WorldWideScience

Sample records for valodas tulkojusi lili

  1. La fuga de Lily

    Directory of Open Access Journals (Sweden)

    Adel López Gómez

    1982-01-01

    Full Text Available ESTANZA.- La escena inicial de esta historia, se desarrolla en el lujoso despacho de don Teódulo, opulento hombre de negocios y presidente de la poderosa firma industrial "Moscardón y Moscardón Verde, Limitada" . La oficina es amplia y elegante, con gruesas alfombras de lana, muebles de fina madera y suave iluminación indirecta. Algunos volúmenes, lujosamente encuadernados, mantienen dentro de la vitrina su severa virginidad, pues desde que trajeron el mueble se ha perdido la llave . Hay algunos adornos en la estancia: una rosada flor de loto sobre una mesilla enana, y la señorita Lily, secretaria del magnate, una muchacha aerodinámica, modelo 1981, propietaria de una dentadura deslumbrante, un lunarcito en la barbilla hacia la izquierda y un par de piernas soberbias.

  2. Makro-valoda datu bāzes piekļuvei

    OpenAIRE

    Pladers, Eduards

    2014-01-01

    Šī maģistra darba ietvaros tika izstrādāta programmēšanas valoda, kas paredzēta darbam ar datu bāzi. Izstrādātā valoda balstās uz objektorientētas programmēšanas pamatprincipiem. Izstrādātās valodas pirmkods tiek translēts uz Java valodas pirmkodu, un tiek izpildīts Java virtuālajā mašīnā. Šīs valodas mērķis ir aizvietot vienkāršas SQL konstrukcijas ar konstrukcijām, kas balstītas uz objektorientētu pieeju. Darbā ir apskatītas uz darba izstrādes brīdi populāras pieejas darbam ar datu bāzi. Da...

  3. Carnation, Lily, Lily, Rose and the process of painting

    Directory of Open Access Journals (Sweden)

    Rebecca Hellen

    2016-04-01

    Full Text Available “One Object” is a British Art Studies series that uses an object from a collection as a starting point for collaborative research. Rebecca Hellen and Elaine Kilmurray have co-authored this essay based on their recent analysis of Carnation, Lily, Lily, Rose (1885–86 by John Singer Sargent This “One Object” article on John Singer Sargent’s Carnation, Lily, Lily, Rose (1885–86 brings together recent technical examination of the painting with the “patchwork” of moments, ideas, and themes that inform the history of its making. A variety of observations were recorded by artists and writers who were staying in or visiting Broadway in Worcestershire when Sargent was making his “big picture” there over the late summers and early autumns of 1885 and 1886. By connecting the research carried out in the conservation studio with research from the archive, we present new information about Sargent’s working methods. In considering technical information in tandem with Sargent’s preparatory work, this article explores the evolution of one of Sargent’s best-known paintings.

  4. hybrids lily (Lilium) cultivar 'eyeliner'

    African Journals Online (AJOL)

    Yomi

    2012-08-30

    Aug 30, 2012 ... was a very beautiful lily cut flower. In order to produce cut flower, mother bulbs were the basic. So, in vitro micro- propagation of bulblets of 'eyeliner' was studied in this paper ...... twelfth five-year plans” 863 “The molecular breeding technology and varieties initiative of Chinese rose, chrysanthemum and lily” ...

  5. Lily and Yuh Nung Jan.

    Science.gov (United States)

    2016-11-23

    Lily and Yuh Nung Jan's collaboration started with the identification of Shaker as the first known potassium channel gene and has flourished to produce over 100 former students and postdocs who are now leading their own research groups. In an interview with Neuron, they reflect on their scientific discoveries, serendipity in science, and the value of curiosity-driven basic research. Copyright © 2016.

  6. Dzimumu atšķirības otrās valodas apguvē

    OpenAIRE

    Brūdere, Kristīne

    2012-01-01

    Bakalaura darbs pēta dzimumu atšķirības otrās valodas apguvē un dzimuma ietekmi valodas apgūšanā, kas arī tika pārbaudīts praktiskajā daļā. Pētnieciskā darba mērķis ir noskaidrot kādā veidā izpaužas dzimumu atšķirības otrās valodas apguvē un kā tas ietekmē valodas apguvi. Praktiskās daļas rezultāti liecina, ka dzimumu atšķirības pastāv. Galvenās atšķirības tiek novērotas mutiskajā komunikācijā, aktivitātes ziņā, vēlmē apgūt valodu un uzsvara likšanā uz valodas apguvi. Lai arī atšķirības starp...

  7. Transgenic lilies via pollen mediated transformation

    NARCIS (Netherlands)

    Leede-Plegt, van der L.M.; Kronenburg-van de Ven, van B.C.E.; Franken, J.; Tuyl, van J.M.; Tunen, van A.J.; Dons, J.J.M.

    1997-01-01

    We have developed a procedure for the production of transgenic lilies by using the pollen grain as vector for DNA delivery. First, a particle gun was used for the introduction of the NPTII gene (for kanamycin resistance) into pollen of lily (Lilium longiflorum), cv ‘Gelria’. Subsequently the

  8. Interspecific hybridization in lily: the use of 2n-gametes in interspecific lily hybrids

    NARCIS (Netherlands)

    Barba Gonzalez, R.; Lim, K.B.; Shujun Zhou,; Ramanna, M.S.; Tuyl, van J.M.

    2008-01-01

    Lily comprises more than 80 species belonging to 7 sections. Within the sections cultivars bred from Sinomartagon, Archelirion, and Leucolirion are the most important in the commercial market. At this moment, the most promising breakthrough in lily breeding is the raising of new cultivar through

  9. A study on the extraction and purification process of lily ...

    African Journals Online (AJOL)

    The objective of this paper was to extract and purify lily polysaccharide and to study its anti-H22 hepatoma effect in mice. Orthogonal experimental method was used to analyze the factors influencing the extraction and purification of lily polysaccharide, and the anti-tumor effect of lily polysaccharide was studied by acting it on ...

  10. Bezkonteksta valodas un to ģenerējošas funkcijas

    OpenAIRE

    Poltarjonoks, Dmitrijs

    2006-01-01

    Darba galvenais mērķis bija savākt informāciju par bezkonteksta valodām un to ģenerējošam funkcijām viena valodā (šeit latviešu valoda). Darbā apskatītas bezkonteksta valodas, bezkonteksta gramatikas, ģenerējošo funkciju un magazīnas automātu jēdzieni. Ir apskatītas arī ar to saistītas teorēmas, lemmas un to pierādījumi. Darbā vēl ir apskatīti ģenerējošo funkciju pielietojumi, lai atrisinātu bezkonteksta valodu algoritmiskās problēmas, tādas kā bezkonteksta gramatikas izvedamo vārdu ska...

  11. Lily Perennializing in Ithaca, Louisiana and Holland

    NARCIS (Netherlands)

    Miller, W.B.; Kuehny, J.; Gude, H.

    2010-01-01

    In May 2006, we published a newsletter (number 10) where we first reported on our experiences with multi-year flowering of a variety of “cut flower” hybrid lilies at Cornell’s outdoor trialing site, Bluegrass Lane, in Ithaca NY. In 2002-2003, we planted a range of LA, Asiatic and Oriental hybrid

  12. Occupational allergy caused by Peruvian lily (Alstroemeria).

    Science.gov (United States)

    Chan, Robin Y C; Oppenheimer, John J

    2002-06-01

    Allergic contact dermatitis to Alstroemeria has been well documented; however, occupational allergy to this decorative flower has never been reported in the literature. We describe a florist with complaints of a sense of throat tightness, allergic rhinoconjunctivitis, urticaria, and facial angioedema attributable to the handling of this popular flower. An allergy skin testing by the puncture technique and a challenge test are performed in a private office. A staff member is used as a control for the skin testing. Main outcome measures are the subject's clinical symptoms. The allergy skin testing reveals positive response to Alstroemeria (Peruvian lily), but negative to Stargazer lily, solidago, and few other flower extracts. In the challenge test, the subject develops conjunctival injection, postnasal drip with nasal congestion, and cough. This is the first report of a type I allergic reaction to Alstroemeria and illustrate the ease of in-office performance of skin testing and challenge to flowering plants.

  13. Multimediālās Power Point prezentācijas izmantošana vācu valodas kā svešvalodas mācīšanā un apguvē

    OpenAIRE

    Deņisova, Inese

    2012-01-01

    Diplomdarbā "Multimediālās PowerPoint prezentācijas izmantošana vācu valodas kā svešvalodas mācīšanā un apguvē” I.Deņisova apskata jaunāko tehnoloģiju izmantošanu kā modernu mācību formu. Darba mērķis: noskaidrot, kādas iespējas sniedz multimediālās PowerPoint prezentācijas izmantošana vācu valodas kā svešvalodas mācīšanā. Praktiskā daļa ietver multimedālās PowerPoint prezentācijas izmantošanas piemērus, aptaujas un intervijas rezultātu analīzi. Secinājums: multimediālās PowerPoint prezent...

  14. Interspecific lily hybrids: a promise for the future

    NARCIS (Netherlands)

    Tuyl, van J.M.; Chi, H.S.; Kronenburg-van de Ven, van B.C.E.; Meijer, B.

    1997-01-01

    In order to introduce new characters such as resistances, flower shape and colour, from wild species into the cultivar assortment of lily it is necessary to overcome interspecific crossing barriers.. Several techniques have been used for wide interspecific lily crosses with species and cultivars

  15. Development of genomic resources for ornamental lilies (Lilium L.)

    NARCIS (Netherlands)

    Shahin, A.

    2012-01-01

    Lily (Lilium L.) is a perennial bulbous ornamental, belonging to subclass Monocotyledonae and family Liliaceae. Lily, according to statistics of Dutch auctions, is the fifth most important cut flower and the second in flower bulbs based on acreage. This species has been extensively used for

  16. Water lilies as emerging models for Darwin's abominable mystery.

    Science.gov (United States)

    Chen, Fei; Liu, Xing; Yu, Cuiwei; Chen, Yuchu; Tang, Haibao; Zhang, Liangsheng

    2017-01-01

    Water lilies are not only highly favored aquatic ornamental plants with cultural and economic importance but they also occupy a critical evolutionary space that is crucial for understanding the origin and early evolutionary trajectory of flowering plants. The birth and rapid radiation of flowering plants has interested many scientists and was considered 'an abominable mystery' by Charles Darwin. In searching for the angiosperm evolutionary origin and its underlying mechanisms, the genome of Amborella has shed some light on the molecular features of one of the basal angiosperm lineages; however, little is known regarding the genetics and genomics of another basal angiosperm lineage, namely, the water lily. In this study, we reviewed current molecular research and note that water lily research has entered the genomic era. We propose that the genome of the water lily is critical for studying the contentious relationship of basal angiosperms and Darwin's 'abominable mystery'. Four pantropical water lilies, especially the recently sequenced Nymphaea colorata, have characteristics such as small size, rapid growth rate and numerous seeds and can act as the best model for understanding the origin of angiosperms. The water lily genome is also valuable for revealing the genetics of ornamental traits and will largely accelerate the molecular breeding of water lilies.

  17. Interneta vārdnīcas vārdu krājuma pilnveidē angļu valodas kā svešvalodas stundās 9.klasē

    OpenAIRE

    Kalēja, Elga

    2012-01-01

    Angļu valoda ieņem nozīmīgu vietu gan reālajā starptautiskā, gan virtuālajā komunikācijā un angļu valodas apguve kļūst par svarīgu mācību uzdevumu. Vārdu krājuma pilnveide ir visu angļu valodas prasmju – klausīšanās, runāšanas, lasīšana, rakstīšana – pamatā. Viena no tipiskākajām jauniešu komunikācijas problēmām ir nepietiekams vārdu krājums un ierobežotas komunikācijas formas, kas jāattīsta un jāpilnveido. Mūsdienās arvien nozīmīgāku vietu leksikas apguvē ieľem moderno tehnoloģiju lietojums ...

  18. Kreativitāte angļu valodas mācīšanā

    OpenAIRE

    Jekimova, Irina

    2009-01-01

    Bakalaura darba tēma ir “Kreativitāte angļu valodas mācīšanā”. Bakalaura darba mērķis ir pētīt kreatīvas metodes, angļu valodas mācīšanas metodiku, testus, kas izmēra verbālu kreativitāti, lai attīstītu svešvalodas komunikatīvu kompetenci. Bakalaura darbs analizē kreativitātes jēdzienu, kreatīvus testus, kas vērtē verbālu kreativitāti, to īpašības no dažādu valodnieku viedokļa. Darba autore analizē kreatīvus testus un no tiem iegūtos rezultātus. Pētījumā ir izmantotas šādas metodes: kvantitat...

  19. Mobilo ierīču izmantošana dažādu valodas līmeņu apguvē

    OpenAIRE

    Leišavniece, Silva

    2014-01-01

    Bakalaura darbā tiek pētīts mobilo ierīču izmantojums dažādu valodas līmeņu apguvē, balstoties uz Eiropas kopīgajām pamatnostādnēm valodas apguvē. Darba mērķis ir izpētīt vairākas izglītojošās mobilās lietotnes un to pielietojumu un nozīmību mācoties spāņu valodu kā svešvalodu ņemot vērā dažādos valodas prasmes līmeņus. Pētījuma veikšanai tika izvēlētas 5 populārākās izglītojošas mobilās lietotnes otrās valodas apguvei, proti, spāņu valodas apguvei un uzskaitīti to plusi un mīnusi. Pētījuma r...

  20. Vai mēs kļūsim par Baltijas baskiem jeb Kā būt pārstāvētiem? / Jāns Undusks ; no igauņu valodas tulkojusi Maima Grīnberga-Preisa

    Index Scriptorium Estoniae

    Undusk, Jaan, 1958-

    2005-01-01

    Teksti aluseks on ettekanne 8. Balti vaimse koostöö konverentsil 16. juunil 2001 Tallinnas: Are we Basques of Baltic? The problem of how to be represented. Eesti k.: Looming, 2002, nr. 9. Orig.: Kas meist saavad balti baskid ehk kuidas olla esindatud?

  1. Desalination of sea water with aquatic lily (Eichhornia crassipes).

    Science.gov (United States)

    Arámburo-Miranda, Isela Victoria; Ruelas-Ramírez, Emmanuel Hammurabi

    2017-11-01

    During the last decades, methods of halo conditioning have been developed to increase the tolerance to salinity in glucophyta crops. Some experiments have carried out the application of hydrogen peroxide (H2O2), in support to the modification of cell tolerance in saline medium. The first objective of this study was to evaluate the effects of the incorporation of H2O2 in salinity tolerance development of the aquatic lily (Eichhornia crassipes). Results showed that the incorporation of 0.03 % H2O2 salinity tolerance developed in salt concentrations similar to seawater. Saline stress tolerance in aquatic lily was shown by the excretion of salts in its leaves; this process helped also in removing salt from seawater. At the same time, the reproduction of the lily is intimately linked to the content of nitrogen (N) and phosphorus (P) (nutrients) in water. This reason is important to control the concentrations of these elements in the water. This will allow maintaining a control in the dissemination of the lily. Considering the mentioned above, the second objective was to continue development of the adaptation of the aquatic lily in seawater, using H2O2 and the required amount of nutrients. This paper points out the importance of considering a biological process for the treatments in the desalination of seawater, making the process more sustainable.

  2. Breeding as a tool for improving postharvest quality characters of lily and tulip flowers

    NARCIS (Netherlands)

    Meulen-Muisers, van der J.J.M.; Oeveren, van J.C.; Tuyl, van J.M.

    1997-01-01

    Segregation of postharvest quality characters was studied in lily and tulip. A large variation in longevity of both lily and tulip flowers was found within populations tested at individual plant level. Other postharvest quality characters like number of flowers per stem, male sterility (lily) and

  3. Response of arum lily calli to culture filtrate of Pectobacterium carotovorum subsp. carotovorum

    NARCIS (Netherlands)

    Ni, L.; Li, X.; Custers, J.B.M.; Zhang, K.; Zhang, L.

    2009-01-01

    This report demonstrated that culture filtrate of Pectobacterium carotovorum ssp. carotovorum isolate ZT0505, the pathogen of bacterial soft rot disease of arum lily (Zantedeschia sp.), contained extracellular enzymes and caused arum lily leaf tissue and callus maceration. Arum lily leaf tissue and

  4. Characterization of a new Anulavirus isolated from Amazon lily plants.

    Science.gov (United States)

    Fuji, S; Kikuchi, M; Ueda, S; Toda, T; Furuya, H; Fukumoto, F; Hanada, K

    2013-01-01

    A quasi-spherical virus was isolated from a cultivated Amazon lily plant (Eucharis grandiflora) that could be mechanically transmitted to healthy E. grandiflora plants, subsequently producing mild mosaic or mottle symptoms on the leaves. The purified virus consisted of three quasi-spherical particles about 20 nm wide and 70, 40 and 30 nm in length, containing three segmented genomes of 3,169, 2,507 and 2,530 nucleotides, respectively. Sequence analysis showed that the newly isolated virus is related to pelargonium zonate spot virus, a member of the genus Anulavirus. We propose that the virus should be designated as Amazon lily mild mottle virus (ALiMMV).

  5. Production of calla lily grown in an NFT system

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Correa Landgraf

    2017-12-01

    Full Text Available The objective of this study was to evaluate the production of calla lily in an NFT system. The experiment was carried out in a greenhouse, using a 2 x 2 factorial scheme in a completely randomized design (CRD, with fifteen replications. The treatments were a combination of two hydroponic profiles (100 and 150 mm of height and two nutrient solutions. Calla lily plantlets obtained from rhizome buds in trays containing nutrient solution, were transferred to a laminar flow of nutrients, and the experiment lasted 12 months. The height of stems and inflorescences were evaluated, as well as the length and diameter of the inflorescence, the number of flowers per plant and number of flowers per m2 . Growing calla lily plants in an NFT system is feasible. The nutrient solution with the highest concentration of nutrients, particularly N and K, and the profile of 150 mm, are the most suitable for the production of calla lily as a cut flower in a laminar flow of nutrients.

  6. Optimizing shipment of lily buls in 40fr teefer containers

    NARCIS (Netherlands)

    Montsma, M.P.; Staal, M.G.; Lukasse, L.J.S.

    2011-01-01

    Lily bulbs is an extremely temperature sensitive and precious commodity. Every now and then it happens that upon delivery the condition of the bulbs is disappointing. Several measures can be taken to reduce the quality loss during transport, both in terms of reefer unit settings and in terms of

  7. Somaclonal variation in lily after in vitro cultivation

    NARCIS (Netherlands)

    Harmelen, van M.J.; Löffler, H.J.M.; Tuyl, van J.M.

    1997-01-01

    Somaclonal variation occurring during cultivation of callus from lily has been determined. Scales of L. longiflorum 'Gelria' were induced to start callus formation. The undifferentiated callus was maintained for 3 years at 20 °C in the dark. After this period the callus was still able to regenerate.

  8. Regeneration and Agrobacterium-mediated transformation of multiple lily cultivars

    NARCIS (Netherlands)

    Wang, Yue; Kronenburg-van de Ven, van B.C.E.; Menzel, T.R.; Maliepaard, C.A.; Shen, X.; Krens, F.A.

