleerde rasionele besinning. Die vroegste fases van die Griekse kultuur het reeds geboorte geskenk aan ’n teoretiese nadenke oor die heelal. Die Pythagoreërs is veral bekend vir hul klem op die verklaringskrag van getalsverhoudinge. In hul tese dat “alles getal is” het hulle egter slegs rasionale getalle (breuke erken en gevolglik uiteindelik vasgeloop in die ontdekking van irrasionale getalle wat tot die geometrisering van die Griekse wiskunde gelei het en tegelyk die bedding gevorm het van waaruit ’n magtige tradisie van ruimte-metafisika gegroei het wat die hele middeleeuse tydperk omspan het. Die vermeende statiese syn is in die mees ekstreme geval – die skool van Parmenides en die argumente van Zeno teen veelheid en beweging – tot in die uiteindelike antinomiese konsekwensies daarvan deurdink. Dit was egter eers die vroeg-moderne tyd – die voorgangers en nakomelinge van Galilei – wat naas getal en ruimte ’n waardering ontwikkel het vir die verklaringskrag van beweging (vergelyk die klassieke meganistiese wêreldbeeld van die heelal as ’n meganisme van stofdeeltjies in beweging. Maar ook hierdie meganistiese reduksie (waardeur alle fisiese verskynsels herlei is tot die beweging van al of niegelade massapunte sou uiteindelik misluk omdat dit nie van die onomkeerbaarheid van fisiese prosesse rekenskap kon gee nie. Gevolglik beliggaam eers die fisika van die 20ste eeu ’n erkenning van die deurslaggewend-stempelende rol van energie-werking (dus van die fisiese aspek in die aard van stoflike dinge en prosesse. Die artikel word afgesluit met ’n vlugtige verduideliking van die implikasies van die voorafgaande argumentasie vir ’n benadering van die misterie van die bestaan van materie.

  8. Fox Den Disease: An Interesting Case Following Delayed Diagnosis. (United States)

    Stehr, Ryan C; Kim, Nicholas; LoGiudice, John A; Ludwig, Kirk


    Pyoderma fistulans sinifica, also known as fox den disease, is a rare and poorly understood inflammatory disorder of the skin and subcutaneous tissues. This disorder is often mistaken for other inflammatory skin disorders and treated inappropriately. The authors describe the case of a 53-year-old male who presented to the colorectal surgery service with a longstanding diagnosis of perirectal Crohn's disease. Despite aggressive immunosuppression and numerous surgical procedures, the patient continued to have unrelenting purulent drainage from the skin of his buttocks. Following wide excision of the affected skin and subcutaneous tissues by the colorectal surgeon, the plastic surgery team reconstructed the 30 cm x 55 cm wound using a combination of local flaps and skin grafts. The initial pathology report of the excised specimen confirmed the presence of nonspecific abscesses and inflammation. Upon special request by the plastic surgery team, the sample was resectioned with the specific intent of establishing a diagnosis of fox den disease. The additional slides met the criteria for an unequivocal diagnosis of fox den disease. Immunosuppression was discontinued and the patient healed his wounds without complication. Fox den disease is often overlooked because of the obscurity of the disease and the special histological sectioning needed to establish a diagnosis. In this case, the patient was unnecessarily treated with immunosuppressive drugs for more than 3 decades because of a misdiagnosis. With increased awareness of fox den disease, perhaps its pathophysiology can be better elucidated as more patients are appropriately diagnosed and treated.

  9. Beoordeling van de gevoeligheid van soorten en habitattypes van Europees belang bij verstoringingrepen


    Wouters, Jan


    Om ecologische schade te vermijden, moeten activiteiten of plannen met mogelijk schadelijke effecten doorgelicht worden. Het instrument ‘effectenindicator’ licht activiteiten in algemene termen door op mogelijke natuureffecten. De in dit advies weergegeven gevoeligheidstabellen geven de gevoeligheid op van soorten en biotopen voor effecten ten gevolge van menselijke activiteiten. De tabellen bevatten deze gegevens voor de soorten waarvoor gewestelijke instandhoudingsdoelstellingen zijn opgest...

  10. Overzicht van de onderzoekresultaten van kroketten, bitterballen en frikandellen van 1986

    NARCIS (Netherlands)

    Cazemier, G.; Veen, van der N.G.


    In 1986 werden in opdracht van de AID 54 monsters frikandellen en 237 monsters kroketten en bitterballen door het RIKILT onderzocht op de eisen, zoals die zijn vastgelegd in de Kwaliteitsverordening Kroketten, Bitterballen en Frika(n)dellen. In dit verslag zijn de analyseresultaten van deze monsters

  11. Ontwikkeling van een protocol voor de transformatie van iris; introductie van resistentie tegen irismozaik viris (IMMV)

    NARCIS (Netherlands)

    Langeveld, S.A.; Klerk, de G.J.M.