    2012-01-01

    To pursue genetic improvement of lily, efficiency of both regeneration and transformation from callus cultures induced from different explants were evaluated in multiple cultivars. Thirty-five callus lines induced from filaments or styles and one control callus line derived from bulb scales of in

  9. Lily Cultivars Have Allelopathic Potential in Controlling Orobanche aegyptiaca Persoon.

    Science.gov (United States)

    Chai, Min; Zhu, Xiaopei; Cui, Hongxia; Jiang, Chuangdao; Zhang, Jinzheng; Shi, Lei

    2015-01-01

    As a devastating holoparasitic weed, Orobanche aegyptiaca Persoon. (Egyptian broomrape) causes serious damage to agricultural production and threatens economic development, which has raised widespread concern. The present study was conducted to determine whether lilies have the potential to be used as 'trap crops' for controlling O. aegyptiaca Persoon. In the experiments, the ability of three popular lily cultivars (Lilium Oriental hybrids 'Sorbonne', Lilium LA (Longiflorum hybrids x Asiatic hybrids) hybrids 'Ceb Dazzle', and Lilium Longiflorum hybrids (L. formosanum x L. longiflorum) 'L. formolongo') to induce O. aegyptiaca Persoon. seed germination was assessed. Parts of the three lily cultivars, including the rhizosphere soil and underground and above-ground organs, all induced "suicidal germination" of parasitic O. aegyptiaca Persoon. seed at four growth stages. Specifically, Sorbonne and Ceb Dazzle behaved with similar allelopathy, and the bulb, scale leaf and aerial stem exhibited stronger allelopathic effects on O. aegyptiaca Pers. germination compared to other organs. Aqueous L. formolongo leaf extracts may contain more stable, effective stimulants given that they induced the highest germination rate at 76.7% even though the extracts were serially diluted. We speculate that these organs may be advantageous in further isolating and purifying economical active substances that can be substitutes for GR24. These results indicate that lilies have the potential to be used as a trap crops or can be processed into green herbicide formulations that can be applied in agriculture production to rapidly deplete the seed bank of O. aegyptiaca Persoon. parasitic weeds in soil.

  10. Lily Cultivars Have Allelopathic Potential in Controlling Orobanche aegyptiaca Persoon.

    Directory of Open Access Journals (Sweden)

    Min Chai

    Full Text Available As a devastating holoparasitic weed, Orobanche aegyptiaca Persoon. (Egyptian broomrape causes serious damage to agricultural production and threatens economic development, which has raised widespread concern. The present study was conducted to determine whether lilies have the potential to be used as 'trap crops' for controlling O. aegyptiaca Persoon. In the experiments, the ability of three popular lily cultivars (Lilium Oriental hybrids 'Sorbonne', Lilium LA (Longiflorum hybrids x Asiatic hybrids hybrids 'Ceb Dazzle', and Lilium Longiflorum hybrids (L. formosanum x L. longiflorum 'L. formolongo' to induce O. aegyptiaca Persoon. seed germination was assessed. Parts of the three lily cultivars, including the rhizosphere soil and underground and above-ground organs, all induced "suicidal germination" of parasitic O. aegyptiaca Persoon. seed at four growth stages. Specifically, Sorbonne and Ceb Dazzle behaved with similar allelopathy, and the bulb, scale leaf and aerial stem exhibited stronger allelopathic effects on O. aegyptiaca Pers. germination compared to other organs. Aqueous L. formolongo leaf extracts may contain more stable, effective stimulants given that they induced the highest germination rate at 76.7% even though the extracts were serially diluted. We speculate that these organs may be advantageous in further isolating and purifying economical active substances that can be substitutes for GR24. These results indicate that lilies have the potential to be used as a trap crops or can be processed into green herbicide formulations that can be applied in agriculture production to rapidly deplete the seed bank of O. aegyptiaca Persoon. parasitic weeds in soil.

  11. Hydroponic Technology for Lily Flowers and Bulbs Production Using ...

    African Journals Online (AJOL)

    This experiment was carried out to investigate the potential of nutrient film technique (NFT) hydroponic system for flowers and bulbs production of the Asiatic hybrid lily cv. "Blackout" using rainwater and some common nutrient solutions (Hoagland No. 2 Basal Salt Mixture, Murashige and Skoog Basal Salt Mixture and ...

  12. Intergenomic recombination and introgression breeding in Longiflorum x Asiatic lilies

    NARCIS (Netherlands)

    Shujun Zhou,

    2007-01-01

    Lily, one of the economically most important ornamental crops, belongs to the genus Lilium of the family Liliaceae. There are about 80 species in Lilium which are categorized into seven sections, i.e., Lilium, Martagon, Pseudolirium, Archelirion, Sinomartagon, Leucolirion and Oxypetala. Usually, it

  13. Frazeoloģismi angļu valodas mācīšanas procesā

    OpenAIRE

    Dmitrenko, Gaļina

    2009-01-01

    Bakalaura darba nosaukums ir „Frazeoloģismi angļu valodas mācīšanas procesā. Zinātniskā darba mērķis ir parādīt, ka angļu valodas frazeoloģismi satur lielu apjomu informācijas par angļu kultūru un ieviest jaunu kultūras mācīšanas metodi. Galvenais pētījuma veids ir eksperiments, kas tika vadīts vidusskolas klasēs. Rezultātā darba autors atklāja, ka informācija par kultūru var palīdzēt frazeoloģismu apgūšanas procesā, un otrādi – kultūra var tikt mācīta ar frazeoloģismu palīdzību. Turk...

  14. New trends in breast reconstructive surgery: "Florentine Lily" reductive mastoplasty.

    Science.gov (United States)

    Rogliani, M; Gentile, P; Trimarco, A; Labardi, L; Brinci, L; Palla, L; Cervelli, V

    2010-06-01

    To describe a mammoplasty technique that we called "Florentine Lily" because of the shape of the pre-operative drawings similarity with the symbol lily Florentine. In a group of 190 women who underwent reductive mammoplasty, 23 women affected by severe enlarged breasts were selected. Main selection requirements were: 18-30 cm rising of the Areola-Nipple Complex (NAC). to obtain a functional and cosmetic result; preservation of mammary gland function; vitality of the areola-nipple complex and its sensitivity. We describe the case of 35 years old woman affected by severe enlargement of the breast and no pathologies. We didn't observe necrosis of the skin flaps and NAC in any case. In one case (rising of Nipple-Areola Complex >25 cm) NAC showed NAC 2 days post-surgery, which spontaneously resolved. Minor complications (edema and ematoma) developed in 20 cases. No infections were observed.

  15. Vārdu mācīšanās paņēmienu izmantošana 7. klasē vācu valodas kā otrās svešvalodas apguves veicināšanai

    OpenAIRE

    Skutele, Aija

    2017-01-01

    Diplomdarbā pētīta vārdu mācīšanās paņēmienu izmantošana vācu valodas kā otrās svešvalodas apguves veicināšanai 7. klasē, jo darba autore prakses ietvaros novēroja, ka skolēniem nav pilnīgas izpratnes par vārdu mācīšanās paņēmieniem. Lai sasniegtu darba mērķi – apzināt vārdu mācīšanās paņēmienu efektivitāti –, tika pētīta vācu valodas aktualitāte, kā arī tās apguve, mācoties vācu valodu kā otro svešvalodu pēc angļu valodas; uzsvars likts uz tiešo un netiešo vārdu mācīšanās paņēmienu izpēti. ...

  16. Lily Cultivars Have Allelopathic Potential in Controlling Orobanche aegyptiaca Persoon

    Science.gov (United States)

    Cui, Hongxia; Jiang, Chuangdao; Zhang, Jinzheng; Shi, Lei

    2015-01-01

    As a devastating holoparasitic weed, Orobanche aegyptiaca Persoon. (Egyptian broomrape) causes serious damage to agricultural production and threatens economic development, which has raised widespread concern. The present study was conducted to determine whether lilies have the potential to be used as ‘trap crops’ for controlling O. aegyptiaca Persoon. In the experiments, the ability of three popular lily cultivars (Lilium Oriental hybrids ‘Sorbonne’, Lilium LA (Longiflorum hybrids x Asiatic hybrids) hybrids ‘Ceb Dazzle’, and Lilium Longiflorum hybrids (L. formosanum x L. longiflorum) ‘L. formolongo’) to induce O. aegyptiaca Persoon. seed germination was assessed. Parts of the three lily cultivars, including the rhizosphere soil and underground and above-ground organs, all induced “suicidal germination” of parasitic O. aegyptiaca Persoon. seed at four growth stages. Specifically, Sorbonne and Ceb Dazzle behaved with similar allelopathy, and the bulb, scale leaf and aerial stem exhibited stronger allelopathic effects on O. aegyptiaca Pers. germination compared to other organs. Aqueous L. formolongo leaf extracts may contain more stable, effective stimulants given that they induced the highest germination rate at 76.7% even though the extracts were serially diluted. We speculate that these organs may be advantageous in further isolating and purifying economical active substances that can be substitutes for GR24. These results indicate that lilies have the potential to be used as a trap crops or can be processed into green herbicide formulations that can be applied in agriculture production to rapidly deplete the seed bank of O. aegyptiaca Persoon. parasitic weeds in soil. PMID:26565398

  17. Kontrastējoša retorika: akadēmiskā angļu rakstu valoda Latvijas kontekstā

    OpenAIRE

    Lokastova, Jeļena

    2007-01-01

    Šis darbs aplūko universitātes studentu akadēmisko eseju retorisko kompozīciju ar mērķi atklāt kopīgas kļūdas un grūtības, kas radās studentiem pielietojot angļu valodas retorisko modēli Latvijas kontekstā. Darba teorētiskajā daļā tiek sniegti pētītā jautājuma un kontrastīvās retoriskās analīzes pielietojuma iespējas ka arī šī pētījuma veikšanas metodes teorētiskie pamatojumi. Šī darba mērķis ir pierādīt, ka atšķirības starp angļu valodas un studentu dzimtās valodas retoriskajiem modeliem izr...

  18. Vārdu ievietošanas testu teorētiskais pamatojums valodas snieguma novērtēšanā

    OpenAIRE

    Kunda, Tatjana

    2008-01-01

    Maģistra darbā iztirzāts vārdu ievietošanas testu pielietojums valodas snieguma novērtēšanā. Pētījuma merķis ir izanalizēt iespējas izmantot vārdu ievietošanas testus valodas snieguma novērtēšanā un noteikt to teorētisko pamatojumu. Tēmas aktualitāti nosaka pašreizējās tendences svešvalodu apmācībā un vērtēšanā, kuru uzmanības centrā ir komunikatīvā valodas vērtēšana. Maģistra darbā aprakstīti vārdu ievietošanas testu pielietojuma teorētiskie ietvari, kā arī izpētīti to teorētiska pamatoju...

  19. Kritiskās domāšanas stratēģijas latviešu valodas pamatprasmju attīstīšanai.

    OpenAIRE

    Stepanova, Ināra

    2006-01-01

    Pētījuma „Kritiskās domāšanas stratēģijas latviešu valodas pamatprasmju attīstīšanai 1.- 4. klasē” mērķis ir pētīt un analizēt kritiskās domāšanas stratēģiju ietekmi uz 1.- 4. klašu skolēnu latviešu valodas pamatprasmju attīstīšanu. Diplomdarbā autore analizē teorētisko literatūru par kritisko domāšanu pedagoģiskajā procesā, pēta un analizē jaunākā skolas vecuma bērnu valodas pamatprasmju attīstīšanas pedagoģiski psiholoģiskos līdzekļus, veic pedagoģisko eksperimentu par kritiskās domāšanas s...

  20. In vitro direct organogenesis in response to floral reversion in lily ...

    African Journals Online (AJOL)

    Our previous study indicated that the tiger lily (Lilium lancifolium var. Flore Pleno) has a great ability to produce inflorescence bulbils in nature as a form of natural phenomenon of floral reversion in plants. This present research was carried out to investigate the artificial floral reversion in in vitro culture of two lilies (Asiatic ...

  1. Effect of methyl jasmonate on morphology and dormancy developmentin lily bulblets regenerated in vitro

    NARCIS (Netherlands)

    Jasik, J.; Klerk, de G.J.M.

    2006-01-01

    Scales of lily bulbs are swollen petioles. Lily scale fragments cultured in vitro regenerate bulblets consisting of scales that may or may not carry a leaf blade. The bulblets are dormant and require a cold treatment to sprout. We added the gaseous plant growth regulator methyl jasmonic acid (MeJA)

  2. Long term lily scale bulblet storage : effects of temperature and storage in polyethylene bags

    NARCIS (Netherlands)

    Bonnier, Frans J.M.; Jansen, Ritsert C.; Tuyl, Jaap M. van

    Collections of lily genotypes are usually maintained by yearly planting, harvesting and storage of the bulbs. To facilitate this maintenance, a storage method has been developed for a collection of lily genotypes, including Asiatic hybrids, Oriental hybrids, Lilium longiflorum and L. henryi. Scale

  3. Cytological changes of Easter lily (Lilium longiflorum) upon root lesion nematode (Pratylenchus penetrans) infection

    Science.gov (United States)

    Lilium longiflorum cv. Nellie White, commonly known as Easter lily, is an important floral crop with an annual wholesale value of over $26 million in the U.S. The root lesion nematode (RLN), Pratylenchus penetrans, is a major pest of lily due to the significant root damage it causes. In this study w...

  4. Interspecific hybridization in Lily (Lilium): Taxonomic and commercial aspects of using species hybrids in breeding

    NARCIS (Netherlands)

    Lim, K.B.; Barba Gonzalez, R.; Shujun Zhou,; Ramanna, M.S.; Tuyl, van J.M.

    2007-01-01

    With the main goal of generating new groups of lilies, that combine agronomic characteristics of major importance, a large number of crosses were performed among the three most important groups of lilies (Lilium), viz., Asiatic, Longiflorum and Oriental; and to some species, to produce F1

  5. Petal Thicknesses and Shape Transformations in Blooming Lilies

    Energy Technology Data Exchange (ETDEWEB)

    Portet, Thomas; Holmes, Peter N.; Bowden, Mark E.; Stephens, Sean A.; Varga, Tamas; Keller, Sarah L.

    2013-01-29

    During blooming, flower petals undergo significant shape changes. For lilies, various different mechanisms responsible for the change have been suggested [1,2]. One is that cell growth along the edge of a petal, or, more generally, a tepal, drives a transition from a cup shape (within a bud) to a saddle shape (within a bloom). This mechanism has been previously considered for tepals modeled as shallow elliptical shells whose thickness from the center, t, falls off at least as fast as t = t0 (1 - x2/a2 - y2/b2 ) [1]. Here t0 is the maximum thickness of the shell, a and b are the semimajor and semiminoraxes, x and y are the coordinates along the longitudinal and lateral axes. By measuring tepal thicknesses from images collected by x-ray tomography of intact buds and by photography of microtomed buds, we find that this condition is indeed met for both Lilium casablanca and Lilium lancifolium. [1] Liang and Mahadevan. Growth, geometry, and mechanics of a blooming lily.

  6. Chemical changes associated with lotus and water lily natto production

    Science.gov (United States)

    Lestari, S. D.; Fatimah, N.; Nopianti, R.

    2017-04-01

    Natto is a traditional Japanese food made by fermenting whole soybean seeds with pure culture of Bacillus subtilis subsp. natto. The purpose of this study was to investigate the suitability of lotus (Nelumbo nucifera) and water lily (Nymphaea stellata) seeds as the raw materials for natto production. Chemical (proximate, amino acids and minerals) changes were observed on raw, steamed and fermented seeds. Proximate compositions of all samples were calculated in both wet basis and dry basis. In wet basis calculation, steaming and fermentation tended to lower the carbohydrates, ashes, fats and protein content which were attributed to the increase of moisture. The total amino acid, iron and magnesium contents of raw lotus seeds were 24.29%, 5.08 mg 100g-1 and 174.23 mg 100g-1 dry matter, respectively. After a 24h-fermentation at 40°C, the total amino acids decreased while iron and magnesium contents increased significantly reaching, in respective order, 9.9 mg 100g-1 and 411.36 mg 100g-1 dry matter. Changes in chemical composition after fermentation were more pronounced in lotus seeds than water lily seeds indicating that their nutrient composition were more suitable to support Bacillus subtilis growth.

  7. Water lilies as emerging models for Darwin’s abominable mystery

    Science.gov (United States)

    Chen, Fei; Liu, Xing; Yu, Cuiwei; Chen, Yuchu; Tang, Haibao; Zhang, Liangsheng

    2017-01-01

    Water lilies are not only highly favored aquatic ornamental plants with cultural and economic importance but they also occupy a critical evolutionary space that is crucial for understanding the origin and early evolutionary trajectory of flowering plants. The birth and rapid radiation of flowering plants has interested many scientists and was considered ‘an abominable mystery’ by Charles Darwin. In searching for the angiosperm evolutionary origin and its underlying mechanisms, the genome of Amborella has shed some light on the molecular features of one of the basal angiosperm lineages; however, little is known regarding the genetics and genomics of another basal angiosperm lineage, namely, the water lily. In this study, we reviewed current molecular research and note that water lily research has entered the genomic era. We propose that the genome of the water lily is critical for studying the contentious relationship of basal angiosperms and Darwin’s ‘abominable mystery’. Four pantropical water lilies, especially the recently sequenced Nymphaea colorata, have characteristics such as small size, rapid growth rate and numerous seeds and can act as the best model for understanding the origin of angiosperms. The water lily genome is also valuable for revealing the genetics of ornamental traits and will largely accelerate the molecular breeding of water lilies. PMID:28979789

  8. Relationship between the composition of flavonoids and flower colors variation in tropical water lily (Nymphaea) cultivars

    National Research Council Canada - National Science Library

    Zhu, Manlan; Zheng, Xuchen; Shu, Qingyan; Li, Hui; Zhong, Peixing; Zhang, Huijin; Xu, Yanjun; Wang, Lijin; Wang, Liangsheng

    2012-01-01

    .... Despite its limited researches on flower color variations and formation mechanism, water lily has background of blue flowers and displays an exceptionally wide diversity of flower colors from purple...

  9. Water Lily and Cosmic Serpent: Equivalent Conduits of the Maya Spirit Realm

    National Research Council Canada - National Science Library

    J. Andrew McDonald; Brian Stross

    2012-01-01

    Abstract This study examines the roles of the serpent and water lily in Maya epigraphy and iconography and, from an ethnobotanical perspective, interprets these elements in Classic and post-Classic...

  10. Lili Marleeni lugu - Triin Maran esitas Pärnus saksa shlaagreid / Aino Siebert ; foto: Jan Siebert

    Index Scriptorium Estoniae

    Siebert, Aino

    2008-01-01

    šlaagri "Lili Marleen" tekkeloost ja käekäigust, laulu sõnade autorist Hans Leip' ist ja heliloojast Norbert Schultze'st, saksa lauljannast Lieselotte Brunnenbergist - kunstnikunimega Lale Andersenist

  11. Runas prasmju mācīšana neformālās izglītības programmas angļu valodas kursos bezdarbniekiem

    OpenAIRE

    Grigorjeva, Elīna

    2010-01-01

    Bakalaura darbā ir izpētīti veidi, kā labāk attīstīt runas prasmes personām, kuras apgūst angļu valodu neformālās izglītības programmas angļu valodas kursos, kas domāti bezdarbniekiem. Teorētiskajā daļā ir apsvērta valodas apguvēju vajadzību noteikšanas nozīme un paņēmieni, kā arī apskatīti dažādi veidi, kā uzlabot runas prasmju mācīšanu. Lai noteiktu valodas prasmes, kuras ir visvairāk nepieciešamas, tika veikts pētījums, kura ietvaros tika novērotas angļu valodas nodarbības, kā arī izanaliz...