    Twee iris cultivars, Blue Magic en Blue Sail, werden in weefselkweek gebracht en callus werd geïnduceerd. Dit callus werd genetisch gemodificeerd met virusresistentie via de particle gun procedure die eerder voor lelie was ontwikkeld. Van een van de cultivars, Blue Magic, werden getransformeerde

  12. Die hermeneutiek van gereformeerde kerkreg

    Directory of Open Access Journals (Sweden)

    Andries le Roux du Plooy


    Full Text Available Die artikel het op die belangrikheid en noodsaaklikheid van ‘n hermeneutiek vir die gereformeerde kerkreg gefokus. Die kerkregtelike dokument wat besonderlik ter sake was, is die kerkorde van die Gereformeerde kerke in Suid-Afrika, met sy besondere band met die Dordtse kerkorde van 1618 en 1619. Agtereenvolgens is aandag gegee aan die volgende aspekte soos (1 die eiesoortige aard van ‘n kerkorde as ‘n teologiese dokument en teks, in onderskeiding van regsdokumente; (2 die aard van die hermeneutiek van kerkreg; (3 enkele teorieë oor die interpretasie of uitleg van tekste, veral regstekste en (4 normatiewe vooronderstellings en reëls vir die interpretasie en verstaan van die teks en artikels van die kerkorde asook besluite van kerklike vergaderinge. Die gevolgtrekking was dat weinig indringende navorsing gedoen is oor die saak van hermeneutiek vir kerkreg, hoewel dit noodsaaklik is. Duidelike hermeneutiese reëls is gesuggereer en verduidelik, wat sou kon meehelp dat kerke en kerklike vergaderinge die artikels van die kerkorde asook besluite en reglemente wat daarop berus het, kan interpreteer en toepas. The hermeneutics of reformed church polity. The article focused on the importance and urgency of a design for reformed hermeneutics on church polity. The Church Order referred to in the article is the Church Order of the Reformed Churches in South Africa, which are closely related to the Church Order of Dordt of 1618 and 1619. The following aspects received attention namely (1  the unique character of a Church Order, in comparison to and distinguished from legal documents and statutes; (2 the character and nature of hermeneutics of church polity; (3 theories of interpretation in the common law tradition and their relevance to church polity and (4 normative presuppositions and marks for the interpretation and understanding of the text and articles of the Church Order, as well as the resolutions of church assemblies. It was found that

  13. Resultaten van het Rijkswaterstaat JAMP 2009 monitoringsprogramma van bot (Platichthys flesus L.). Biologische gegevens van bot en milieukritische stoffen in bot


    Hoek-van Nieuwenhuizen, van, M.; Barneveld, van, E.


    De in dit rapport beschreven werkzaamheden zijn in 2009 door IMARES uitgevoerd op basis van een opdracht van Rijkswaterstaat in het kader van het Joint Assessment and Monitoring Program van de OSPARCOM. De opdracht hield in het verkrijgen van biologische gegevens van bot (visziekten). De benodigde monsters bot werden verzameld door IMARES. Tevens werd materiaal van bot verzameld voor chemisch onderzoek en geanalyseerd.

  14. Stroming en samenstelling van de sprengen en het grondwater van de Veluwe in 1996; een vergelijking met de toestand van 1986

    NARCIS (Netherlands)

    Meinardi CR; LBG


    Monsters water uit sprengen en grondwater van de Veluwe zijn onderzocht op concentraties van hoofdcomponenten en van microcomponenten (bepalingen door NITG). Onderzoek is gedaan ter bepaling van verblijftijden in de bodem van grondwater en van het water in sprengen. De intrekgebieden van de

  15. Inzicht door onderdompeling Een reactie op Bart Van de Putte, Henk de Smaele en Dirk Jan Wolffram

    Directory of Open Access Journals (Sweden)