  12. Bērnu ar dzirdes traucējumiem valodas attīstīšanas sekmēšana tēlotājdarbības nodarbībās pirmsskolā

    OpenAIRE

    Dargeļe, Gunita

    2013-01-01

    Darba nosaukums: Bērnu ar dzirdes traucējumiem valodas attīstīšanas sekmēšana tēlotājdarbības nodarbībās pirmsskolā. Darba autore: Gunita Dargeļe Darba vadītāja: Dr. paed., prof. Sarmīte Tūbele Pētījuma mērķis: Pētīt valodas attīstību ar tēlotājdarbību nodarbību palīdzību attīstīšanās procesu pirmsskolas vecuma bērnu ar dzirdes traucējumiem apmācībā. Pētījuma objekts: Valodas attīstības process pirmsskolas vecuma bērniem ar dzirdes traucējumiem. Pētījuma hipotēze: Valodas apguv...

  13. Dziesmu, spēļu un rotaļu izmantošana angļu valodas stundās 1.-4.klasē.

    OpenAIRE

    Vīndedze, Krista

    2006-01-01

    Mūsdienās arvien vairāk pieaug svešvalodu zināšanu nepieciešamība. Gan darba tirgū, gan arī ikdienā nepietiek tikai ar dzimtās valodas zināšanām, nepieciešama vēl kāda valoda. Vēl joprojām vadošā sazināšanās valoda pasaulē ir angļu valoda, tāpēc arī Latvijā bērni šo valodu apgūst jau sākumskolā. Tomēr ne visiem tā padodas un ne visi bērni ir motivēti mācīties, tāpēc skolotājam ir jāmeklē tādas metodes, kuras palīdzētu un motivētu bērnus apgūt angļu valodu. Diplomdarba „Dziesmu, spēļu un ...

  14. Tipizētās JavaScript valodas izmantošana tīmekļa lietojumprogrammu izstrādei

    OpenAIRE

    Puzanovs, Vladimirs

    2015-01-01

    Pēdējā laikā tīmekļa programmēšanā, precīzāk, tīmekļa lietojumprogrammu izstrādē, pieaug tipizēto JavaScript valodas paveidu popularitāte. Tie iekļauj JavaScript valodā statisko tipizāciju, kā arī vairākas tradicionālu objektorientētu valodu paradigmas. Pašlaik līderi šajā jomā ir Microsoft ar savu TypeScript valodu, bet arī Google un Facebook darbojās šajā virzienā – izstrādā, respektīvi, AtScript un Flow valodas. Maģistra darbā tiek izpētītas šo valodu iespējas, to atšķirības, kā arī tiek n...

  15. Lietišķās angļu valodas intensificēšanas iespējas studiju procesā

    OpenAIRE

    Ate, Inese

    2006-01-01

    Dotā maģistra darba tēma ir “Lietišķās angļu valodas apguves intensificēšanas iespējas studiju procesā” Maģistra darba galvenā ideja ir balstīta uz atziņu, ka studiju procesam ir jaunas mūsdienu sabiedrības izvirzītas vajadzības. Valodas apgūšanai jānorit vienlaicīgi ar tādām svarīgām šodienas realitātes iezīmēm, kā aktīvu ieinteresētību, pašapliecināšanos un spēju pielietot apgūtās prasmes sevis pilnveidošanai. Daudzi svešvalodu mācīšanas teorijas pētnieki pēdējā laikā vairāk uzmanības...

  16. Control of aphid-vectored and thrips-borne virus spread in lily, tulip, iris and dahlia by sprays of mineral oil, polydimethylsiloxane and pyrethroid insecticide in the field

    National Research Council Canada - National Science Library

    Asjes C J; Blom-Barnhoorn G L

    2001-01-01

    In this study control of spread by insect vectors of non-persistent Lily symptomless virus and Lily mottle virus in lily, Tulip breaking virus in tulip, Iris mild mosaic virus, Narcissus latent virus...

  17. Simultaneous detection of three lily viruses using Triplex IC-RT-PCR.

    Science.gov (United States)

    Zhang, Yubao; Wang, Yajun; Xie, Zhongkui; Yang, Guo; Guo, Zhihong; Wang, Le

    2017-11-01

    Viruses commonly infecting lily (Lilium spp.) include: Lily symptomless virus (LSV), Cucumber mosaic virus (CMV) and Lily mottle virus (LMoV). These viruses usually co-infect lilies causing severe economic losses in terms of quantity and quality of flower and bulb production around the world. Reliable and precise detection systems need to be developed for virus identification. We describe the development of a triplex immunocapture (IC) reverse transcription (RT) polymerase chain reaction (PCR) assay for the simultaneous detection of LSV, CMV and LMoV. The triplex IC-RT-PCR was compared with a quadruplex RT-PCR assay. Relative to the quadruplex RT-PCR, the specificity of the triplex IC-RT-PCR system for LSV, CMV and LMoV was 100% for field samples. The sensitivity of the triplex IC-RT-PCR system was 99.4%, 81.4% and 98.7% for LSV, CMV and LMoV, respectively. Agreement (κ) between the results obtained from the two tests was 0.968, 0.844 and 0.984 for LSV, CMV and LMoV, respectively. This is the first report of the simultaneous detection of LSV, CMV and LMoV in a triplex IC-RT-PCR assay. In particular we believe this convenient and reliable triplex IC-RT-PCR method could be used routinely for large-scale field surveys or crop health monitoring of lily. Copyright © 2017. Published by Elsevier B.V.

  18. Control review of air-borne tulip breaking virus and lily symptomless virus in Lilium in the Netherlands

    NARCIS (Netherlands)

    Asjes, C.J.; Blom-Barnhoorn, G.J.; Piron, P.G.M.; Harrewijn, P.; Oosten, van A.M.

    1998-01-01

    In this study on the air-borne viruses in Lilium, mainly lily symptomless virus (LSV) and tulip breaking virus (TBV), various factors involved in the efficiency of control are dealt with. The incidence of LSV was reduced very substantially from the old 100␛ate. TBV occurs at fairly low rates. Lily

  19. Effect of postharvest treatments on the longevity of cut inflorescences of ‘Rialto’ oriental lily

    OpenAIRE

    Rabiza-Świder Julita; Skutnik Ewa; Jędrzejuk Agata; Ratuszek Marlena

    2015-01-01

    Cut lily flowers are very popular but their longevity is not satisfactory. The quality of cut lily flowers is determined by two factors: the longevity of the flowers and the general appearance of the entire cut stem during its vase life. The aim of this work was to evaluate the effects of gibberellic acid (GA3), standard preservative (8HQC and 2% sucrose) and commercial preservatives Chrysal Professional 2 and Chrysal sachet as well as Floralife 200 and Floralife 300 on the quality of ‘Rialto...

  20. Filmu izmantošana kā motivācijas veicinātājs vācu valodas kā otrās svešvalodas stundās skolēniem ar priekšzināšanām

    OpenAIRE

    Kalēja, Agnese

    2016-01-01

    Diplomdarbā pētīts jautājums, cik efektīva un motivējoša ir filmu skatīšanās mācību stundu laikā, lai apgūtu svešvalodu un iegūtu informāciju par apkārtējo pasauli. Tēma tika izvēlēta, jo neskatoties uz to, ka daudzi skolēni izvēlas vācu valodu kā otro svešvalodu, viņiem joprojām trūkst motivācijas darbam. Šī darba mērķis ir izpētīt, kā filma ietekmē skolēnu mācību motivāciju, vācu valodas kā svešvalodas stundās. Teorētiskajā daļā aplūkoti mediju didaktikas jautājumi un izpētīts, cik efektīv...

  1. Studi Tingkat Ploidi pada Lili (Lilium sp. Hasil Kultur Antera Melalui Penghitungan Jumlah Kloroplas dan Kromosom

    Directory of Open Access Journals (Sweden)

    Dewi Pramanik

    2016-12-01

    Full Text Available Lili (Lilium sp. termasuk famili Liliaceae, merupakan tanaman hias yang memiliki nilai ekonomi tinggi karena permintaan konsumen terus meningkat. Permintaan varietas tanaman yang seragam menuntut pengembangan hibrida F1. Perakitan tanaman hibrida dapat dihasilkan melalui pembentukan tanaman haploid. Salah satu metode untuk memproduksi tanaman haploid adalah dengan kultur antera.  Pengecekan tanaman hasil kultur antera dapat dilakukan dengan penghitungan  jumlah kloroplas dan jumlah kromosom, namun untuk lili hasil belum diperoleh informasi mengenai korelasi antara jumlah kloroplas pada sel penjaga stomata dengan jumlah kromosom, sehingga tujuan penelitian ini adalah untuk mengatahui korelasi antara jumlah kloroplas dengan jumlah kromosom serta mengetahui tingkat ploidi pada regeneran lili hasil kultur antera. Penelitian ini dilaksanakan di Laboratorium Kultur Jaringan Balai Penelitian Tanaman Hias (BALITHI Cianjur dari Januari-Juni 2016.  Terdapat 5 nomor lili yang diuji tingkat ploidinya.  Setiap nomor terdiri dari 4 ulangan, setiap ulangan ada 4 botol dan  masing-masing botol terdiri dari 3 planlet. Metode analisis yang digunakan yaitu statistik sederhana rata-rata dan standar eror dan dikorelasikan. Hasil penelitian menunjukkan planlet haploid terbanyak ditemukan pada nomor 2015.1.1 kelompok Longiflorum dengan jumlah 26,67% sedangkan planlet haploid yang jumlahnya paling sedikit ditemukan pada nomor 2015.S2.3 kelompok Oriental dengan jumlah 11,11%. Metode kultur antera dapat menghasilkan planlet haploid namun pada Lilium sp. persentase keberhasilannya masih rendah. Tidak diperoleh korelasi antara jumlah kloroplas dan kromosom. Penelitian lebih lanjut terkait tingkat ploidi tanaman lili dan pengujian jumlah kromosom dengan menggunakan flowcytometer perlu dilakukan.  Lily (Lilium sp., Liliaceae family, is an ornamental plant that has a high economic value as consumer demand continues to rise. The uniformity of crop varieties requires the

  2. Latviešu valodas prasmju attīstīšanas veicināšana mazākumtautības pirmsskolas izglītības iestādē

    OpenAIRE

    Radionova, Alla

    2017-01-01

    Darba autore : Alla Radionova Darba veids: Diplomdarbs Studiju programma: Pirmsskolas izglītības skolotājs Darba zinātniskā vadītāja: Ieva Margeviča-Grinberga, Latvijas Universitātes docente Mērķis: Izpētīt latviešu valodas prasmju attīstības veicināšanas iespējas mazākumtautības pirmsskolas izglītības iestādē. Pētījuma hipotēze: pirmsskolas vecuma bērnam otrās valodas apguve būs sekmīga, ja: •bērni nodarbību laikā izjutīs pozitīvu noskaņojumu un interesi par otrās valodas mācīšanos; •p...

  3. Genetic and physiological aspects of postharvest flower longevity in Asiatic hybrid lilies (Lilium L.)

    NARCIS (Netherlands)

    Meulen-Muisers, van der J.J.M.

    2000-01-01

    In The Netherlands Lilium is economically the fourth overall flower crop for cut flower production. Longevity is a main quality characteristic for cut flowers. During postharvest handling of Asiatic hybrid lilies pretreatment with chemical solutions containing silver is

  4. A molecular cytogenetic study of intergenomic recombination and introgression of chromosomal segments in lilies (Lilium)

    NARCIS (Netherlands)

    Nadeem Khan, M.

    2009-01-01

    Lilies (Lilium L.) are one of the most important ornamental bulbous crops for cut flower industry grown extensively in The Netherlands for last few decades. The genus Lilium consists of seven different sections with about 80 species. The species within genus Lilium (2n = 2x = 24) comprise a range

  5. Water lily sign and serpent sign in pulmonary hydatid cystic disease

    Directory of Open Access Journals (Sweden)

    Ashish Ranjan

    2017-01-01

    Full Text Available The teaching image depicts sections of CT chest showing water lily sign and serpent sign. In the diagnosis of pulmonary hydatid disease, these signs are pathognomonic, these must be corroborated clinically, and early interventions should be done to avoid rupture of cysts leading to complications.

  6. Control strategies with reduced fungicide input for Botrytis leaf blight in lily - a simulation analysis

    NARCIS (Netherlands)

    Kraker, de J.; Ende, van den J.E.; Rossing, W.A.H.

    2005-01-01

    Leaf blight, caused by the pathogen Botrytis elliptica (Berk.) Cooke, is the most important foliar disease in ornamental lily cultivation. The conventional control strategy of Dutch bulb growers is to apply protective fungicides at weekly intervals from crop emergence until harvest. We applied

  7. Effect of floral bud reduction on flower longevity in Asiatic hybrids lilies.

    NARCIS (Netherlands)

    Meulen-Muisers, van der J.J.M.; Oeveren, van J.C.; Sandbrink, J.M.; Tuyl, van J.M.

    1995-01-01

    Floral bud abortion was found to be an undesirable source of non-genetic variation in breeding trials directed on the improvement of individual flower longevity in Asiatic hybrid lilies. It increased the longevity of the remaining flowers of the inflorescence. A similar response was found after

  8. The use of morphogenic suspension cultures for the development of a protoplast regeneration system in lily

    NARCIS (Netherlands)

    Famelaer, L.; Bordas, M.; Baliu', E.; Ennik, E.; Meijer, H.; Tuyl, van J.M.; Creemers-Molenaar, J.

    1997-01-01

    The present study reports data on the development of a protoplast regeneration procedure in lily. Established morphogenic suspension cultures were obtained from callus cultures induced on mature embryos from crosses between cultivars of L. longiflorum. The effect on the frequency of protoplast

  9. Molecular markers as a tool for breeding for flower longevity in Asiatic hybrid lilies.

    NARCIS (Netherlands)

    Meulen, van der J.J.M.; Oeveren, van J.C.; Sandbrink, J.M.; Tuyl, van J.M.

    1996-01-01

    Segregation of flower longevity in two lily populations was studied and the genetic linkage of morphological markers and RAPD markers with loci involved in flower longevity was investigated. A large variation in flower longevity was found within the two populations tested at individual plant level.

  10. In vitro direct organogenesis in response to floral reversion in lily

    African Journals Online (AJOL)

    Sony

    2016-11-02

    Nov 2, 2016 ... Our previous study indicated that the tiger lily (Lilium lancifolium var. Flore Pleno) has a great ability to produce inflorescence bulbils in nature as a form of natural phenomenon of floral reversion in plants. This present research was carried out to investigate the artificial floral reversion in in vitro culture of.

  11. Inflorescence bulbils of tiger lily in vivo and bulbils culture in vitro ...

    African Journals Online (AJOL)

    The present study includes two experiments; the physiological and the biotechnological experiments. The physiological experiment was designed to investigate the most interesting rare natural phenomenon of the development of vegetative reproductive organs (bulbils) in the inflorescence of tiger lily. In the other hand, the ...

  12. Global transcriptome profiling analysis of inhibitory effects of paclobutrazol on leaf growth in lily (Lilium Longiflorum-Asiatic hybrid

    Directory of Open Access Journals (Sweden)

    Xiaopei eZhu

    2016-04-01

    Full Text Available As a popular ornamental flower, potted lily is an important object of lily breeding. Paclobutrazol, a chemical growth retardation compound, is often used to dwarf plant in producing potted lilies. However, in recent years, the plants with inherited dwarf traits by using genetic engineer breeding technology are being developed. The studies on molecular basis of lily dwarfism will offer some target genes which have profound dwarf effect for genetic engineer breeding. Here, we confirmed that paclobutrazol inhibited plant height and leaf size in Lilium Longiflorum-Asiatic hybrid, and then RNA-Seq technique was employed to analyze gene transcripts of Lilium Longiflorum-Asiatic hybrid leaves by paclobutrazol treatment in order to get a deeper insight into dwarfism mechanism of lily. Approximately 38.6 Gb data was obtained and assemble into 53,681 unigenes. Annotation, pathways, functional classification and phylogenetic classification of these data were analyzed based on Nr, Nt, Swiss-Prot, KEGG, COG and GO databases. 2,704 differentially expressed genes were screened by comparing paclobutrazol-treated samples with untreated samples and quantitative real-time PCR was performed to validate expression profiles. By analyzing dynamic changes of differentially expressed genes, nine metabolic pathways and signal transduction pathways were significantly enriched and many potentially interesting genes were identified that encoded putative regulators or key components of cell division, cell expansion, GA metabolism and signaling transduction and these genes were highlighted to reveal their importance in regulation of plant size. These results will provide a better understanding of the molecular mechanism on lily dwarfism and some potential genes related to lily organ size, which will lay the foundation for molecular breeding of potted lilies. These transcriptome data will also serve as valuable public genomic resources for other genetic research in lily.

  13. FIRST RECORD OF PHYTOPHAGOUS BUG PARAFURIUS DISCIFER (STÄL, 1860 (HEMIPTERA: MIRIDAE ATTACKING OF CALLA LILY IN BRAZIL

    Directory of Open Access Journals (Sweden)

    Lívia Mendes Carvalho

    2011-07-01

    Full Text Available The calla lily is a cut flower highly appreciated in the composition of floral arrangements and gardens. The calla lily is susceptible to pests that affect plant and the lack of technologies for pest control is difficult due to the increase in the indiscriminate use of insecticides. In São João del Rei, State of Minas Gerais (21º 08' 00" S, 44º 15' 40" W it was first recorded the occurrence of phytophagous bug Parafurius discifer (Stäl, 1860 (Hemiptera: Miridae attacking leaves of calla lily in Brazil. This species has the potential to be a pest of calla lily and therefore damage this orfirstnamental plant. A better knowledge of this species could help in the search for alternative control more effective and sustainable.

  14. Characterization of Phyllosticta hostae causing Phyllosticta leaf spot on spider lily in China

    Directory of Open Access Journals (Sweden)

    Yi Run Hua

    2015-12-01

    Full Text Available Leaf spot disease on the spider lily [Hymenocallis littoralis (Jacq. Salisb.] continues to cause serious problems in China. To confirm the pathogen, the pathogenicity of isolates from diseased leaves was tested according to Koch’s postulates. The isolates were tentatively identified using morphological characteristics and confirmation was done by phylogenetic analysis of the translation elongation factor 1-alpha gene (TEF1, the actin gene (ACT, and internal transcibed spacer (ITS sequences using neighbor-joining (NJ, maximum parsimony (MP, and Bayesian inference (BI methods. The pathogen was identified as Phyllosticta hostae. Molecular analysis indicated very little diversity in the TEF1, ACT, and ITS gene. This is the first report of P. hostae causing leaf spot disease on spider lily in China.

  15. No pain, no gain... O discurso da corpolatria em “Lili & Elizete”

    Directory of Open Access Journals (Sweden)

    Francisco Vieira da Silva

    2015-03-01

    Full Text Available Neste texto, objetivamos analisar o discurso da corpolatria nas tiras Lili & Elizete, de Caco Galhardo. Para tal intento, situamos nosso olhar investigativo no âmbito das reflexões de Ortega (2003; 2006 acerca das práticas bioascéticas contemporâneas. Nas tiras analisadas, verificamos que o humor reside na reiteração do discurso da corpolatria, de modo a compor uma heterogeneidade de posições enunciativas. Assim, na estabilidade das conversas entre as amigas Lili e Elizete, não raro se constata o duelo entre uma posição de recusa à biossiabilidade e uma posição que a defende de modo ferrenho.

  16. The Dialectic of Silence and Remembrance in Lily Brett's 'Things Could Be Worse'

    OpenAIRE

    Botez, Catalina

    2011-01-01

    The dynamics of silence and silencing in Australian writer Lily Brett’s autobiographic fiction Things Could Be Worse reflects the crisis of memory and understanding experienced by both first and second-generation Holocaust survivors within the diasporic space of contemporary Australia. It leads to issues of handling traumatic and transgenerational memory, the latter also known as postmemory (M. Hirsch), in the long aftermath of atrocities, and problematises the role of forgetting in shielding...

  17. The application of fluorescence in situ hybridization in different ploidy levels cross-breeding of lily.

    Science.gov (United States)

    Wang, Qing; Wang, Jingmao; Zhang, Yiying; Zhang, Yue; Xu, Shunchao; Lu, Yingmin

    2015-01-01

    21 crossing were conducted between Asiatic Lily with different ploidy levels, the results showed that the interploidy hybridization between diploid and tetraploid lilies was not as successful as intraploidy hybridization. Regardless of male sterility, triploid lilies could be used as female parents in the hybridization which the progenies were aneuploidy. 3x×4x crosses could be cultured more successfully than 3x×2x crosses. 45S rDNA was mapped on the chromosomes of seven Lilium species and their progenies using fluorescence in situ hybridization (FISH). FISH revealed six to sixteen 45S rDNA gene loci, and normally the sites were not in pairs. The asymmetry indexes of LA (Longiflorum hybrids × Asiatic hybrids) hybrids was higher than Asiatic hybrids, the evolution degree was LA hybrids > Asiatic hybrids. 45S rDNA distributed variably on chromosome 1-10 and 12 among Asiatic hybrids. Chromosome 1 had invariable sites of 45S rDNA in all Asiatic hybrids, which could be considered as the characteristic of Asiatic hybrids. LA hybrid 'Freya' had two sites of 45S rDNA on one homologous chromosome 5, and also it could be found in the progenies. The karyotype and fluorescence in situ hybridization with 45S rDNA as probe were applied to identify the different genotypes of 9 hybrids. Typical chromosomes with parental signal sites could be observed in all the genotypes of hybrids, it was confirmed that all the hybrids were true.

  18. Water relations in calla lily flower stems harvested at different opening stages(

    Directory of Open Access Journals (Sweden)

    Thais Silva Sales

    2015-12-01

    Full Text Available Cut flowers are a well established product and require conservation techniques that help keep postharvest quality for marketing. In this context, the objective of this study was to evaluate different opening stages of calla lily (Zantedeschia aethiopica cut stems and their influence on posthaverst. Calla lily stems were harvested in the morning, according to the following opening stages: closed spathe, semi-closed spathe (1/3 open, semi-open spathe (2/3 open and fully open spathe. Once selected and standardized, stems were placed in a controlled room at 21 ± 2 °C and relative humidity of 75 ± 5%, for eight days. The evaluations were conducted daily, observing water pH, commercial quality analysis, width and length of the spathe, fresh weight of stem, water absorption and transpiration. The experimental design was completely randomized, with four treatments (opening stages, five replicates and two stems by plot. The model used was split plot in time, with harvest stages as plots, and evaluation days as subplots. Calla lily harvested at closed spathe and semi-closed spathe (1/3 open, showed spathe opening, although it did not achieve fully spathe expansion, had higher water uptake and hydration of flower stems, and increased water retention capacity by floral tissues until saturation, followed by a period of weight reduction caused by transpiration rates greater than absorption.

  19. Ziziphi spinosae lily powder suspension in the treatment of depression-like behaviors in rats.

    Science.gov (United States)

    Wang, Yifang; Huang, Mei; Lu, Xinyi; Wei, Runze; Xu, Jinyong

    2017-04-28

    Depression is a chronic, recurring and potentially life-threatening illness. Current treatments for depression are characterized by a low success rate and associated with a wide variety of side effects. The aim of the present study was to evaluate the behavioral anti-depressant effect of a novel herbal compounds named ziziphi spinosae lily powder suspension, as well as to investigate its potential mechanisms. Except for body weight, depressive-like behaviors were also evaluated using forced swimming test, sucrose consumption test and open field test. In order to investigate the underlying potential mechanisms, serum 5-HT and brain 5-HIAA were measured using ultrahigh-performance liquid chromatography and high-performance liquid chromatography, respectively. Results showed that the herbal compounds ziziphi spinosae lily suspension could alleviate depressive symptoms in rat model of chronic depression. Biochemical analysis revealed that the herbal compounds elevated serum 5-HT and brain 5-HIAA. Ziziphi spinosae lily powder suspension could alleviate depressive behaviors in depression model animals. The underlying mechanisms may be related to the increase of serum 5-HT in peripheral blood and 5-HIAA in brain. The study provides important mechanistic insights into the protective effect of the herbal compounds against chronic depressive disorder and suggests that the herbal compounds may be a potential pharmacological agent for treatment of major depressive disorder.

  20. Reference gene selection for gene expression studies in lily using quantitative real-time PCR.

    Science.gov (United States)

    Zhang, M F; Liu, Q; Jia, G X

    2016-04-29

    Quantitative real-time polymerase chain reaction (qRT-PCR) is an important technology used to analyze gene-expression levels. Reference genes, which are assumed to be expressed consistently across various developmental stages and in different tissues, were selected for expression level analysis. Using digital gene expression technology, we selected nine reference genes (18S, EF, CYCOL, SAND, GAPDH, ACTIN, BHLH, TIP, and Clathrin) as candidate reference genes for further study. Using three different analysis methods (GeNorm, NormFinder, and BestKeeper), a total of 144 lily (Lilium x formolongi "Raizan 3") samples were analyzed. The samples were collected from four different tissues under various developmental stages. In addition, leaves treated with different plant hormones were collected and analyzed. The data showed that the stability of the nine reference genes differed among samples, but TIP, EF, Clathrin, and BHLH could be identified as the most stable genes overall. In addition, the relative expression level of LfFT in different lily tissues with the competence to flower was also analyzed to verify the selected reference genes. This study constitutes an important source for selecting reference genes when analyzing the expression patterns of flowering time and floral development regulation genes in lily cultivars.

  1. Rhizopus Soft Rot on Lily Caused by Rhizopus oryzae in Korea

    Directory of Open Access Journals (Sweden)

    Soo-Sang Hahm

    2014-03-01

    Full Text Available Rhizopus soft rot of lily (Lilium longiflorum caused by Rhizopus oryzae was observed in the experimental field in Taean Lily Experiment Station in Korea, 2012. The typical symptoms were water-soaked lesions on bottom stem and leaf rot. The lesion rapidly expanded and the plant was softened totally. The fungus grew vigorously at an optimum temperature (25oC and brownish colony and black sporangia were formed on potato dextrose agar medium. Sporangiophores formed on end of sporangia were sub-globose, brownish and 6-10 μm in size. Sporangia were globose, blackish and 87-116 μm in size. Sporangiospores were irregularly oval and sub-globose, brownish 4-8 μm in size. On the basis of mycological characteristics, analyzing sequences of internal transcribed spacer region of ribosomal DNA, and pathogenicity test on host plants, the causal fungus was identified as R. oryzae. This is the first report of Rhizopus soft rot on lily caused by R. oryzae in Korea.

  2. JavaScript valodas pielietojums kvalitatīva tīmekļa vietņu pirmkoda veidošanā

    OpenAIRE

    Orlovs, Mihails

    2014-01-01

    Tīmekļa tehnoloģijas attīstās ļoti strauji, katru dienu parādās jaunas tīmekļa vietnes. Bet to kvalitātes līmenis ir samērā zems. Ir ļoti maz tīmekļa vietņu, kuras cilvēkiem ir patīkami apmeklēt. Visas pārējās vai nu slikti izskatās vai lēni strādā. Darba mērķis ir sameklēt risinājumu, kā ar JavaScript valodas palīdzību var uzlabot tīmekļa vietņu kvalitāti. Darba izvirzītie uzdevumi ir sameklēt iespējas, kā uzlabot tīmekļa vietnes pirmkoda kvalitāti un, kā arī izveidot savus rīkus, kas ...

  3. Angļu valodas vārdu krājuma apgūšana izmantojot datorspēles

    OpenAIRE

    Vegners, Emīls

    2013-01-01

    Šis pētījums ir balstīts uz uzskatu, ka datorspēles nesniedz nekādu ieguldījumu, bet tikai paaugstina iespēju izcelties vardarbīgām situācijām un, ka datorspēles ir radītas tikai lai pavadītu laiku. Šī pētījuma mērķis ir cīnīties ar uzskatu, ka datorspēles nesniedz pozitīvu vērtību Angļu valodas vārdu krājuma apguvē un attīstībā. Par pamatu šim pētījumam tika izmantota pašnovērošana (introspekcija) un atskats pagātnē (retrospekcija). Tika veikta aptauja, lai noskaidrotu datorspēļu ietek...

  4. Characterization of calla Lily sot rot caused by Pectobacterium Carotovorum subsp. Carotovorum ZT0505 bacterial growth and pectate lyase activity under different conditions.

    NARCIS (Netherlands)

    Ni, L.; Guo, L.; Custers, J.B.M.; Zhang, L.

    2010-01-01

    Soft rot is a major disease of calla lily (Zantedeschia spp.) and other important crops worldwide. In this report, the bacterial isolate ZT0505 proved to be a soft rot pathogen of calla lily growing around Kunming (subtropical China) and was identified as Pectobacterium carotovorum subsp.

  5. Assessment of flavonoids and volatile compounds in tea infusions of water lily flowers and their antioxidant activities.

    Science.gov (United States)

    Yin, Dan-Dan; Yuan, Ru-Yu; Wu, Qian; Li, Shan-Shan; Shao, Shuai; Xu, Yan-Jun; Hao, Xiang-Hong; Wang, Liang-Sheng

    2015-11-15

    Water lily, a member of the Nymphaeaceae family, can be made into tea on the basis of outstanding fragrance characteristics and health care functions. In this study, 16 flavonoids were identified and quantified in tea infusions prepared from the petals of 33 water lily cultivars using HPLC-DAD and HPLC-ESI-MS/MS. The infusions were analyzed with HS-SPME coupled with GC-MS; 29 volatile compounds were detected, of which nine were found to be scent components. The cultivars were clustered into three clusters characterized according to scent components. The 'Conqueror' and 'Virginia' cultivars had the highest antioxidant activities. The concentrations of polyphenols and flavonoids showed significant positive correlations with antioxidant activity as measured by DPPH, ABTS(+), and FRAP assays. This study is valuable for a fuller understanding of this important tea and can also be used for the development of water lily. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Control of aphid-vectored and thrips-borne virus spread in lily, tulip, iris and dahlia by sprays of mineral oil, polydimethylsiloxane and pyrethroid insecticide in the field

    NARCIS (Netherlands)

    Asjes, J.; Blom-Barnhoorn, G.J.

    2001-01-01

    In this study control of spread by insect vectors of non-persistent Lily symptomless virus and Lily mottle virus in lily, Tulip breaking virus in tulip, Iris mild mosaic virus, Narcissus latent virus and Iris severe mosaic virus in bulbous iris, and semi-persistent Dahlia mosaic virus and persistent

  7. Relationship between the composition of flavonoids and flower colors variation in tropical water lily (Nymphaea cultivars.

    Directory of Open Access Journals (Sweden)

    Manlan Zhu

    Full Text Available Water lily, the member of the Nymphaeaceae family, is the symbol of Buddhism and Brahmanism in India. Despite its limited researches on flower color variations and formation mechanism, water lily has background of blue flowers and displays an exceptionally wide diversity of flower colors from purple, red, blue to yellow, in nature. In this study, 34 flavonoids were identified among 35 tropical cultivars by high-performance liquid chromatography (HPLC with photodiode array detection (DAD and electrospray ionization mass spectrometry (ESI-MS. Among them, four anthocyanins: delphinidin 3-O-rhamnosyl-5-O-galactoside (Dp3Rh5Ga, delphinidin 3-O-(2"-O-galloyl-6"-O-oxalyl-rhamnoside (Dp3galloyl-oxalylRh, delphinidin 3-O-(6"-O-acetyl-β-glucopyranoside (Dp3acetylG and cyanidin 3- O-(2"-O-galloyl-galactopyranoside-5-O-rhamnoside (Cy3galloylGa5Rh, one chalcone: chalcononaringenin 2'-O-galactoside (Chal2'Ga and twelve flavonols: myricetin 7-O-rhamnosyl-(1 → 2-rhamnoside (My7RhRh, quercetin 7-O-galactosyl-(1 → 2-rhamnoside (Qu7GaRh, quercetin 7-O-galactoside (Qu7Ga, kaempferol 7-O-galactosyl-(1 → 2-rhamnoside (Km7GaRh, myricetin 3-O-galactoside (My3Ga, kaempferol 7-O-galloylgalactosyl-(1 → 2-rhamnoside (Km7galloylGaRh, myricetin 3-O-galloylrhamnoside (My3galloylRh, kaempferol 3-O-galactoside (Km3Ga, isorhamnetin 7-O-galactoside (Is7Ga, isorhamnetin 7-O-xyloside (Is7Xy, kaempferol 3-O-(3"-acetylrhamnoside (Km3-3"acetylRh and quercetin 3-O-acetylgalactoside (Qu3acetylGa were identified in the petals of tropic water lily for the first time. Meanwhile a multivariate analysis was used to explore the relationship between pigments and flower color. By comparing, the cultivars which were detected delphinidin 3-galactoside (Dp3Ga presented amaranth, and detected delphinidin 3'-galactoside (Dp3'Ga presented blue. However, the derivatives of delphinidin and cyanidin were more complicated in red group. No anthocyanins were detected within white and yellow group

  8. Relationship between the composition of flavonoids and flower colors variation in tropical water lily (Nymphaea) cultivars.

    Science.gov (United States)

    Zhu, Manlan; Zheng, Xuchen; Shu, Qingyan; Li, Hui; Zhong, Peixing; Zhang, Huijin; Xu, Yanjun; Wang, Lijin; Wang, Liangsheng

    2012-01-01

    Water lily, the member of the Nymphaeaceae family, is the symbol of Buddhism and Brahmanism in India. Despite its limited researches on flower color variations and formation mechanism, water lily has background of blue flowers and displays an exceptionally wide diversity of flower colors from purple, red, blue to yellow, in nature. In this study, 34 flavonoids were identified among 35 tropical cultivars by high-performance liquid chromatography (HPLC) with photodiode array detection (DAD) and electrospray ionization mass spectrometry (ESI-MS). Among them, four anthocyanins: delphinidin 3-O-rhamnosyl-5-O-galactoside (Dp3Rh5Ga), delphinidin 3-O-(2"-O-galloyl-6"-O-oxalyl-rhamnoside) (Dp3galloyl-oxalylRh), delphinidin 3-O-(6"-O-acetyl-β-glucopyranoside) (Dp3acetylG) and cyanidin 3- O-(2"-O-galloyl-galactopyranoside)-5-O-rhamnoside (Cy3galloylGa5Rh), one chalcone: chalcononaringenin 2'-O-galactoside (Chal2'Ga) and twelve flavonols: myricetin 7-O-rhamnosyl-(1 → 2)-rhamnoside (My7RhRh), quercetin 7-O-galactosyl-(1 → 2)-rhamnoside (Qu7GaRh), quercetin 7-O-galactoside (Qu7Ga), kaempferol 7-O-galactosyl-(1 → 2)-rhamnoside (Km7GaRh), myricetin 3-O-galactoside (My3Ga), kaempferol 7-O-galloylgalactosyl-(1 → 2)-rhamnoside (Km7galloylGaRh), myricetin 3-O-galloylrhamnoside (My3galloylRh), kaempferol 3-O-galactoside (Km3Ga), isorhamnetin 7-O-galactoside (Is7Ga), isorhamnetin 7-O-xyloside (Is7Xy), kaempferol 3-O-(3"-acetylrhamnoside) (Km3-3"acetylRh) and quercetin 3-O-acetylgalactoside (Qu3acetylGa) were identified in the petals of tropic water lily for the first time. Meanwhile a multivariate analysis was used to explore the relationship between pigments and flower color. By comparing, the cultivars which were detected delphinidin 3-galactoside (Dp3Ga) presented amaranth, and detected delphinidin 3'-galactoside (Dp3'Ga) presented blue. However, the derivatives of delphinidin and cyanidin were more complicated in red group. No anthocyanins were detected within white and

  9. Outcome following gastrointestinal tract decontamination and intravenous fluid diuresis in cats with known lily ingestion: 25 cases (2001-2010).

    Science.gov (United States)

    Bennett, Alice J; Reineke, Erica L

    2013-04-15

    To describe the outcome of cats treated with gastrointestinal tract decontamination, IV fluid diuresis, or both after ingestion of plant material from lilies of the Lilium and Hemerocallis genera. Design-Retrospective case series. 25 cats evaluated after ingestion of lily plants. Medical records of cats examined at the Matthew J. Ryan Veterinary Hospital of the University of Pennsylvania with known lily ingestion between July 2001 and April 2010 were reviewed. Inclusion in the study required evidence of lily plant ingestion within the preceding 48 hours. Type of lily ingested, time of ingestion, gastrointestinal tract decontamination procedures performed, and IV fluid diuresis were recorded. The presence or absence of acute kidney injury was determined by evaluating BUN concentration, creatinine concentration, and urine specific gravity. Outcome was defined as survival to discharge, death, or euthanasia. The time from ingestion until evaluation at the Matthew J. Ryan Veterinary Hospital of the University of Pennsylvania ranged from diuresis, supportive care, and monitoring. Seventeen of these 23 (74%) cats had normal BUN and creatinine concentrations throughout hospitalization. At the time of discharge from the hospital, 2 of the 23 (9%) hospitalized cats had an increased BUN concentration, creatinine concentration, or both. All 25 (100%) cats survived to discharge from the hospital. In this series of cats treated with gastrointestinal tract decontamination, IV fluid diuresis, or both within 48 hours after lily ingestion, the outcome was good, with a low incidence of acute kidney injury. Future studies are needed to determine the most effective gastrointestinal tract decontamination procedures and optimal duration of IV fluid therapy.