    Jan Hein Furnée


    Full Text Available Giving a detailed account of the social history of The Hague’s most prominent sites of civilised leisure – the gentlemen’s clubs, the zoo, the Royal Theatre and the seaside resort of Scheveningen – Plaatsen van beschaafd vertier demonstrates how the constant struggle for social in- and exclusion structured the daily lives of upper and middle class men and women in The Hague in the nineteenth century. In response to Bart Van de Putte, Jan Hein Furnée argues that extensive quantitative analyses of ‘class’ and ‘social class’ show that objective class stratifications based onwealth and/or occupation are important tools, but at most semi-finished products for historical research. Furnée fully agrees with Henk de Smaele’s objection that his study would have benefitted from a more in-depth reflection on the ways in which shifting patterns in women’s freedom of movement in urban spaces were related to their political and economic emancipation. In response to Dirk Jan Wolffram, Furnée repeats some examples given in his book that show how political practices in places of leisure impacted upon local and national politics, even though this didnot directly contribute to a linear process of increasing political participation and representation.Aan de hand van een gedetailleerde analyse van de sociale geschiedenis van herenen burgersociëteiten, de dierentuin, de Koninklijke Schouwburg en badplaats Scheveningen demonstreert Plaatsen van beschaafd vertier hoe de constante strijd om sociale in- en uitsluiting het dagelijks leven van mannen en vrouwen uit de hogere en middenstanden in negentiende-eeuws Den Haag beheerste. In reactie op Bart Van de Putte betoogt Jan Hein Furnée dat grondige kwantitatieve analyses van ‘class’ en ‘social class’ uitwijst dat objectieve sociale stratificaties op basis van welstand en/of beroep voor historisch onderzoek weliswaar zeer nuttig enzelfs noodzakelijk, maar uiteindelijk slechts een

  16. American black bear denning behavior: Observations and applications using remote photography (United States)

    Bridges, A.S.; Fox, J.A.; Olfenbuttel, C.; Vaughan, M.B.


    Researchers examining American black bear (Ursus americanus) denning behavior have relied primarily on den-site visitation and radiotelemetry to gather data. Repeated den-site visits are time-intensive and may disturb denning bears, possibly causing den abandonment, whereas radiotelemetry is sufficient only to provide gross data on den emergence. We used remote cameras to examine black bear denning behavior in the Allegheny Mountains of western Virginia during March-May 2003. We deployed cameras at 10 den sites and used 137 pictures of black bears. Adult female black bears exhibited greater extra-den activity than we expected prior to final den emergence, which occurred between April 12 and May 6, 2003. Our technique provided more accurate den-emergence estimation than previously published methodologies. Additionally, we observed seldom-documented behaviors associated with den exits and estimated cub age at den emergence. Remote cameras can provide unique insights into denning ecology, and we describe their potential application to reproductive, survival, and behavioral research.

  17. Omkering van de bewijslast: knelpunten in de regeling en bij de toepassing van de omkering van de sanctie (deel I)

    NARCIS (Netherlands)

    Okhuizen, E.C.G.


    De omkering van de bewijslast als processuele sanctie op het niet nakomen van de aangifteplicht en de daaraan verbonden bijkomende verplichtingen lijken niet weg te denken uit ons belastingrecht. De sanctie kwam al voor in de fiscale wetgeving die dateert van vóór de invoering van de Algemene wet

  18. Dansk udlevering efter den europæiske arrestordre

    DEFF Research Database (Denmark)

    Elholm, Thomas; Bang Fuglsang Madsen Sørensen, Henning


    Den europæiske arrestordre, der blev vedtaget af EU i 2002, har haft stor betydning for retsudviklingen vedrørende udlevering af personer til strafforfølgning eller strafafsoning i EU. Danmark er - trods retsforbeholdet - fuldt ud med i ordningen om arrestordren, og mange danske domstole har...... efterhånden haft sådanne sager. Det har givet anledning til en række vanskelige juridiske spørgsmål. I den sidste tid har det især drejet sig om, hvorvidt udlevering kan afslås med henvisning til urimelige fængselsforhold i andre lande. EU-domstolen har den 5. april 2016 afsagt en vigtig dom om spørgsmålet...

  19. STUDI KONEKTIVITAS AKUIFER ANTARA SUMUR BOR DENGAN SUMBER DAYA AIR DI BAWAHNYA (Study on Aquifer Connectivity, between Boreholes with water resources underneath

    Directory of Open Access Journals (Sweden)