  10. Identification of anther-specific/predominant genes regulated by gibberellin during development of lily anthers.

    Science.gov (United States)

    Hsu, Yi-Feng; Tzeng, Jhih-Deng; Liu, Ming-Che; Yei, Fung-Ling; Chung, Mei-Chu; Wang, Co-Shine

    2008-01-01

    We successfully identify anther-specific/predominant genes induced by gibberellin (GA) at the microspore stage of lily (Lilium longiflorum) anthers. We used a suppression-subtractive hybridization strategy to identify 22 individual cDNAs followed by a reverse RNA dot plot to determine their specificities at the microspore stage. Of the 22 genes, 12 are clearly anther-specific and three are anther-predominant. Sequence analysis revealed that five anther-specific/predominant genes are novel. The transcripts of anther-specific/predominant genes were differentially detected at the microspore development phase; some began accumulating in level as early as the occurrence of meiosis. When uniconazole, an inhibitor of GA biosynthesis was applied in young lily plants we found that all of the anther-specific/predominant genes, with the exception of LLA-139, were up-regulated by GAs in the anther while only some were responsive to the exogenous addition of 100 microM GA3. In situ hybridization with antisense riboprobes of selected genes in the anther showed a strong signal localized to the tapetal layer. The different actions of GA on gene expression in anthers are discussed.

  11. Treatment and Analysis of a Paint Chip from "Water Lilies": A Fire Damaged Monet

    Science.gov (United States)

    Miller, Sharon K. R.; Banks, Bruce A.; Tollis, Greg

    2001-01-01

    A museum fire in 1958 severely damaged a Monet 'Water Lilies' (1916-1926) painting that was on display. The surface of the painting is very dark with areas of blistering and charring. Over the years, traditional techniques have been found to be ineffective at removal of the soot and char from the surface. The painting, which is now in the care of the New York University (NYU) Conservation Center of the Institute of Fine Arts, was the subject of a study to determine if atomic oxygen treatment could remove the soot and char without damaging the fragile painting underneath. For test purposes, a small chip of paint was removed from the edge of the painting by a conservator at NYU and supplied to NASA Glenn Research Center for atomic oxygen treatment and analysis. The diffuse spectral reflectance, at three locations on the paint chip, was monitored at intervals during the atomic oxygen treatment process. Photo documentation of the chip during treatment was also performed. The color contrast was calculated from the spectral reflectance data as a function of treatment duration. Results of the testing indicated that the contrast improved as a result of the treatment, and the differentiation of colors on the surface was significantly improved. Soot and char could be removed without visibly affecting the gross surface features such as impasto areas. These results indicate the feasibility for the treatment of the 'Water Lilies' painting.

  12. Tropical Storm Isidore and Hurricane Lili: Louisiana barrier shoreline response, preliminary results

    Science.gov (United States)

    Sallenger, Asbury; Penland, Shea; Krabill, William

    2003-01-01

    In a cooperative effort between the U.S. Geological Survey, National Aeronautics and Space Administration, University of New Orleans, and Louisiana's Department of Natural Resources, Louisiana's barrier islands were surveyed with airborne topographic lidar and oblique aerialphotography both before and after the impacts of 2002's Tropical Storm Isidore and Hurricane Lili. The surveys were compared to quantify the magnitudes and patterns of erosion and accretion in both natural areas and areas that had been subjected to major restoration. Wave runup exceeded the elevation of the entire Isles Dernieres barrier chain creating overwash deposits that, in places, were driven landward ~ 300 m. This response was not as severe as observed during Hurricane Andrew in 1992 when the Isles Dernieres were completely and continuously inundated and sand bodies were driven landward on the order of 1 km. Based on a comparison of surveys before and after the combined impacts of Lili and Isidore, the largest shoreline change occurred at the east end of East Island and reached ~ 130 m of erosion.

  13. Molecular evolution of the Li/li chemical defence polymorphism in white clover (Trifolium repens L.).

    Science.gov (United States)

    Olsen, K M; Sutherland, B L; Small, L L

    2007-10-01

    White clover (Trifolium repens) is naturally polymorphic for cyanogenesis (hydrogen cyanide release following tissue damage). The ecological factors favouring cyanogenic and acyanogenic plants have been examined in numerous studies over the last half century, making this one of the best-documented examples of an adaptive polymorphism in plants. White clover cyanogenesis is controlled by two, independently segregating Mendelian genes: Ac/ac controls the presence/absence of cyanogenic glucosides; and Li/li controls the presence/absence of their hydrolysing enzyme, linamarase. In this study, we examine the molecular evolution and population genetics of Li as it relates to the cyanogenesis polymorphism. We report here that Li exists as a single-copy gene in plants possessing linamarase activity, and that the absence of enzyme activity in li/li plants is correlated with the absence of much or all of the gene from the white clover genome. Consistent with this finding, we confirm by reverse transcription-polymerase chain reaction that Li gene expression is absent in plants lacking enzyme activity. In a molecular population genetic analysis of Li and three unlinked genes using a worldwide sample of clover plants, we find an absence of nucleotide variation and statistically significant deviations from neutrality at Li; these findings are consistent with recent positive directional selection at this cyanogenesis locus.

  14. Eksāmena kārtošanas stratēģijas angļu valodas stundās 12. klases skolēnu sagatavošanai valsts centralizētajam angļu valodas eksāmenam

    OpenAIRE

    Fedotova, Svetlana

    2013-01-01

    Valsts centralizētajiem eksāmeniem ir liela ietekme uz skolēnu dzīvi. Tā ir arī liela atbildība skolotājiem sniegt visu nepieciešamu palīdzību, lai skolēni varētu nokārtot eksāmenus veiksmīgi. Tieši tāpēc, šī diplomdarba mērķis bija noskaidrot, kādas eksāmena kārtošanas stratēģijas varētu palīdzēt skolēniem sagatavoties valsts centralizētajam angļu valodas eksāmenam. Lai iepazīstinātu skolēnus ar eksāmena kārtošanas procedūru, iemācītu skolēnus pildīt uzdevumus, kas ir iekļauti katrā eksāmena...

  15. Application of Gamma Irradiation and Its Convergent Treatments on Several Varieties of Oriental Hybrid Lily to Control Leaf Blight

    Directory of Open Access Journals (Sweden)

    Ji-Hoon Kim

    2014-06-01

    Full Text Available In order to seek more eco-friend, economic and safer quarantine method than current methyl bromide fumigation, the convergent treatment with 200 Gy of gamma irradiation and several chemicals such as nano-siver particles (NSS, sodium dichloroisocyanurate (NaDCC was tried on the cuttings of lily in the packing of catonnage box for export. With 6 independent experiments of gamma irradiation on the three lily cultivars, cvs. Siberia, Le reve and Sorbonne, incidence and severity of lily leaf blight was investigated on leaves and petals at 8-d after infection. 200 Gy of gamma irradiation decreased at 13-25% of severity on the leaf of Sorbonne, but it increased at 2-5% of severity on the leaf of Siberia and Le reve. Chemical substitutes such as NSS and NaDCC were not effective to control of lily blight on cuttings. By 200 Gy of gamma irradiation treatment, chlorophyll contents were statistically significantly decreased at 12-d after irradiation and the longevities vaselife of fully open flower of Siberia and Sorbonne were increased at 0.4 to 1.2 days. In addition, the relative fresh weights of the gamma irradiated cuttings were severely dried compared to the non-irradiated control. On the other hands, the symptoms of phyto-toxicity of high dose gamma irradiation at 1 or 2 kGy on cv. Siberia were to be blight at the tip of bloom, bent necks of flower, and delayed the process of flowering.

  16. Freezing Tolerance of Bulb Scales of Lily Cultivars : Effects of Freezing and Storage Duration and Partial Dehydration

    NARCIS (Netherlands)

    Bonnier, Frans J.M.; Jansen, Ritsert C.; Tuyl, Jaap M. van

    1997-01-01

    Effects of freezing duration, previous storage duration of bulbs at -2 °C, and partial dehydration of scales on freezing tolerance of lily (Lilium hybrids) scales were studied for a series of cultivars. Freezing tolerance of scales was estimated by measuring ion leakage and recording scale bulblet

  17. Effect of low temperature on dormancy breaking and growth after planting in lily bulblets regenerated in vitro

    NARCIS (Netherlands)

    Langens-Gerrits, M.M.; Miller, W.B.; Croes, A.; Klerk, de G.J.M.

    2003-01-01

    Lilies regenerating on scale segments may develop dormancy in vitro depending on the culture conditions. The dormancy is broken by storage for several weeks at a low temperature ( 5 degreesC). The effect of the low temperature on sprouting, time of leaf emergence and further bulb growth was studied.

  18. 050. Water-lily sign in a patient without ruptured lung hydatid cyst

    Science.gov (United States)

    Konstantinou, Eleftheria; Tryfon, Stavros; Nikolaou, Konstantina; Karittevli, Melina; Madesis, Athanasios; Tsara, Venetia

    2015-01-01

    Background Our aim was the presentation of a case with clinico-radiologic findings compatible with ruptured echinococcus cyst that was not finally confirmed. Case presentation A 35-year-old female patient, who was evaluated previously at another hospital, because of recurrent episodes of pleurodynia, severe epigastric pain, vomiting and constipation during the last week is presented. The chest radiograph revealed a cyst which contains air in the left lower lung field. From her past medical history the patient reported a serious car-accident a year ago, for which she was admitted to ICU for two months. Laboratory testing revealed leukocytosis. An urgent CT scan of the chest and abdomen revealed a cyst in the left lower lobe of the lung containing a freely floating endocyst (the “water-lily sign”). This “water-lily” or “meniscus” sign denoting the entrance of air between the laminated membrane and the pericyst through a bronchopericystic fistula is observed as a thin, radiolucent crescent in the upper part of the cyst on plain radiography. The ultrasound examination revealed no evidence of rupture of the cavity within the abdomen or any hepatic involvement. Emergency gastroscopy followed, in which stomach contents were not allowed to complete the examination. The patient underwent emergency thoracic exploration. At operation we found that the cyst was a pseudo-cyst as it was a part of the stomach which had slid into the thorax. The fibrin-necrotic lesion of the left hemidiaphragm as a result of past accident of the patient gave to the upper part of the stomach the opportunity to escape from the abdomen into the thorax. This part was finally winding through fibrin lesions of hemidiaphragm, engulfed therein food and gastric juice and gave the described clinical picture. Conclusions This is a rare case of post-traumatic complication of the hemidiaphragm that resembles the water-lily sign, which is seen almost exclusively in hydatid infection, when there is

  19. In vitro propagation of Calla lily: adenine sulphate and 6-benzilaminopurine

    Directory of Open Access Journals (Sweden)

    Márcia De Nazaré Oliveira Ribeiro

    2014-09-01

    Full Text Available Calla lily [Zantedeschia aethiopica (L. Spreng.] belonging to the Araceae family is appreciated as cut flower and in com­position of gardens. However, the conventional propagation of this plants shows a poor productive. Thus, tissue culture besides allowing fast clonal propagation also provides healthy and uniforms plants. The aim was study the influence of the differents concentrations of 6-benzilaminopurine (BAP and adenine sulphate (AS on in vitro multiplication of Calla lily. The explants were maintained in MS medium added with BAP (0.0, 8.9, 17.8 and 26.7 μM and adenine sulphate (0, 54, 108 and 162 μM. The plants were transferred to growth room and maintained at 25±1ºC and photoperiod of 16 hours for 60 days, under luminous intensity of 35 μmol m-2 s-1, for a period of 60 days. The experimental design was entirely randomized with four repetitions of three seedlings each, resulting in twelve plants per treatment, each tube with one plant. The statistics analysis showed interactive effects for quantify of BAP and AS for leaves number and fresh mass of the aerial parts. The highest number of leaves (4.8 and fresh mass of aerial parts (0.73 g was obtained with 26.7 μM of BAP combined with 108 μM of AS, highest number of shoots (2.6 was obtained with 22,19 μM of BAP and highest lengh of sprouts (5.0 cm was observed in the absence of BAP. The addition of BAP increased the number of shoots per explant. The use of adenine sulphate in combination with BAP had a positive effect for the accumulation of fresh weight and number of leaves in vitro culture.

  20. Flowering pathway is regulated by bulb size in Lilium longiflorum (Easter lily).

    Science.gov (United States)

    Lazare, S; Zaccai, M

    2016-07-01

    Lilium longiflorum (Easter lily) vegetative propagation occurs through production of underground bulbs containing apical and axillary meristems. In addition, sexual reproduction is achieved by flowering of elongated shoots above the bulb. It is generally accepted that L. longiflorum has an obligatory requirement for vernalisation and that long day (LD) regime hastens flowering. However, the effect of bulb size and origin, with respect to axillary or apical meristems on flowering, as well as the interactions between these meristems are largely unknown. The aim of this study was to explore the effect of bulb size, vernalisation and photoperiod on L. longiflorum flowering. To this end, we applied vernalisation and photoperiod treatments to the different bulb sizes and used a system of constant ambient temperature of 25 °C, above vernalisation spectrum, to avoid cold-dependent floral induction during plant growth. Vernalisation and LD hasten flowering in all bulbs. Large, non-vernalised bulbs invariably remained at a vegetative stage. However, small non-vernalised bulbs flowered under LD conditions. These results demonstrate for the first time that cold exposure is not an obligatory prerequisite for L. longiflorum flowering, and that an alternative flowering pathway can bypass vernalisation in small bulbs. We suggest that apical dominance interactions determine the distinct flowering pathways of the apical and axillary meristems. Similar floral induction is achieved in propagated bulblets from scaling. These innovative findings in the field of geophyte floral induction represent valuable applicative knowledge for lily production. © 2016 German Botanical Society and The Royal Botanical Society of the Netherlands.

  1. The lily-of-the-valley fragrance receptor--potential in prostate cancer imaging.

    Science.gov (United States)

    Sturzu, Alexander; Echner, Hartmut; Heckl, Stefan

    2009-11-01

    The early diagnosis of prostate cancer and its metastases still remains a great challenge. Recently, olfactory receptors have been found in healthy and malignant prostate tissue. If conjugated to a dye, olfactory receptor ligands would represent candidates for markers of not only olfactory cells but also prostate tissue. Such a conjugate would be of great value for the detection of prostate cancer metastases. We coupled sulforhodamine, a fluorescence dye, to undecylic aldehyde, the antagonist of the lily-of-the-valley fragrance receptor. By using confocal laser scanning microscopy and flow cytometry we examined the uptake of this conjugate into various different human cell lines. One healthy prostate cell line, two different prostate carcinoma cell lines, and five other carcinoma cell lines were investigated. CD1 nude mice bearing human PC3 prostate carcinoma xenografts were injected with the conjugate. Rhodamine fluorescence of mouse organ frozen sections was evaluated by confocal laser scanning microscopy. When comparing the seven human cell lines, the conjugate was preferentially taken up by the cytoplasm of healthy and malignant prostate cells. The mice showed high conjugate uptake into the xenografts, but much lower uptake into the mouse organs. After 3 hr of circulation, efflux could be observed in the xenograft sections. Xenograft touch prints confirmed in vivo intracellular accumulation. This conjugate may be of potential value in the diagnosis of prostate cancer and its metastases.

  2. Consumers’ and Retailers’ Attitudes Towards a Mexican Native Species of Aztec Lily as an Ornamental Plant

    Directory of Open Access Journals (Sweden)

    Yesica Mayett-Moreno

    2018-01-01

    Full Text Available The use of native ornamental plants in urban landscapes and ornamental consumers’ designs is one strategy to preserve biodiversity. Sprekelia formosissima (L. Herb., known as Aztec lily (ALY, is one of the nearly 4000 species of native ornamental plants of Mexico. However, its domestic market is not yet developed and is virtually unknown. The objectives of this study were to: (1 compare consumers’ and retailers’ knowledge of ALY, and (2 to identify potential clusters of consumers and retailers based on their knowledge and preferences, such that marketing of the ALY could be best tailored to different market segments, leading to its sustainable commercialization. There were 464 interviews conducted in four nurseries in Mexico. Results showed only one consumer knew about the ALY; additionally, we found different behaviors in consumers and in retailers: those not interested in the ALY, but when they know it is Mexican they will acquire it; those interested no matter the ALY origin, and those who dislike the ALY because it is Mexican. Those answers suggest that improving consumers/retailers knowledge about this native flower could lead to a sustainable commercialization in Mexico, helping to ensure its conservation as well.

  3. Programmed Cell Death Progresses Differentially in Epidermal and Mesophyll Cells of Lily Petals.

    Directory of Open Access Journals (Sweden)

    Hiroko Mochizuki-Kawai

    Full Text Available In the petals of some species of flowers, programmed cell death (PCD begins earlier in mesophyll cells than in epidermal cells. However, PCD progression in each cell type has not been characterized in detail. We separately constructed a time course of biochemical signs and expression patterns of PCD-associated genes in epidermal and mesophyll cells in Lilium cv. Yelloween petals. Before visible signs of senescence could be observed, we found signs of PCD, including DNA degradation and decreased protein content in mesophyll cells only. In these cells, the total proteinase activity increased on the day after anthesis. Within 3 days after anthesis, the protein content decreased by 61.8%, and 22.8% of mesophyll cells was lost. A second peak of proteinase activity was observed on day 6, and the number of mesophyll cells decreased again from days 4 to 7. These biochemical and morphological results suggest that PCD progressed in steps during flower life in the mesophyll cells. PCD began in epidermal cells on day 5, in temporal synchrony with the time course of visible senescence. In the mesophyll cells, the KDEL-tailed cysteine proteinase (LoCYP and S1/P1 nuclease (LoNUC genes were upregulated before petal wilting, earlier than in epidermal cells. In contrast, relative to that in the mesophyll cells, the expression of the SAG12 cysteine proteinase homolog (LoSAG12 drastically increased in epidermal cells in the final stage of senescence. These results suggest that multiple PCD-associated genes differentially contribute to the time lag of PCD progression between epidermal and mesophyll cells of lily petals.

  4. X-ray Irradiation Control of Frankliniella occidentalis and Frankliniella intonsa (Thysanoptera: Thripidae) in the Exportation of Freshly Cut Lily Flowers.

    Science.gov (United States)

    Koo, Hyun-Na; Yun, Seung-Hwan; Kim, Hyun-Ju; Kim, Hyun Kyung; Kim, Gil-Hah

    2017-04-01

    Lily (Lilium longiflorum Thunb.) is the most representative bulb flower, and it is the third most important flower in the flower industry of South Korea after rose and chrysanthemum. To determine the efficacy of X-ray irradiation for use in quarantine processing, two species of flower thrips (Frankliniella intonsa (Trybom) and Frankliniella occidentalis (Pergande)) were placed in the top, middle, and bottom locations of lily boxes and irradiated with different X-ray doses. After irradiation with an X-ray dose of 150 Gy, the egg hatching of the two flower thrips was completely inhibited at every location in the lily boxes, and the irradiated F. intonsa and F. occidentalis nymphs failed to emerge as adult in every location of the lily boxes. When the adults were irradiated at 150 Gy, the fecundity of the two flower thrips was markedly lower than that of the untreated control groups. The F1 generation failed to hatch at the top and middle locations, whereas the F1 generation of both F. intonsa and F. occidentalis was not suppressed at the bottom locations, even at 200 Gy. However, hatching was perfectly inhibited at 300 Gy of X-ray irradiation. Also, X-rays did not affect the postharvest physiology of cut lilies. Therefore, a minimum dose of 300 Gy is recommended for the control of F. intonsa and F. occidentalis for the exportation of lily. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Daudzfaktoru personības paštēla implicīto asociāciju testa latviešu valodas versijas izstrāde

    OpenAIRE

    Andrejeva, Aleksandra

    2012-01-01

    Šī maģistra darba mērķis bija izstrādāt daudzfaktoru personības paštēla IAT latviešu valodas versiju un veikt tās ticamības un validitātes pārbaudi. Maģistra darba ietvaros tika izvirzīti 5 pētījuma jautājumi par izstrādātās metodes psihometriskajiem aspektiem: 1) iekšējo saskaņotību, 2) konverģento validitāti ar attiecīgajām eksplicītā mērījumu instrumenta dimensijām, 3) dimensiju savstarpējo diskriminanto validitāti, 4) prognostisko validitāti un 5) diskriminanto validitāti ar pašvērtēju...

  6. Studentu komunikatīvās kompetences attīstīšana apgūstot mērķvalodas vārdu krājumu

    OpenAIRE

    Vizbule, Ludmila

    2008-01-01

    Diplomdarba mērķis ir pierādīt, ka daudzveidīga vārdu krājuma mācīšanas un tā apguves uzdevumu lietošana, kā arī apgūtā materiāla regulāra nostiprināšana paaugstina studentu spēju apgūt vārdu krājumu mērķvalodā, tādējādi veicinot komunikatīvās kompetences attīstību. Darbā sniegts pārskats par komunikatīvās kompetences jēdzienu saistībā ar svešvalodas mācīšanu un tās apguvi; lingvistiskā kompetence un leksiskā kompetence aplūkotas kā būtiskas komunikatīvās kompetences sastāvdaļas. Diplomdar...

  7. Video izmantošana runas prasmju attīstīšanai angļu valodas stundās 5.- 7.klasēs.

    OpenAIRE

    Dreiberga, Lolita

    2006-01-01

    Mūsdienu sabiedrībā arvien pieaug interese par video, televīziju, datortehniku, kas ietekmē ikvienu kā pozitīvi, tā arī negatīvi, kā arī piedāvā plašas iespējas skolēnu izglītošanai un pilnveidošanai. Mūsu sabiedrībā skolēni lielākās savas dzīves zināšanas un pieredzi iegūst no tehniskajiem līdzekļiem (video, televīzijas, datortehnikas). Diplomdarba „Video izmantošana runas prasmju attīstīšanai angļu valodas stundās 5.-7. klasēs” mērķis ir noskaidrot un izpētīt, kāda ir video loma 5.-7. k...

  8. Didaktisko materiālu izmantošana korekcijas darbā bērniem ar valodas sistēmas nepietiekamu attīstību 4. klasē

    OpenAIRE

    Dziedātāja, Ieva

    2017-01-01

    Diplomdarba mērķis ir aprobēt izstrādāto didaktisko materiālu efektivitāti korekcijas darbā bērniem ar valodas sistēmas nepietiekamu attīstību. Teorētiskajā daļā ir veikta 10-11 gadus vecu bērnu attīstības īpatnību analīze, izanalizēta zinātniskā literatūra, kas saistīta ar VSNA, fonemātisko uztveri un mācīšanās traucējumiem, apskatīti artikulācijas aparāta sagatavošanas posmi skaņu korekcijai. Diplomdarba praktiskā daļa sastāv no pētījuma, kas nepieciešams, lai noteiktu didaktisko materiālu ...

  9. Jaunākā skolas vecuma skolēnu kritiskās domāšanas attīstīšana latviešu valodas stundās.

    OpenAIRE

    Kauķe, Zaiga

    2006-01-01

    Diplomdarba “ Jaunākā skolas vecuma bērnu kritiskās domāšanas attīstīšana latviešu valodas stundās” aktualitāti nosaka jaunais Latvijas Valsts pamatizglītības standarts. Viens no tā izglītojošajiem aspektiem - analītiski kritiskais - paredz, ka skolēni, apkopojot savu iepriekšējo pieredzi, mācās paši apgūt jaunas zināšanas, tās kritiski izvērtējot. Tādēļ bērniem jādod iespēja veidot savas domas patstāvīgi un neatkarīgi no citiem, apgūt garīgās darbības prasmes. Pētījuma mērķis ir izanalizē...

  10. Molecular characterization of a divergent strain of calla lily chlorotic spot virus infecting celtuce (Lactuca sativa var. augustana) in China.

    Science.gov (United States)

    Wu, Xiaodong; Wu, Xiaoyun; Li, Wenbin; Cheng, Xiaofei

    2018-02-01

    Through sequencing and assembly of small RNAs, an orthotospovirus was identified from a celtuce plant (Lactuca sativa var. augustana) showing vein clearing and chlorotic spots in the Zhejiang province of China. The S, M, and L RNAs of this orthotospovirus were determined to be 3146, 4734, and 8934 nt, respectively, and shared 30.4-72.5%, 43.4-80.8%, and 29.84-82.9% nucleotide sequence identities with that of known orthotospoviruses. The full length nucleoprotein (N) of this orthotospovirus shared highest amino acid sequence identity (90.25%) with that of calla lily chlorotic spot virus isolated from calla lily (CCSV-calla) [China: Taiwan: 2001] and tobacco (CCSV-LJ1) [China: Lijiang: 2014]. Phylogenetic analyses showed that this orthotospovirus is phylogenetically associated with CCSV isolates and clustered with CCSV, tomato zonate spot virus (TZSV), and tomato necrotic spot-associated virus (TNSaV) in a separate sub-branch. These results suggest that this orthotospovirus is a divergent isolate of CCSV and was thus named CCSV-Cel [China: Zhejiang: 2017].

  11. Assessing Genetic Diversity and Population Differentiation of Colored Calla Lily (Zantedeschia Hybrid) for an Efficient Breeding Program

    Science.gov (United States)

    Wei, Zunzheng; Zhang, Huali; Wang, Yi; Li, Youli; Xiong, Min; Wang, Xian; Zhou, Di

    2017-01-01

    Plastome-genome incompatibility (PGI) is prevalent in several plants including the Zantedeschia species, a worldwide commercial flower crop native to South Africa. Generally, hybrids suffering from PGI appear less vigorous and more susceptible than normal plants. Previous reports revealed that the PGI level in interspecific hybrids is correlated with the relatedness of the parental species in the genus Zantedeschia. To provide a basis for utilizing and improving resources in breeding programs, a total of 117 accessions of colored calla lily (Zantedeschia hybrid), collected from New Zealand, the Netherlands and the United States, were genotyped using 31 transferable expressed sequence tags-simple sequence repeats (EST-SSR) markers from the white calla lily (Zantedeschia aethiopica). A moderately high level of genetic diversity was observed, with 111 alleles in total, an observed/expected heterozygosity (Ho/He) of 0.453/0.478, and polymorphism information content (PIC) of 0.26. Genetic distance and STRUCTURE-based analysis further clustered all accessions into four subgroups (G-Ia, G-Ib, G-IIa and G-IIb), which mostly consisted of Zantedeschia pentlandii, Zantedeschia elliotiana, Zantedeschia albomaculata and Zantedeschia rehmannii, respectively. Significant genetic differentiation was observed between all inferred subgroup pairs, with the Fst ranging from 0.142 to 0.281. Finally, the accessions assigned into G-IIb (Z. rehmannii) were recommended as top priority parents in efficient Zantedeschia breeding program designs. PMID:28635663

  12. Fusarium agapanthi sp. nov, a novel bikaverin and fusarubin-producing leaf and stem spot pathogen of Agapanthus praecox (African lily) from Australia and Italy

    Science.gov (United States)

    This study was conducted to characterize a novel Fusarium species that caused leaf and stem spot on Agapanthus praecox (Agapanthus, African lily) in northern Italy and leaf rot and spot on the same host in Melbourne, Australia. Formally described as Fusarium agapanthi, this pathogen was analyzed usi...

  13. Performance of Free Water Surface Constructed Wetland Using Typhalatifolia and Canna Lilies for the Treatment of Domestic Wastewater.

    Science.gov (United States)

    Shrikhande, Avinash N; Nema, P; Mhaisalkar, Vasant A

    2014-01-01

    Discharge of untreated wastewater or partially treated wastewater into surface water bodies or on to land is a major cause of surface and ground water pollution thereby posing health hazards. Conventional wastewater treatment is generally not preferred for small communities due to higher capital and maintenance costs and lack of skilled supervision required for operation and maintenance. A constructed wetland treatment appears to be an appropriate alternative that can be employed both in developed and developing countries. A constructed wetland system is simple to construct and operate with low cost, and hence worth considering for the treatment of municipal wastewaters, especially from small communities. In this context, the site for carrying out the studies related to wastewater treatment was chosen at Kavikulguru Institute of Technology and Science (KITS), Ramtek, Dist. Nagpur. A Free Water Surface Constructed Wetland (FWSCW) of size 22.00m x 6.50 m x 0.60m was constructed at KITS, Ramtek. The performance of FWS CW system was studied for domestic wastewater treatment with theoretical hydraulic retention times of 10 days, 7 days and 5 days. Important parameters, such as BOD5, COD, TSS, NH4-N, PO4-P, DO, pH and faecal coliforms in both raw and treated wastewaters were monitored during a macrophytes life cycle. Based on the studies, it is concluded that minimum 5 days HRT is necessary for the treatment of wastewater in FWSCW using Typhalatifolia or Canna Lilies. Typhalatifolia is better in removal of pollutants from the wastewater in comparison to Canna Lilies and hence, is recommended for use in constructed wetland. The nutrient uptake capacity of Typhalatifolia is also quite encouraging and hence has great potential for application in treating wastewater from fertilizer industry. During the application of kinetic model, the observed and predicted values in respect of BOD, TSS and NH4-N in case of Typhalatifolia and BOD, COD and TSS in case of Canna Lilies were

  14. Rezension von: Lily Tonger-Erk: Actio. Körper und Geschlecht in der Rhetoriklehre. Berlin: De Gruyter 2012.

    Directory of Open Access Journals (Sweden)

    Anson Koch-Rein

    2014-03-01

    Full Text Available Lily Tonger-Erk beschäftigt sich mit Rhetorik als Körperbildungsmacht, indem sie die geschlechtliche Konstruktion der Actio, der körperlichen Dimension des Redeauftritts in der rhetorischen Lehre, in drei für die Geschichte der Rhetorik bedeutsamen historischen Momenten von der klassischen Antike über das 18. bis zum späten 20. Jahrhundert analysiert. Dabei gelingt ihr ein ausgezeichneter Brückenschlag zwischen detailreicher und epochenübergreifender Rhetorikgeschichte und einer analytischen Genderperspektive. Diese Untersuchung der Redner_innenbildung als rhetorischer Körperbildung (im Doppelsinne von Erziehung und Subjektivierung legt einen wichtigen Grundstein für weitere Studien zur rhetorischen Produktion von Geschlecht und Körper.

  15. Sequence and structure prediction of RNA-dependent RNA polymerase of lily symptomless virus isolated from L. × 'Casablanca'.

    Science.gov (United States)

    Xu, Pinsan; Li, Huangai; Liu, Jiwen; Luan, Yushi; Yin, Yalei; Bai, Jianfang

    2011-06-01

    The DNA sequence of the RNA-dependent RNA polymerase (RdRp) gene of lily symptomless virus (LSV), a lily-infecting member of the genus Carlavirus, was determined from nine overlapping cDNA fragments of different sizes. The complete sequence of this RdRp gene (HM070294) consisted of 5,847 nucleotides coding for a protein of 220 kDa. It had 97-98% sequence identity with RdRps of other known isolates at both the DNA and the amino acid level. Phylogenetic analysis indicated that this RdRp (designated as RdRp-DL) was closely related to the RdRp of the Korean isolate (AM516059), as well as to the RdRps from Passiflora latent virus (PLV) and Kalanchoe latent virus (KLV) of the genus Carlavirus. Hydrophobic analysis of RdRp-DL revealed a hydrophobic N-terminus and a hydrophilic C-terminus. Helices and Loops were the major secondary structures of RdRp-DL. In addition, RdRp-DL also had three coil structures. Four conserved domains were identified: typoviral methyltransferase, RNA-dependent RNA polymerase, P-loop-containing nucleoside triphosphate hydrolases and carlavirus endopeptidase. A model of the tertiary structure predicted by I-TASSER was obtained for each of these conserved domains. This is the first report of a detailed phylogenetic analysis of LSV RdRp with those of other members of the genus Carlavirus, and the first to predict the domain structures of LSV RdRp.

  16. Airborne eXpendable BathyThermographs (AXBT) data from Ocean Surveys in the Gulf of Mexico during Hurricane Lili 2002-10-02 to 2002-10-04 (NCEI Accession 0159386)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Airborne eXpendable BathyThermographs (AXBT) data from deployments during field operations to study Hurricane Lili. The data were used in model simulations for...

  17. Mit dem Puppenwagen in die normative Weiblichkeit. Lili Elbe und die journalistische Inszenierung von Transsexualität in Dänemark

    Directory of Open Access Journals (Sweden)

    Sabine Meyer

    2010-12-01

    Full Text Available When the Danish painter Einar Wegener underwent several operations in 1930 in order to subsequently live as Lili Elvenes, the case was of great interest for both the public and the media. In the beginning of 1931 the Danish newspapers Politiken and Ekstra Bladet published a series of efficacious interlinked articles that were staged as a self-contained whole. Along with emphasizing the discursive competence of medicine and legislation this staging focused on the perpetuation of a heteronormative order. Employing the variables sex, gender and desire as well as their interconnections highlights the normalizing processes of (re-construction tied to such a perpetuation. At the same time it discloses staging strategies, which enable an analysis of Lili Elvenes’ agency. By pursuing this notion of agency such an analysis demonstrates how the transsexual subject is embedded in dominant discourses.

  18. Cloning and Functional Characterization of a Gene for Capsanthin-Capsorubin Synthase from Tiger Lily (Lilium lancifolium Thunb. ‘Splendens’)

    OpenAIRE

    Jeknić, Zoran; Morré, Jeffrey T.; Jeknić, Stevan; Jevremović, Slađana; Subotić, Angelina; Chen, Tony H.H.

    2012-01-01

    The orange color of tiger lily (Lolium lancifolium ‘Splendens’) flowers is due, primarily, to the accumulation of two κ-xanthophylls, capsanthin and capsorubin. An enzyme, known as capsanthin-capsorubin synthase (CCS), catalyzes the conversion of antheraxanthin and violaxanthin into capsanthin and capsorubin, respectively. We cloned the gene for capsanthin-capsorubin synthase (Llccs) from flower tepals of L. lancifolium by the rapid amplification of cDNA ends (RACE) with a heterologous non-de...

  19. Transcriptome analysis of colored calla lily (Zantedeschia rehmannii Engl. by Illumina sequencing: de novo assembly, annotation and EST-SSR marker development

    Directory of Open Access Journals (Sweden)

    Zunzheng Wei

    2016-09-01

    Full Text Available Colored calla lily is the short name for the species or hybrids in section Aestivae of genus Zantedeschia. It is currently one of the most popular flower plants in the world due to its beautiful flower spathe and long postharvest life. However, little genomic information and few molecular markers are available for its genetic improvement. Here, de novo transcriptome sequencing was performed to produce large transcript sequences for Z. rehmannii cv. ‘Rehmannii’ using an Illumina HiSeq 2000 instrument. More than 59.9 million cDNA sequence reads were obtained and assembled into 39,298 unigenes with an average length of 1,038 bp. Among these, 21,077 unigenes showed significant similarity to protein sequences in the non-redundant protein database (Nr and in the Swiss-Prot, Gene Ontology (GO, Cluster of Orthologous Group (COG and Kyoto Encyclopedia of Genes and Genomes (KEGG databases. Moreover, a total of 117 unique transcripts were then defined that might regulate the flower spathe development of colored calla lily. Additionally, 9,933 simple sequence repeats (SSRs and 7,162 single nucleotide polymorphisms (SNPs were identified as putative molecular markers. High-quality primers for 200 SSR loci were designed and selected, of which 58 amplified reproducible amplicons were polymorphic among 21 accessions of colored calla lily. The sequence information and molecular markers in the present study will provide valuable resources for genetic diversity analysis, germplasm characterization and marker-assisted selection in the genus Zantedeschia.

  20. Evolutionary trends in the floral transcriptome: insights from one of the basalmost angiosperms, the water lily Nuphar advena (Nymphaeaceae).

    Science.gov (United States)

    Yoo, Mi-Jeong; Chanderbali, André S; Altman, Naomi S; Soltis, Pamela S; Soltis, Douglas E

    2010-11-01

    Current understanding of floral developmental genetics comes primarily from the core eudicot model Arabidopsis thaliana. Here, we explore the floral transcriptome of the basal angiosperm, Nuphar advena (water lily), for insights into the ancestral developmental program of flowers. We identify several thousand Nuphar genes with significantly upregulated floral expression, including homologs of the well-known ABCE floral regulators, deployed in broadly overlapping transcriptional programs across floral organ categories. Strong similarities in the expression profiles of different organ categories in Nuphar flowers are shared with the magnoliid Persea americana (avocado), in contrast to the largely organ-specific transcriptional cascades evident in Arabidopsis, supporting the inference that this is the ancestral condition in angiosperms. In contrast to most eudicots, floral organs are weakly differentiated in Nuphar and Persea, with staminodial intermediates between stamens and perianth in Nuphar, and between stamens and carpels in Persea. Consequently, the predominantly organ-specific transcriptional programs that characterize Arabidopsis flowers (and perhaps other eudicots) are derived, and correlate with a shift towards morphologically distinct floral organs, including differentiated sepals and petals, and a perianth distinct from stamens and carpels. Our findings suggest that the genetic regulation of more spatially discrete transcriptional programs underlies the evolution of floral morphology. © 2010 The Authors. The Plant Journal © 2010 Blackwell Publishing Ltd.

  1. Plant villin, lily P-135-ABP, possesses G-actin binding activity and accelerates the polymerization and depolymerization of actin in a Ca2+-sensitive manner.

    Science.gov (United States)

    Yokota, Etsuo; Tominaga, Motoki; Mabuchi, Issei; Tsuji, Yasunori; Staiger, Christopher J; Oiwa, Kazuhiro; Shimmen, Teruo

    2005-10-01

    From germinating pollen of lily, two types of villins, P-115-ABP and P-135-ABP, have been identified biochemically. Ca(2+)-CaM-dependent actin-filament binding and bundling activities have been demonstrated for both villins previously. Here, we examined the effects of lily villins on the polymerization and depolymerization of actin. P-115-ABP and P-135-ABP present in a crude protein extract prepared from germinating pollen bound to a DNase I affinity column in a Ca(2+)-dependent manner. Purified P-135-ABP reduced the lag period that precedes actin filament polymerization from monomers in the presence of either Ca(2+) or Ca(2+)-CaM. These results indicated that P-135-ABP can form a complex with G-actin in the presence of Ca(2+) and this complex acts as a nucleus for polymerization of actin filaments. However, the nucleation activity of P-135-ABP is probably not relevant in vivo because the assembly of G-actin saturated with profilin, a situation that mimics conditions found in pollen, was not accelerated in the presence of P-135-ABP. P-135-ABP also enhanced the depolymerization of actin filaments during dilution-mediated disassembly. Growth from filament barbed ends in the presence of Ca(2+)-CaM was also prevented, consistent with filament capping activity. These results suggested that lily villin is involved not only in the arrangement of actin filaments into bundles in the basal and shank region of the pollen tube, but also in regulating and modulating actin dynamics through its capping and depolymerization (or fragmentation) activities in the apical region of the pollen tube, where there is a relatively high concentration of Ca(2+).