    Agus Budhie Wijatna


    Full Text Available ABSTRAK Untuk memenuhi kebutuhan air bersih bagi penduduk di daerah bekas bencana letusan Gunung Merapi, Kabupaten Sleman, DIY, telah dibuat 5 sumur bor di Dusun Srunen (BH1, Pagerjurang (BH2, Ngepring (BH3, Kuweron (BH4, dan di Dusun Bubur (BH5. Pembuatan sumur bor pada elevasi antara 544 sampai 846 m.dpl, dengan kedalaman antara 98-146 m dan debit pengambilan airtanah rerata 9-10 liter per detik tersebut dikawatirkan akan mempengaruhi kondisi muka airtanah sumur gali di Dusun Pendowoharjo (W7, Ngaglik (W8, Gebang (W9, Condong Catur (W10, sumur UGM (W11 dan mempengaruhi debit umbul (mataair Ngepas (S8, Umbul Jogopaten (S9, Umbul Pajangan (S10, Umbul Londo (S11, Umbul Permai (S12, dan Umbul Seturan (S13, yang berada pada elevasi 148-329 m.dpl. Secara teoritis, pengambilan airtanah di sumur bor akan berpengaruh jika terdapat interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair. Pada penelitian ini, interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair dilakukan menggunakan isotop lingkungan (D, 3H dan 18O. Penelitian diawali dengan menentukan lokasi pengambilan sampel airtanah berdasarkan peta topografi dan kondisi hidrologi; sampel airtanah diambil dari sumur bor, sumur gali dan mataair sebanyak 30 ml dan 1.000 ml; rasio isotop δD dan δ18O pada sampel airtanah diukur dengan liquid-water stable isotope analyzer LGR DLT-100, sedangkan kadar tritium diukur dengan Liquid Scientillation Counter (LSC Tri Carb 1900 TR. Genesis sampel airtanah ditentukan berdasarkan komposisi isotop (δ18O, δD dengan mengacu pada persamaan Merapi Meteoric Water Line (MMWL; sedangkan untuk memastikan adanya interkoneksi hidraulik, maka hasil pengukuran kadar tritium dianalisis dengan tritium dating method. Hasil penelitian menunjukkan bahwa genesis airtanah di BH1, BH2, BH3, dan BH4 berbeda dengan genesis airtanah sumur gali dan mataair di bawahnya. Sehingga dapat disimpulkan airtanah sumur bor di BH1, BH2, BH3, dan BH4 tidak memiliki

  20. Ontwateren van zeugenmest door middel van omgekeerde osmose

    NARCIS (Netherlands)

    Thelosen, J.; Gastel, van J.; Cuyck, van J.


    In periodiek nummer 1 (februari 1991) is het proces van omgekeerde osmose reeds beschreven. In het kort komt omgekeerde osmose op het volgende neer: de te ontwateren vloeistof wordt onder hoge druk (55 bar) door filterbuizen gepompt.

  1. Verteerbaarheid van katoensaadbevattende diete en die effek van ...

    African Journals Online (AJOL)

    , 15 and 20% whole cottonseed respectively, was determined in sheep at a feeding level of ... Die skynbare verteerbaarheid van droe materie (DM), organiese materie (OM), totale ruproteien (TRP), ruvesel (RV), neutraalbestande vesel (NBV), ...

  2. 'n Kwalitatiewe ondersoek na die invloed van aspekte van die ...

    African Journals Online (AJOL)

    S Blignaut

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 26: No1, 1998. 15 ...... van byvoorbeeld die televisie en gedrukte media 'n invloed op die .... fashion promotion and advertising. New York. ... Consumer behaviour to-.

  3. Het effect van het calciumgehalte van pootgoed op de ziektegevoeligheid

    NARCIS (Netherlands)

    Velema, R.; Griend, van de P.; Velvis, H.


    Het onderzoek dat in dit verslag is beschreven heeft betrekking op de relatie tussen het calciumgehalte in de knol en het optreden van de ziekten Fusarium spp, Helminthosporium solani, Phytophthora infestans en Erwinia spp.

  4. Achtergrondconcentraties van 17 sporenmetalen in het grondwater van Nederland

    NARCIS (Netherlands)

    Fraters B; Boumans LJM; Prins HP; LBG


    Er worden achtergrondconcentraties gegeven van 17 sporenmetalen in het grondwater in Nederland. De drie typen achtergrondconcentraties die onderscheiden worden, zijn: natuurlijk, semi-natuurlijk en regionaal. De natuurlijke achtergrondconcentratie is de concentratie zoals die gemeten zou worden op

  5. Filosofisk terapi som træning til døden

    DEFF Research Database (Denmark)

    Dræby, Anders

    Den eksistentielfænomenologiske terapi deler den opfattelse med stoicismen, at filosofiens hovedopgave er at hjælpe mennesket med at finde vej i en problematisk verden. Oplægget udforsker desuden et overlap, som består i den indsigt, at terapeutisk udfrielse fra menneskelig lidelse til livsduelig......Den eksistentielfænomenologiske terapi deler den opfattelse med stoicismen, at filosofiens hovedopgave er at hjælpe mennesket med at finde vej i en problematisk verden. Oplægget udforsker desuden et overlap, som består i den indsigt, at terapeutisk udfrielse fra menneskelig lidelse til...

  6. Diana og Kirke. Den klassiske mytes metamorfose i italienske Renæssance

    DEFF Research Database (Denmark)

    Cecchini, Leonardo

    Den klassiske myte har en særlig stilling i det, Aleida Assmann har kaldt kulturelle Gedächtnis. Takket være dens store udbredelse i den vestlige kultur (både i litteratur, kunst og i andre områder), har den en tendens til at virke, snarere end som konkret ”tekst”, som et udbredt kulturel registe...... renæssancekulturen omarbejder den klassiske myte. Som case-stories vil jeg anvende Kirke-myten og ”den mytiske jagt” (Diana og Aktæon) og vise, hvordan de bliver genanvendt, tilpasset og fortolket i tekster af Petrarca, Boccaccio, Machiavelli og Gelli....

  7. Facial Cellulitis Arising from Dens Evaginatus: A Case Report

    Directory of Open Access Journals (Sweden)

    Chun-Ming Chen


    Full Text Available Dens evaginatus is a developmental anomaly that produces a tubercle on the occlusal surface of a tooth. It is found most frequently in the mandibular premolars. The occlusal tubercle easily causes occlusal interferences. Attrition or fracture of the tubercle can lead to pulpitis, pulp necrosis, periapical pathosis, and periapical infection. This case report illustrates the treatment of facial cellulitis arising from dens evaginatus with open apex. Calcium hydroxide was used for the apexification procedure. One year after canal obturation, radiography revealed no apical pathosis and the apical seal was evident.

  8. Die Umweltschäden und Entsorgungsprobleme des russischen Nuklearkomplexes


    Kronfeld-Goharani, Ulrike


    "Als Nachfolgestaat der ehemaligen Sowjetunion mit ihrer gigantischen Nuklearindustrie zählt Russland heute zu den Ländern, in denen sich große Mengen Nuklearmüll angereichert haben und einzelne Regionen des Landes von radioaktiven Kontaminationen besonders stark betroffen sind. Ungeachtet dessen änderte im Juni 2001 das russische Parlament das Umweltgesetz, um verbrauchten Nuklearbrennstoff aus dem Ausland in großen Mengen zu importieren. Während Befürworter der Gesetzesänderungen den Import...

  9. Financial Inclusion: Reformen in den Bereichen Verbraucherschutz und finanzielle Allgemeinbildung


    Christa Hainz


    Nicht zuletzt der Mangel an wirksamer Offenlegung von Informationen und irreführende Werbung auf Seiten der Anbieter sowie mangelndes Verständnis bezüglich Finanzprodukten auf Seiten der Konsumenten trugen dazu bei, dass der Markt für Subprime-Hypotheken in den USA zusammenbrach. Eine Verbesserung dieses institutionellen Umfelds sollte deshalb dazu dienen, derart negative Entwicklungen in der Zukunft zu verhindern. Der Beitrag gibt einen Überblick, welche Industrieländer Reformen in den Berei...

  10. Kurz zum Klima: Zu viel Salz verdirbt den Boden


    Zimmer, Markus; Lippelt, Jana; Frank, Jonas


    Der zunehmende Einsatz von Anlagen zur Bewässerung sowie mangelnde Erfahrungswerte und Unkenntnis über den richtigen Einsatz der künstlichen Bewässerung haben in den letzten Jahrzehnten zu einer massiven Zunahme der Versalzung des Bodens geführt. Durch diese Bodenversalzung werden weite Flächen für die Landwirtschaft unbrauchbar. Sie sind nur durch hohen Aufwand und Kosten wieder renaturierbar. Der Beitrag in der Reihe »Kurz zum Klima« gibt einen Überblick über die Versalzung in Anbaugebiet...

  11. Fieldlab als aanjager van het innovatie ecosysteem

    NARCIS (Netherlands)

    Stolwijk, C.; Seiffert, L.


    Recente ontwikkelingen op het gebied van innovatiebeleid tonen een hernieuwde aandacht voor de rol van fieldlabs in het aanjagen van het omliggende innovatie ecosysteem1. Voorbeelden van deze trend zijn o.a. de Europese ’Innovation Hubs’, de Duitse ‘Mittelstand 4.0-Kompetenzzentren’, en de

  12. Effecten van wintergewassen op verliezen en benutting van stikstof bij de teelt van snijmaos; verslag van onderzoek op ROC Aver-Heino tussen voorjaar 1991 en najaar 1994

    NARCIS (Netherlands)

    Dijk, van W.; Schröder, J.J.; Holte, ten L.; Groot, de W.J.M.


    Tussen 1988 en 1994 is onderzoek verricht naar de effecten van wintergewassen (winterrogge en onderzaai van gras) op de verliezen en benutting van stikstof bij continuteelt van snijmaos op zandgrond. Gemiddeld over de gehele onderzoeksperiode nam zowel rogge als gras 30-40 kg/ha op in de

  13. Van Varroa jacobsoni naar Varroa destructor

    NARCIS (Netherlands)

    Calis, Johan


    Resultaten van onderzoek naar de verschillende voortplantingsstrategieën van Varroa jacobsoni en Varroa destructor in respectievelijk de Oosterse honigbij (Apis cerana) en de Westerse honingbij (Apis mellifera). Het hygiënisch gedrag van de Oosterse honingbij (leegruimen van aangetaste

  14. Consumentenonderzoek in het Restaurant van de Toekomst

    NARCIS (Netherlands)

    Wijk, de R.A.; Gorselink, M.; Steenbekkers, L.P.A.; Wabeke, M.; Thomasson, T.