  2. Functional analysis reveals the possible role of the C-terminal sequences and PI motif in the function of lily (Lilium longiflorum) PISTILLATA (PI) orthologues

    Science.gov (United States)

    Chen, Ming-Kun; Hsieh, Wen-Ping; Yang, Chang-Hsien

    2012-01-01

    Two lily (Lilium longiflorum) PISTILLATA (PI) genes, Lily MADS Box Gene 8 and 9 (LMADS8/9), were characterized. LMADS9 lacked 29 C-terminal amino acids including the PI motif that was present in LMADS8. Both LMADS8/9 mRNAs were prevalent in the first and second whorl tepals during all stages of development and were expressed in the stamen only in young flower buds. LMADS8/9 could both form homodimers, but the ability of LMADS8 homodimers to bind to CArG1 was relatively stronger than that of LMADS9 homodimers. 35S:LMADS8 completely, and 35S:LMADS9 only partially, rescued the second whorl petal formation and partially converted the first whorl sepal into a petal-like structure in Arabidopsis pi-1 mutants. Ectopic expression of LMADS8-C (with deletion of the 29 amino acids of the C-terminal sequence) or LMADS8-PI (with only the PI motif deleted) only partially rescued petal formation in pi mutants, which was similar to what was observed in 35S:LMADS9/pi plants. In contrast, 35:LMADS9+L8C (with the addition of the 29 amino acids of the LMADS8 C-terminal sequence) or 35S:LMADS9+L8PI (with the addition of the LMADS8 PI motif) demonstrated an increased ability to rescue petal formation in pi mutants, which was similar to what was observed in 35S:LMADS8/pi plants. Furthermore, ectopic expression of LMADS8-M (with the MADS domain truncated) generated more severe dominant negative phenotypes than those seen in 35S:LMADS9-M flowers. These results revealed that the 29 amino acids including the PI motif in the C-terminal region of the lily PI orthologue are valuable for its function in regulating perianth organ formation. PMID:22068145

  3. Symptom development in response to combined infection of in vitro grown Lilium longiflorum with the root lesion nematode Pratylenchus penetrans and soilborne fungi collected from diseased roots of field-grown lilies

    Science.gov (United States)

    Eight fungal isolates (ELRF 1-8) were isolated from necrotic roots of Lilium longiflorum cv. Nellie White (Easter lily) grown in a field in the U.S. Pacific Northwest. The eight fungal isolates were identified by sequencing and molecular phylogenetic analyses based on their ITS rDNA region. Five iso...

  4. Program standard of quality control for a system of Positron Emission Tomography-computed tomography (PET-CT) used in the Foundation Valle de Lili; Programa estandar de control de calidad para un sistema de tomografia por emision de positrones-tomografia computadorizada (PET-CT) utilizado en la Fundacion Valle del Lili

    Energy Technology Data Exchange (ETDEWEB)

    Nunez, Nathalia I.; Benavides, Sivor O., E-mail: Nnunez@fcvl.org, E-mail: Obenavides@fcvl.org [Fundacion Valle del Lili (OFM-PR/FVL), Cali (Colombia). Dept. de Fisica Medica y Proteccion Radiologica; Lopera, Wilson, E-mail: wilson.lopera@correounivalle.edu.co [Universidad del Valle, Cali (Colombia). Dept. de Fisica

    2013-07-01

    A standard protocol of quality control in the Fundacion Valle del Lili for the implementation of a multimodal scanner developed emission tomography BIOGRAPH mCT X-3R of SIEMENS Registered-Sign covering routine testing, frequency, acceptance ranges necessary corrective and preventive measures to detect and correct any faults and proceed if the upper detection precision and accuracy ranges accepted deviations actions. In order to minimize errors in the planning and management of patient dose, thereby improving the quality of the diagnostic image with the dose of radiation is reasonably low as possible, consistent with the clinical use of the equipment used and the information requested diagnostic study.

  5. Vernalização afeta o filocrono em lírio Vernalization affects the phyllochron in lily

    Directory of Open Access Journals (Sweden)

    Mariângela Schuh

    2005-01-01

    Full Text Available O experimento foi desenvolvido com o objetivo de estudar o efeito da vernalização sobre o filocrono (intervalo de tempo entre o aparecimento de duas folhas sucessivas em lírio (Lilium longiflorum Thunb., cv. Snow Queen, no campo experimental do Departamento de Fitotecnia da Universidade Federal de Santa Maria (UFSM, Santa Maria (RS. Os tratamentos constituíram-se de bulbos submetidos a -0,5 ºC; 4 ºC e 10 ºC com períodos de vernalização dos bulbos de 2, 4, 6 e 8 semanas. O tratamento testemunha correspondeu a bulbos não vernalizados. Após o tratamento de vernalização, os bulbos foram plantados no interior de uma estufa plástica em 5 de dezembro de 2002 e observado o desenvolvimento das plantas. O filocrono foi estimado pelo inverso do coeficiente angular da regressão linear entre o número de folhas e o acúmulo térmico acima de 1 ºC, a partir da emergência das plantas. Os resultados evidenciaram que o estado de vernalização da planta afeta o filocrono em lírio, e plantas não vernalizadas ou com pouca vernalização têm um filocrono mais elevado do que plantas completamente vernalizadas. Quando o tratamento de vernalização é maior que 30 dias efetivos de vernalização, o valor do filocrono foi em torno de 25 ºC dia/folha, valor que pode ser utilizado como referência quando os bulbos são vernalizados e utilizados em plantios comerciais.An experiment was carried out to verify the effect of vernalization period on the phyllochron (time interval between the appearance of two successive leaves in lily (Lilium longiflorum Thunb, cv. 'Snow Queen'. The trial was conducted at Santa Maria, RS, Brazil. Treatments were bulbs stored at vernalizing temperatures of -0.5, 4, and 10ºC during periods of 2, 4, 6 and 8 weeks. Control treatment was unvernalized bulbs. Bulbs were planted inside a plastic greenhouse on December 05, 2002, and crop development was evaluated throughout the growing season. Phyllochron for each treatment was

  6. Sticky snack for sengis: The Cape rock elephant-shrew, Elephantulus edwardii (Macroscelidea), as a pollinator of the Pagoda lily, Whiteheadia bifolia (Hyacinthaceae)

    Science.gov (United States)

    Wester, Petra

    2010-12-01

    Following the recent discovery of rodent pollination in the Pagoda lily, Whiteheadia bifolia (Hyacinthaceae) in South Africa, now the Cape rock elephant-shrew, Elephantulus edwardii (Macroscelidea, Afrotheria) is reported as an additional pollinator. Elephant-shrews, live-trapped near W. bifolia plants, were released in two terraria, containing the plants. The animals licked nectar with their long and slender tongues while being dusted with pollen and touching the stigmas of the flowers with their long and flexible noses. The captured elephant-shrews had W. bifolia pollen in their faeces, likely as a result of grooming their fur as they visited the flowers without eating or destroying them. The animals mostly preferred nectar over other food. This is the first record of pollination and nectar consumption in the primarily insectivorous E. edwardii, contributing to the very sparse knowledge about the behaviour of this unique clade of African mammals, as well as pollination by small mammals.

  7. Effect of irrigation with nutrient solutions mixed with treated wastewater on Asiatic lily ‘Brunello’ grown in a closed soilless culture

    Directory of Open Access Journals (Sweden)

    Ahmed Abdel-Nabi Al-Hammouri

    2017-01-01

    Full Text Available A plastic greenhouse study was implemented to evaluate the potential use of treated wastewater for irrigation of Asiatic lily ‘Brunello’ grown in zeolite. Plants received the following treatments: a nutrient solution (N alone, (N mixed with treated wastewater (W at rates of 3N:1W, 1N:1W and 1N:3W respectively. A closed system was used in which the drain solution was circulated for several days until its electrical conductivity reached 2.3 dS m-1, after which fresh irrigation solutions were used to start a second cycle of circulation. The results indicated that plants irrigated with (N or 3N:1W solution had the longest stems (34.4 and 36.2 cm respectively, peduncles and buds (about 4.5 cm, and the greatest shoot (3.4 and 3.8 cm and bud mass (14.95 and 17.6 g respectively. Plants irrigated with 1N:3W solution had the highest dry mass tissue content of K (3.06 g kg -1 and B (35.5 mg kg-1. Plants irrigated with 1N:1W or 1N:3W were inferior to other plants. It can be concluded that 1N:3W mixture may be used for production of high quality cut flowers of lily. Moreover, it is expected to save 3.4 litres m-2 of a nutrient solution and 1850, 347 and 1870 mg m-2 day-1 for N, P, and K respectively.

  8. Expression Analysis of Lily Type Lectin Isotypes in the Rock Bream, Oplegnathus fasciatus: in the Tissue, Developmental Stage and Viral Infection.

    Science.gov (United States)

    Lee, Young Mee; Yang, In Jung; Noh, Jae Koo; Kim, Hyun Chul; Park, Choul-Ji; Park, Jong-Won; Noh, Gyeong Eon; Kim, Woo-Jin; Kim, Kyung-Kil

    2016-12-01

    Lectins belong to the pattern-recognition receptors (PRRs) class and play important roles in the recognition and elimination of pathogens via the innate immune system. Recently, it was reported that lily-type lectin-1 is involved when a pathogen attacks in the early immune response of fish. However, this study is limited to information that the lectin is involved in the innate immune response against viral infection. In the present study, the lily-type lectin-2 and -3 of Oplegnathus fasciatus (OfLTL-2 and 3) have been presented to be included B-lectin domain and two D-mannose binding sites in the amino acid sequence that an important feature for the fundamental structure. To investigate the functional properties of OfLTLs, the tissue distribution in the healthy rock bream and temporal expression during early developmental stage analysis are performed using quantitative real-time PCR. OfLTL-2 and 3 are predominantly expressed in the liver and skin, but rarely expressed in other organ. Also, the transcripts of OfLTLs are not expressed during the early developmental stage but its transcripts are increased after immune-related organs which are fully formed. In the challenge experiment with RBIV (rock bream iridovirus), the expression of OfLTLs was increased much more strongly in the late response than the early, unlike previously known. These results suggest that OfLTLs are specifically expressed in the immune-related tissues when those organs are fully formed and it can be inferred that the more intensively involved in the second half to the virus infection.

  9. Doses de boro no desenvolvimento de copo-de-leite em solução nutritiva Boron doses in the development of calla lily in nutrient solution

    Directory of Open Access Journals (Sweden)

    Roseane Rodrigues de Souza

    2010-12-01

    Full Text Available O boro desempenha funções importantes em processos biológicos das plantas, como a síntese e estruturação da parede celular, lignificação, metabolismo e transporte de carboidratos, além de participar da divisão e diferenciação celular em tecidos meristemáticos. No entanto, as necessidades nutricionais para o cultivo de copo-de-leite, especialmente de boro, ainda são pouco conhecidas. Assim, objetivou-se avaliar os efeitos de diferentes doses de boro no crescimento e desenvolvimento, teor e acúmulo desse nutriente em plantas de copo-de-leite cultivadas em solução nutritiva. Mudas micropropagadas foram submetidas aos tratamentos com as doses de 0,05; 0,25; 0,50; 0,75; 1,00 e 2,00 mg L-1 de boro em solução nutritiva de Hoagland & Arnon diluída a 30% de sua força iônica. O delineamento experimental foi o inteiramente casualizado, com dez repetições. As plantas não manifestaram sintomas visuais de deficiência ou de toxidez de boro, no entanto, o sistema radicular das plantas cultivadas na dose de 0,05 mg L-1 de boro apresentou-se com o crescimento reduzido. A melhor dose para o desenvolvimento adequado de plantas de copo-de-leite em solução nutritiva é de 1,20 mg L-1 de boro.Boron has essential functions in plant biological processes such as cell wall synthesis and structuralization, lignification, carbohydrates metabolism and transport. This element also acts in cell division and differentiation in meristematic tissues. However, the nutritional needs for calla lily cultivation, and especially boron needs, are still poorly known. Thus, the objective of this work was to evaluate the effects of different boron doses on growth and development, content and accumulation of boron in calla lily plants grown in a nutrient solution. Micropropagated seedlings were submitted to treatments with the doses 0.05; 0.25; 0.50; 0.75; 1.00 and 2.00 mg L-1 boron in Hoagland & Arnon nutrient solution diluted to 30% of its ionic force. The

  10. The floral scents of Nymphaea subg. Hydrocallis (Nymphaeaceae), the New World night-blooming water lilies, and their relation with putative pollinators.

    Science.gov (United States)

    Maia, Artur Campos Dália; de Lima, Carla Teixeira; Navarro, Daniela Maria do Amaral Ferraz; Chartier, Marion; Giulietti, Ana Maria; Machado, Isabel Cristina

    2014-07-01

    Night-blooming water lilies are characterized by intense emission of floral VOCs. Their unique scent-oriented pollinators, cyclocephaline scarabs (Scarabaeidae, Cyclocephalini), are attracted to flowers that they use as reliable sources of food and as mating aggregation sites. Chemical analysis of floral scent samples of seven species of Nymphaea subg. Hydrocallis established remarkably simple fragrant blends, each of which was dominated by one or two prominent compounds that alone accounted for over 95% of total scent emission. A total of 22 VOCs were identified: aliphatics (9), C5-branched chain compounds (5) and aromatics (8). Anisole was the dominant constituent in the floral scents of Nymphaea amazonum subsp. amazonum, N. amazonum subsp. pedersenii and N. tenerinervia, whereas (methoxymethyl)benzene was the most abundant VOC in samples of N. lasiophylla and N. lingulata. Flowers of N. rudgeana and N. gardneriana emitted high amounts of methyl hexanoate and methyl 2-methylbutanoate. Comparisons of floral VOC composition including other day- and night-blooming species of Nymphaea and Victoria obtained from the literature evidenced disparities related to habitus. While flowers of day-blooming species mostly emit aromatic alcohols and ethers, nocturnal species are particularly rich in aromatic ethers, aliphatic esters and C5-branched chain esters. These findings strongly suggest that the floral scent composition within closely related Nymphaea and Victoria is linked to pollinator selection, and the putative role of floral VOCs in pollinator attractiveness is discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. Molecular characterization and expression analysis of Lily-type lectin (Sm LTL) in turbot Scophthalmus maximus, and its response to Vibrio anguillarum

    Science.gov (United States)

    Xia, Dandan; Ma, Aijun; Huang, Zhihui; Shang, Xiaomei; Cui, Wenxiao; Yang, Zhi; Qu, Jiangbo

    2017-04-01

    A full-length lily-type lectin (Sm LTL) was identified from turbot (Scophthalmus maximus) in this study. By searching database for protein identification and function prediction, Sm LTL were confirmed. The full-length cDNA of Sm LTL is composed of 569 bp and contains a 339 bp ORF that encodes 112 amino acid residues. The Sm LTL peptide is characterized by a specific β-prism architecture and contains three mannose binding sites in a three-fold internal repeat between amino acids 30-99; two of the repeats share the classical mannose binding domain (QxDxNxVxY) while the third binding site was similar to other fish-specific binding motifs (TxTxGxRxV). The primary, secondary, and tertiary structures of Sm LTL were predicted and analyzed, indicating that the Sm LTL protein was hydrophilic, contained 5.36% α-helices, 39.29% extended strands, 16.07% β-folds, and 39.29% random coils, and three β-folds. Quantitative realtime polymerase chain reaction (qPCR) analysis revealed that the Sm LTL mRNA was abundantly expressed in skin, gill, and intestine. Low levels of Sm LTL expression were observed in other tissues. The expression of Sm LTL in gill, skin and intestine increased at mRNA level after stimulation of Vibrio anguillarum, our results suggest that Sm LTL serve as the first line of defence against microbial infections and play a pivotal role in the innate mucosal immune system. The current study indicates that Sm LTL is a member of the lilytype lectin family and the information reported here will provide an important foundation for future research on the role of this protein.

  12. Absorción de nutrientes de Zantedeschia elliottiana (Zalla Lily) en diferentes estados fenológicos como punto de partida para la determinación de requerimientos nutricionales del cultivo en condiciones del eje cafetero colombiano.

    OpenAIRE

    Gómez Posada, Susana

    2009-01-01

    Zantedeschia elliottiana o Calla Lily, es uno de los cultivos promisorios dentro de los llamados productos no tradicionales de flor de corte para exportación. La alta demanda y precio del producto en el mercado internacional, hacen de ésta especie una opción rentable para los floricultores del país. Sin embargo, para condiciones ecuatoriales, no se conoce información precisa sobre absorción de nutrientes en los diferentes estados de desarrollo del cultivo, lo que dificulta ajustar y optimizar...

  13. Genetically based polymorphisms in morphology and life history associated with putative host races of the water lily leaf beetle, Galerucella nymphaeae.

    Science.gov (United States)

    Pappers, Stephanie M; van der Velde, Gerard; Ouborg, N Joop; van Groenendael, Jan M

    2002-08-01

    A host race is a population that is partially reproductively isolated from other conspecific populations as a direct consequence of adaptation to a specific host. The initial step in host race formation is the establishment of genetically based polymorphisms in, for example, morphology, preference, or performance. In this study we investigated whether polymorphisms observed in Galerucella nymphaeae have a genetic component. Galerucella nymphaeae, the water lily leaf beetle, is a herbivore which feeds and oviposits on the plant hosts Nuphar lutea and Nymphaea alba (both Nymphaeaceae) and Rumex hydrolapathum and Polygonum amphibium (both Polygonaceae). A full reciprocal crossing scheme (16 crosses, each replicated 10 times) and subsequent transplantation of 1,001 egg clutches revealed a genetic basis for differences in body length and mandibular width. The heritability value of these traits, based on midparent-offspring regression, ranged between 0.53 and 0.83 for the different diets. Offspring from Nymphaeaceae parents were on average 12% larger and had on average 18% larger mandibles than offspring from Polygonaceae parents. Furthermore, highly significant correlations were found between feeding preference of the offspring and the feeding preference of their parents. Finally, two fitness components were measured: development time and survival. Development time was influenced by diet, survival both by cross type and diet, the latter of which suggest adaptation of the beetles. This suggestion is strengthened by a highly significant cross x diet interaction effect for development time as well as for survival, which is generally believed to indicate local adaptation. Although no absolute genetic incompatibility among putative host races was observed, survival of the between-host family offspring, on each diet separately, was lower than the survival of the within-host family offspring on that particular host. Survival of offspring of two Nymphaeaceae parents was about

  14. Synthesis and electrochemistry of cubic rocksalt Li-Ni-Ti-O compounds in the phase diagram of LiNiO 2-LiTiO 2-Li[Li 1/3Ti 2/3]O 2

    Science.gov (United States)

    Zhang, Lianqi; Noguchi, Hideyuki; Li, Decheng; Muta, Takahisa; Wang, Xiaoqing; Yoshio, Masaki; Taniguchi, Izumi

    On the basis of extreme similarity between the triangle phase diagrams of LiNiO 2-LiTiO 2-Li[Li 1/3Ti 2/3]O 2 and LiNiO 2-LiMnO 2-Li[Li 1/3Mn 2/3]O 2, new Li-Ni-Ti-O series with a nominal composition of Li 1+ z/3Ni 1/2- z/2Ti 1/2+ z/6O 2 (0 ≤ z ≤ 0.5) was designed and attempted to prepare via a spray-drying method. XRD identified that new Li-Ni-Ti-O compounds had cubic rocksalt structure, in which Li, Ni and Ti were evenly distributed on the octahedral sites in cubic closely packed lattice of oxygen ions. They can be considered as the solid solution between cubic LiNi 1/2Ti 1/2O 2 and Li[Li 1/3Ti 2/3]O 2 (high temperature form). Charge-discharge tests showed that Li-Ni-Ti-O compounds with appropriate compositions could display a considerable capacity (more than 80 mAh g -1 for 0.2 ≤ z ≤ 0.27) at room temperature in the voltage range of 4.5-2.5 V and good electrochemical properties within respect to capacity (more than 150 mAh g -1 for 0 ≤ z ≤ 0.27), cycleability and rate capability at an elevated temperature of 50 °C. These suggest that the disordered cubic structure in some cases may function as a good host structure for intercalation/deintercalation of Li +. A preliminary electrochemical comparison between Li 1+ z/3Ni 1/2- z/2Ti 1/2+ z/6O 2 (0 ≤ z ≤ 0.5) and Li 6/5Ni 2/5Ti 2/5O 2 indicated that charge-discharge mechanism based on Ni redox at the voltage of >3.0 V behaved somewhat differently, that is, Ni could be reduced to +2 in Li 1+ z/3Ni 1/2- z/2Ti 1/2+ z/6O 2 while +3 in Li 6/5Ni 2/5Ti 2/5O 2. Reduction of Ti 4+ at a plateau of around 2.3 V could be clearly detected in Li 1+ z/3Ni 1/2- z/2Ti 1/2+ z/6O 2 with 0.27 ≤ z ≤ 0.5 at 50 °C after a deep charge associated with charge compensation from oxygen ion during initial cycle.