    Miljoenen mensen lunchen dagelijks op hun werk. Over bijvoorbeeld motieven bij de keuze van maaltijdcomponenten, de invloed van de inrichting van het restaurant of variaties in het assortiment op dit keuzegedrag is weinig tot niets bekend. In het Restaurant van de Toekomst doet de Consumer Science

  15. Mechanische preventie van tarweopslag in graszaadteelt

    NARCIS (Netherlands)

    Wever, A.C.; Borm, G.E.L.


    Voor de chemische bestrijding van tarwe in veldbeemdgras is, na het vervallen van de toelating van diuron in juni '99, alleen chloorprofam nog toegelaten. Van beide middelen is een vrij grote kans op schade en is de effectiviteit tegen tarwe matig en zeer wisselend. Omdat de kans op nieuwe

  16. De kern van HRM. - 2e dr.

    NARCIS (Netherlands)

    Verburg, R.; den Hartog, D.


    In dit boek staat de kern van HRM centraal. Op basis van praktijkvoorbeelden, toonaangevende internationale publicaties en onderzoek in Nederland worden essentiële thema's van HRM belicht. Zo komen de volgende onderwerpen aan de orde: - De oorsprong van HRM - De veranderende relatie tussen werkgever

  17. Numerieke simulatie van de blastbelasting op vlucht MH17 van Malaysia Airlines als gevolg van de detonatie van een gevechtslading (U)

    NARCIS (Netherlands)


    De Onderzoeksraad voor Veiligheid (OVV) onderzoekt de crash van vlucht MH17 van Malaysia Airlines die plaatsvond op donderdag 17 juli 2014 in de regio Donetsk (Oekraïne). De OVV wil een duidelijk beeld geven van de oorzaak van de crash. Een mogelijke oorzaak is fatale schade aan het vliegtuig als

  18. Evaluatie van de Alcohol Verkeer Cursussen

    NARCIS (Netherlands)

    Leuw, Ed.; Brouwers, M.


    In dit rapport wordt een overzicht gegeven van de opzet, doelstellingen en uitkomsten van het evaluatie-onderzoek dat is verbonden aan de landelijke invoering van Alcohol Verkeer Cursussen (AVC's). Het verslag geeft een globaal en beschrijvend beeld van de belangrijkste kenmerken (deelname en

  19. Endopolygalacturonases van Botrytis cinerea: karakteristieken in vitro

    NARCIS (Netherlands)

    Krooshof, G.H.; Kester, H.C.M.; Burgers, K.; Benen, J.A.E.


    In dit artikel samenvattingen van lezingen van zeven presentaties van zestien onderzoekers van de KNPV-werkgroep Botrytis die op 18 september 2002 hun jaarlijkse bijeenkomst op het PPO Bomen in Boskoop hielden. De lezingen hadden de volgende onderwerpen: 1) Botrytis problems in hardy ornamentals; 2)

  20. Die teologiese arbeid van Antonius HJ Gunneweg

    African Journals Online (AJOL)

    En dis 'n klein treetjie van klagte na aanklag en na protes teen die gode, die heersers wat die mens vernietig deur hom oor sy ware lewe te bedrieg. Die ideologie eis dan ook dienooreenkomstig die bevryding en emansipasie van die mens van die gode en van God (1983: 118—119). Volgens die Jahwis is dit die slang wat, ...

  1. De polders van Nederland: een geologisch succesverhaal?

    NARCIS (Netherlands)

    Cohen, K.M.

    Overal in Nederland is de gesteldheid van de ondergrond het gevolg van landschapsvorming door de natuur, en van bedoelde en onbedoelde acties door de mens. Dat is nog eens extra waar in de poldergebieden van de kustvlakte en het rivierengebied. Al in de Romeinse tijd lagen daar lokaal de nodige

  2. De Balanced Scorecard, van theorie naar praktijk

    NARCIS (Netherlands)

    Schotanus, Fredo


    Meten is weten en wat men meet is wat men krijgt. Ofwel, wat gemeten wordt, is waar aandacht aan geschonken wordt. Dit zijn veelgehoorde statements en zij geven het belang aan van het meten van prestaties en van het meten van de juiste factoren. Hoe moet dit meten in de praktijk worden gebracht? Aan

  3. Over de zin en onzin van ecolabels

    NARCIS (Netherlands)

    Duim, van der V.R.


    In dit forum een discussie over de zin en onzin van ecolabels en keurmerken in toerisme. Voorstanders van eco-labeling plaatsen het debat in de context van een brede visie op milieuverandering. Labels zijn voor duurzame ontwikkeling een essentieel instrument om de belangen van burger-consumenten in

  4. Die Subjektiewe en Objektiewe doelwitte van Arbeid

    Directory of Open Access Journals (Sweden)

    T. H. Veldsman


    Die artikel gee aandag aan die subjektiewe en objektiewe doelwitte van arbeid. Hul plek en funksie binne 'n voorgestelde geïntegreerde motiveringsmodel word eerstens aangedui. Vervolgens word die verwantskap tussen die twee doelwitte uitgelig, gevolg deur 'n bespreking van die aard van die objektiewe doel. Laastens word die invloed van moderne arbeid op hierdie doelwitte uitgestippel.

  5. De fysiologische tremor van de hand

    NARCIS (Netherlands)

    Weerden, Tiemen Willem van


    Bij het innemen van een houding, zoals het willekeurig horizontaal gestrekt houden van de hand, vertoont het betrokken lichaamsdeel kleine fluctuaties in positie: de fysiologische tremor. Het doel van het proefschrift is, naast een beschrijving van het fenomeen, inzicht te geven in de oorzakelijke

  6. Stabiliteit van drijvende lichamen; anti-slingertanks

    NARCIS (Netherlands)

    Bourgingnon, G.P.


    Het dempen van de slingerbewegingen (roll) van een drijvend lichaam door middel van tanks met een vrije vloeistofoppervlakte. In de scheepsbouwkunde is vrij veel bekend over het toepassen van anti-slingertanks. De anti-slingertank, die ook dempt bij een stilliggend schip (in tegenstelling tot


    African Journals Online (AJOL)

    In 1933 belas Rykskanselier. Hitler vir. Goering, Minister van Lugvaart, in die geheim met die skepping van die Luftwaffe. Die basis in Rusland is gesluit en toekomstige vlieeniers is nou in die geheim na Italie waar hulle elke aspek van moderne oorlog- voering oefen en die Blitzkrieg-gedagte, deur op ondersteuning van 'n.

  8. Biobrood van eigen bodem: een ketenproject

    NARCIS (Netherlands)

    Postma, R.; Bakker, den A.; Derksen, V.; Kruiger, K.; Maassen, J.; Osman, A.M.; Schepers, H.E.


    In 2007 is het ketenproject “Biobrood van eigen bodem” uitgevoerd in het kader van het coinnovatieprogramma biologische afzetketens. Het betrof een samenwerkingsproject van een aantal ketenpartijen uit de biologische broodketen en een aantal kennisinstellingen. Het doel van het project was gericht

  9. Het microscopisch onderzoek van amandelspijs en banketspijs

    NARCIS (Netherlands)

    Jong, de W.J.H.J.


    Nagaan of het door middel van microscopisch onderzoek mogelijk is om de identiteit vast te stellen van de gebruikte grondstoffen bij de bereiding van amandelspijs en banketspijs. Van een aantal monsters (22) gevulde speculaas werd de spijs geïsoleerd. Voor het microscopisch onderzoek werden een

  10. Tranen van bloed : Het beleg van 's-Hertogenbosch en de oorlog in de Nederlanden, 1629

    NARCIS (Netherlands)

    Cauwer, de Peter


    Het beleg van 's-Hertogenbosch en de veldtocht van 1629 staat in de Nederlandse geschiedschrijving te boek als een van de meest roemruchte gebeurtenissen van de Tachtigjarige Oorlog. Het beeld en de interpretaties van deze gebeurtenis zijn de afgelopen decennia nauwelijks veranderd. Toch bleven de

  11. Detectie van Meloidogyne spp. in grondmonsters - een vergelijking van twee technieken

    NARCIS (Netherlands)

    Veenhuizen, P.T.M.; Schoemakers, N.; Vos, J.; Versteegen, F.; Landeweert, R.; Karssen, G.


    Hier volgen de samenvattingen van de bijeenkomst van 20 maart 2007 van de KNPV-werkgroep Meloidogyne. 1) Kwantitatieve multiplexdetectie van aaltjes; 2). Meloidogyne chitwoodi en M. fallax: vergelijking visuele beoordeling en Taqman-PCR aan pootaardappelen; 3) Detectie van Meloidogyne spp. in

  12. Kroniek van de intellectuele eigendom

    NARCIS (Netherlands)

    Visser, D.J.G.


    Het online doorverkopen en uitlenen van e-books is omstreden. De thuiskopieheffing blijft een kostbaar hoofdpijndossier. Een parodie vereist een humoristische bedoeling. Onpersoonlijke geschriften en verweesde werken zijn niet meer beschermd. Een stoel is geen merk, maar een winkelinrichting

  13. Voedingsgewoonten van overvloed en onbehagen.

    NARCIS (Netherlands)

    Hartog, den A.P.


    Vijf artikelen waarin de volgende aspecten zijn belicht: -) vijftig jaar eten in Nederland; -) sociale klasseverschillen in (op)voeding; -) voedingsaankopen in het gezin; -) invloed sociale omgeving; -) effectiviteit van vet- en suikervervangers

  14. Gezondheidsaspecten van Legionella in water

    NARCIS (Netherlands)

    Schets FM; de Roda Husman AM; MGB


    Legionella pneumophila is een veroorzaker van ernstige longontsteking bij mensen. Legionella bacterien blijken overal in waterige milieus aanwezig te zijn. Met name in kunstmatige waterige milieus kunnen mensen blootgesteld worden aan aerosolen waarin Legionella aanwezig is. Dit beknopte

  15. Tandem Van de Graaff facility (United States)

    Federal Laboratory Consortium — Completed in 1970, the Tandem Van de Graaff facility was for many years the world's largest electrostatic accelerator facility. It can provide researchers with beams...

  16. Gentegreerde woordeboekgebruik van vakwoordeboeke vir ...

    African Journals Online (AJOL)

    Riette Ruthven

    word bespreek asook daardie vakwoordeboeke wat op aanleerders van sowel 'n taal as die vak gerig is. ... Abstract: Integrated Dictionary Use of Specialised Dictionaries for Learn- ers. ...... Applied Language Studies 25(3): 319-331. Gouws ...

  17. Over Rattus rattus roquei Sody met beschrijving van een nieuw ras van Rattus rattus van Soemba

    NARCIS (Netherlands)

    Sody, H.J.V.


    Geen der op Java voorkomende soorten heeft wellicht den werkers in Javaansche ratten zooveel determinatie-zorgen gekost als de voor kort door mij 1) met roquei benoemde Javaansche „boomrat" 2). Door enkele auteurs 3) werd de vorm oorspronkelijk slechts aangeduid als Mus sp. of Rattus sp., ter

  18. Evaluatie van relatievorming in de laagdrempelige verslavingszorg

    Directory of Open Access Journals (Sweden)

    Esther Kuis


    deze vergelijking de vragenlijst die de meeste aspecten van de kwaliteit van de relatie meet, en bewerkten deze. Daarna is dit instrument getoetst in een onderzoek onder 80 bezoekers van laagdrempelige verslavingscentra in vier verschillende steden. De auteurs concluderen dat de bewerkte vragenlijst onderscheidend vermogen bezit voor verschillende werkers en instellingen. De lijst is behulpzaam bij het meten van de kwaliteit van de relatie tussen cliënt en hulpverlener.

  19. Mediamonitering in die bestuur van korporatiewe beeld



    M.Comm. Die waarde van hierdie ondersoek hou verband met die bemarking van 'n onderneming en die handhawing van 'n mededingende voordeel deur die projektering van 'n positiewe beeld (Anon., 1995a:92; Bateman & Zeithaml, 1993:75; Caminiti, 1992:50; Kotler & Armstrong, 1991:240). Hierdie aspek neem toe in belangrikheid soos wat die besigheidsmilieu in Suid-Afrika verander, veral wat betref die toetrede van buitelandse maatskappye tot die Suid-Afrikaanse mark.

  20. Van Hove singularities revisited

    International Nuclear Information System (INIS)

    Dzyaloshinskii, I.


    Beginning with the work of Hirsch and Scalapino the importance of ln 2 -Van Hove singularity in T c -enhancement in La 2 CuO 4 -based compounds was realized, which is nicely reviewed by Rice. However, the theoretical treatment carried out before is incomplete. Two things were apparently not paid due attention to: interplay of particle-particle and particle-hole channels and Umklapp processes. In what follows a two-dimensional weak coupling model of LaCuO 4 will be solved exactly in the ln 2 -approximation. The result in the Hubbard limit (one bare charge) is that the system is unstable at any sign of interaction. Symmetry breaking moreover is pretty peculiar. Of course, there are separate singlet superconducting pairings in the pp-channel (attraction) and SDW (repulsion) and CDW (attraction) in the ph-channel. It is natural that Umklapps produce an SDW + CDW mixture at either sign of the interaction. What is unusual is that both the pp-ph interplay and the Umklapps give rise to a monster-coherent SS + SDW + CDW mixture, again at either sign of the bare charge. In the general model where all 4 charges involved are substantially different, the system might remain metallic. A more realistic approach which takes into account dopping in La-M-Cu-O and interlayer interaction provides at least a qualitative understanding of the experimental picture. 10 refs, 5 figs