  15. Aclimatização de mudas micropropagadas de Bastão do Imperador em diferentes volumes de recipientes Acclimatization of micropropagated seedlings of Torch Lily in containers of different capacities

    Directory of Open Access Journals (Sweden)

    Elisangela Maria dos Santos

    2013-02-01

    Full Text Available É crescente o mercado de flores tropicais no Brasil. No nordeste, por causa do clima, torna-se difícil a aclimatização dessas plantas. Portanto, este trabalho tem por objetivo determinar o recipiente mais adequado para aclimatizar mudas micropropagadas de bastão do imperador cv. Porcelana, em ambiente protegido. O experimento foi realizado em estufa e as mudas utilizadas foram obtidas por micropropagação. O delineamento experimental utilizado foi de blocos ao acaso, com quatro tratamentos (volumes e cinco repetições. Os volumes dos recipientes testados foram: V1 - 50 cm³ (Copo pequeno - CP; V2 - 150 cm³ (Tubete pequeno - TP; V3 - 300 cm³ (Tubete grande - TG; V4 - 450 cm³(Vaso pequeno - VP. Foram coletados dados correspondentes ao número de folhas (NF, altura da muda (AM, diâmetro do pseudocaule (DP, massa fresca da parte aérea (MFPA, massa fresca do sistema radicular (MFSR, massa seca da parte aérea (MSPA e massa seca do sistema radicular (MSSR. Foi realizada a análise de variância e os resultados de natureza qualitativa foram submetidos ao teste de média. O vaso de 450 cm³ é o recipiente mais adequado para aclimatização de bastão do imperador, pois proporcionou melhor desenvolvimento das mudas.The Brazilian market of tropical flowers is in a rapid growth stage. The climate of the Brazilian northeastern region, however, tends to hamper plant acclimatization. Considering this, our study aims at determining the most appropriate container (concerning to capacity to acclimatize micropropagated Torch Lily (cultivar Porcelana in a greenhouse. The experimental design was randomized blocks with four treatments (container capacities and five replications. The tested container capacities were: V1 = 50cm³ (small glass - CP; V2 = 150cm³ (small plastic tube - TP; V3 = 300 cm³ (large plastic tube - TG; V4 = 450cm³ (small vase - VP. The characteristics evaluated were: the number of leaves (NF, seedling height (AM, stem diameter (DP

  16. Elevated H(2)O (2) production via overexpression of a chloroplastic Cu/ZnSOD gene of lily (Lilium oriental hybrid 'Marco Polo') triggers ethylene synthesis in transgenic potato.

    Science.gov (United States)

    Kim, Yoon-Sik; Kim, Hyun-Soon; Lee, Yong-Hwa; Kim, Mi-Sun; Oh, Hyun-Woo; Hahn, Kyu-Woong; Joung, Hyouk; Jeon, Jae-Heung

    2008-06-01

    Transgenic potato plants (SS2 and SS4) that overexpressed a chloroplastic copper/zinc superoxide dismutase lily gene were utilized as an H(2)O(2)-inducible system in order to study the role of H(2)O(2) as a signaling molecule in the biosynthesis of ethylene. SS2 and SS4 plants grown in vitro under sealed microenvironment (SME) conditions displayed anomalous phenotypes including reduction of stem elongation, radial stem growth, and promotion of root hair formation in the generated root, which were similar to ethylene-induced responses. In addition, SS4 plants showed severe vitrification in developing leaves and elevated ethylene production under SME conditions. After the ethylene action inhibitor AgNO(3), 1-aminocyclopropane-1-carboxylic acid (ACC) oxidase (ACO) inhibitor CoCl(2), and ACC synthase inhibitor L -aminoethoxyvinylglycine were added to the growth media, the anomalous phenotypes in SS4 plants reverted to their normal phenotype with a concurrent decrease in ethylene production. Northern blot analysis showed that ACO transcripts in SS4 plants were constantly at high levels under normal and SME conditions, indicating that a high level of H(2)O(2) in SS4 plants up-regulates ACO transcripts. Moreover, the direct treatment of H(2)O(2) in potato plants confirmed the elevated expression of the ACO gene. Taken together, these data suggest that the high concentration of H(2)O(2) in transgenic potato plants stimulates ethylene biosynthesis by activating ACO gene expression.

  17. Hierarchical Mesoporous Lithium-Rich Li[Li0.2Ni0.2Mn0.6]O2 Cathode Material Synthesized via Ice Templating for Lithium-Ion Battery.

    Science.gov (United States)

    Li, Yu; Wu, Chuan; Bai, Ying; Liu, Lu; Wang, Hui; Wu, Feng; Zhang, Na; Zou, Yufeng

    2016-07-27

    Tuning hierarchical micro/nanostructure of electrode materials is a sought-after means to reinforce their electrochemical performance in the energy storage field. Herein, we introduce a type of hierarchical mesoporous Li[Li0.2Ni0.2Mn0.6]O2 microsphere composed of nanoparticles synthesized via an ice templating combined coprecipitation strategy. It is a low-cost, eco-friendly, and easily operated method using ice as a template to control material with homogeneous morphology and rich porous channels. The as-prepared material exhibits remarkably enhanced electrochemical performances with higher capacity, more excellent cycling stability and more superior rate property, compared with the sample prepared by conventional coprecipitation method. It has satisfactory initial discharge capacities of 280.1 mAh g(-1) at 0.1 C, 207.1 mAh g(-1) at 2 C, and 152.4 mAh g(-1) at 5 C, as well as good cycle performance. The enhanced electrochemical performance can be ascribed to the stable hierarchical microsized structure and the improved lithium-ion diffusion kinetics from the highly porous structure.

  18. Molecular weight and related properties of lily amylose determined by monitoring of elution from TSK-GEL PW high performance gel chromatography columns by the low-angle laser light scattering technique and precision differential refractometry.

    Science.gov (United States)

    Takagi, T; Hizukuri, S

    1984-05-01

    Amylose was fractionated according to its molecular weight by high performance gel chromatography using columns of a TSK-GEL PW series. Elution from the columns was monitored with a low-angle laser light scattering photometer and a precision differential refractometer. The following results were obtained indicating that the procedure is highly efficient for characterizing an amylose preparation with respect to its molecular weight: 1) the weight-average molecular weight of lily amylose used as a test material was determined to be 786,000 +/- 26,000 (n = 7); 2) the molecular weight distribution curve of the amylose was worked out from the chromatographic data; and 3) based on the concept of the universal calibration curve, the Mark-Houwink-Sakurada equation of the amylose was presumed to be [eta] = 2.27 X 10(-4)M0.62 (dl/g). The technique saves time and sample significantly compared with the conventional ones, and consequently enables the characterization of amylose in aqueous solvents without either the degradation or association peculiar to the amylose molecule.

  19. Organic-Acid-Assisted Fabrication of Low-Cost Li-Rich Cathode Material (Li[Li1/6Fe1/6Ni1/6Mn1/2]O-2) for Lithium-Ion Battery

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Taolin; Chen, Shi; Li, Li; Zhang, Xiaoxiao; Wu, Huiming; Wu, Tianpin; Sun, Cheng-Jun; Chen, Renjie; Wu, Feng; Lu, Jun; Amine, Khalil

    2014-12-24

    A novel Li-rich cathode Li[Li1/6Fe1/6Ni1/6Mn1/2]O-2 (0.4Li(2)MnO(3-)0.6LiFe(1/3)Ni(1/3)Mn(1/3)O(2)) was synthesized by a solgel method, which uses citric acid (SC), tartaric acid (ST), or adipic acid (SA) as a chelating agent. The structural, morphological, and electrochemical properties of the prepared samples were characterized by various methods. X-ray diffraction showed that single-phase materials are formed mainly with typical alpha-NaFeO2 layered structure (R3 m), and the SC sample has the lowest Li/Ni cation disorder. The morphological study indicated homogeneous primary particles in good distribution size (100 nm) with small aggregates. The Fe, Ni, and Mn valences were determined by X-ray absorption near-edge structure analysis. In coin cell tests, the initial reversible discharge capacity of an SA electrode was 289.7 mAh g(-1) at the 0.1C rate in the 1.54.8 V voltage range, while an SC electrode showed a better cycling stability with relatively high capacity retention. At the 2C rate, the SC electrode can deliver a discharge capacity of 150 mAh g(-1) after 50 cycles. Differential capacity vs voltage curves were employed to further investigate the electrochemical reactions and the structural change process during cycling. This low-cost, Fe-based compound prepared by the solgel method has the potential to be used as the high capacity cathode material for Liion batteries.

  20. Ridgefield - Shiny Geranium and Fragrant Water Lily

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The proposed project is a part of the Ridgefield NWR invasive species management program, and will help achieve goals and priority habitats identified in the Refuge...

  1. Lily Pad Doubling: Proportional Reasoning Development

    Science.gov (United States)

    Robichaux-Davis, Rebecca R.

    2017-01-01

    Progressing from additive to multiplicative thinking is critical for the development of middle school students' proportional reasoning abilities. Yet, many middle school mathematics teachers lack a thorough understanding of additive versus multiplicative situations. This article describes a sequence of instructional activities used to develop the…

  2. A new method for promoting lily flowering

    African Journals Online (AJOL)

    Jane

    2011-08-08

    Aug 8, 2011 ... ... Conglin Huang1, Zhongyi Wu1, Guixia Jia2* and Xiuhai Zhang1*. 1Beijing Agro-Biotechnology Research Center, Beijing Academy of Agriculture and Forestry Sciences, Beijing, China. 2College of Landscape Architecture, National Engineering Research Center for Floriculture, Beijing Forestry University,.

  3. Kunstikonkursi parimad on selgunud / Lili Saksing

    Index Scriptorium Estoniae

    Saksing, Lili

    2009-01-01

    Kehtna Kunstide Kooli Raplamaa lastele ja noortele mõeldud 2009. a. kunstikonkursist "Oma silmaga" teemal "Mõttemaja". Konkursi võitjad. Peapreemia pälvis Joosep Viitkar. Kehtna Kunstide Kooli saalis avati näitus, kus on eksponeeritud 77 tööd seitsmest koolist. Lisatud žürii liikmete ja näituse kujundaja kommentaarid

  4. Kunstikonkurss "Oma silmaga" 2009. aastal / Lili Saksing

    Index Scriptorium Estoniae

    Saksing, Lili

    2009-01-01

    Kehtna Kunstide Kooli korraldatav Raplamaa laste ja noorte kunstikonkurss "Oma silmaga" toimub 2009. a. teemal "Mõttemaja". Ülesandeks on luua tasapinnaline töö, kus kujutatakse Raplamaal asuvat mõttemaja, mille töö autor on ise kavandanud ja sobitanud valitud ümbrusse. Rändnäitus 2008. a. konkursi töödest teemal "Aeg ja mina" on jõudnud Kohila Koolituskeskusesse Tohisoo mõisas

  5. Potential of Spectral Reflectance as Postharvest Classification Tool for Flower Development of Calla Lily (Zantedeschia aethiopica (L. Spreng. Potencial de la Reflectancia Espectral como Herramienta para la Clasificación Poscosecha del Desarrollo Floral en Cala (Zantedeschia aethiopica (L. Spreng.

    Directory of Open Access Journals (Sweden)

    Antonio J . Steidle Neto

    2009-12-01

    Full Text Available Unsuitable postharvest management is one of the most serious problems that floriculture has to face. An option for reducing postharvest losses is to use automatic systems for flower sorting and classification, which yield consistent results, reduce costs and speed up these tasks. The objective of this work was show the potential of spectral reflectance to distinguish different postharvest development stages of calla lily flowers, Zantedeschia aethiopica (L. Spreng., aiming the use of this technology within automatic systems for flower classification. The measuring equipment was a spectrometer connected to a portable computer and configured for reflectance data acquisition in the 400 to 1000 nm range. Based on the results, it was verified a differentiation between the spectral reflectance curves of calla lily flowers, with gradual decreases on the measured values according to the increase of the senescence stages. Thus, the spectral reflectance has potential to be used in the development of automatic systems for postharvest classification of calla lily flowers.El manejo poscosecha inadecuado es uno de los problemas más serios que la floricultura tiene que enfrentar. Una opción para reducir las pérdidas poscosecha es emplear sistemas automáticos para ordenar y clasificar las flores, los cuales permiten resultados consistentes, reducen gastos y aceleran estas tareas. El objetivo de este trabajo fue demostrar el potencial de la reflectancia espectral para discriminar las diferentes fases de desarrollo poscosecha de flores de cala (Zantedeschia aethiopica [L.] Spreng., visando el uso de esta tecnología en sistemas automáticos para la clasificación de flores. El equipo de medición fue un espectrómetro conectado a un computador portátil y configurado para la adquisición de datos de reflectancia comprendidos en la región espectral de 400 a 1000 nm. Con base en los resultados, se constató una diferencia entre las curvas de reflectancia

  6. Propriedades termodinâmicas de adsorção de água do amido de rizomas do lírio-do-brejo (Hedychium coronarium Thermodynamic properties of water adsortion of the starch of rhizome of swamp lily (Hedychium coronarium

    Directory of Open Access Journals (Sweden)

    Diego Palmiro Ramirez Ascheri

    2009-06-01

    Full Text Available Determinaram-se as propriedades termodinâmicas (entalpia diferencial, entropia diferencial, entalpia integral e entropia integral do amido de rizomas do lírio-do-brejo (Hedychium coronarium por meio de isotermas de adsorção de água. As isotermas foram determinadas em atividades de água no intervalo de 0,11 a 0,84, sob temperaturas que variaram de 30 a 50 °C. A Equação de GAB, que se ajustou bem às isotermas experimentais, foi utilizada para estimar as propriedades termodinâmicas de adsorção. As isotermas apresentaram ligeira inversão, indicando a precença de amido danificado. A entalpia diferencial e a entropia diferencial aumentaram com a diminuição da umidade de equilíbrio e correlacionaram entre si confirmando a compensação química linear. Um modelo exponencial do tipo Y = b.e(a/Xe descreveu adequadamente a dependência destas propriedades diferenciais ao teor de umidade de equilíbrio. A entalpia integral e a entropia integral aumentaram continuamente com o teor de umidade de equil��brio, porém com valores negativos para a entropia integral. Estas propriedades termodinâmicas de adsorção de água demonstraram que o amido extraído dos rizomas do lírio-do-brejo possui baixa higrocopicidade apesar da ocorrência de grânulos de amido danificados.Thermodynamic properties where determined (differential enthalpy, of differential entropy, integral enthalpy, and integral entropy of the starch of rhizomes of swamp lily through water adsorption isotherms. The isotherms were determined in water activities in the range of 0.11 to 0.84, in temperatures ranging from 30 to 50 °C. The GAB equation which fits well to the experimental isotherms was used to estimate the properties of thermodynamic adsorption. The slight reversal of the isotherms indicates damaged starch. The enthalpy and entropy differential gap increased with the decrease in moisture and correlated to each other confirming the chemical linear compensation. An

  7. Cinética de remoção de matéria orgânica em sistemas alagados construídos cultivados com lírio amarelo Organic matter removal kinetics in constructed wetlands cultivated with yellow lily

    Directory of Open Access Journals (Sweden)

    Renata C. Chagas

    2011-11-01

    Full Text Available Objetivou-se, com a realização deste trabalho, obter o ajuste do modelo matemático adaptado de cinética de primeira ordem e os respectivos parâmetros cinéticos para descrição da degradação da matéria orgânica em SACs cultivados com lírio amarelo (Hemerocallis flava, no tratamento de esgoto doméstico. Os SACs foram cultivados com lírio amarelo e submetidos a diferentes taxas de carregamento orgânico superficial (TCOs de esgoto doméstico: 44; 98; 230 e 395 kg ha-1 d-1 de DBO. O modelo matemático adaptado de decaimento do material orgânico apresentou bom ajuste e descreveu adequadamente a cinética de remoção de matéria orgânica (DQO nos sistemas avaliados apresentando, geralmente, R² superior a 75%. Em ordem crescente de TCO valores de coeficientes de degradação (Kv foram, respectivamente, de 0,45; 0,69; 1,23 e 1,72 d-1, considerados baixos para os dois primeiros SACs e normais para os outros dois, e os valores de "n" de 0,448; 0,107; 0,327 e 0,461, na faixa normalmente encontrada na literatura.This work aimed to obtain the adjustment of the mathematical model adapted from the first order kinetics and its respective parameters for describing the organic matter degradation in constructed wetlands (CWs planted with yellow lily (Hemerocallis flava for the treatment of domestic sewage. The CWs were cultivated with yellow lily and subjected to different surface organic loading rates (TCOs of domestic sewage: 44, 98, 230 and 395 kg ha-1 day-1 BOD. The mathematical model adapted from the decay of organic material showed a good fit and adequately described the kinetics of removal of organic matter (COD in the evaluated systems, with generally more than 75% R². In ascending order of TCO values of degradation coefficients (Kv were, respectively, of 0.45, 0.69, 1.23 and 1.72 d-1, considered low for the first two CWs and normal for the other two, and the values of "n" of 0.448, 0.107, 0.327 and 0.461 in the range normally found in

  8. Soluções de condicionamento para conservação pós-colheita de inflorescências de copo-de-leite armazenadas em câmara fria Conditioning solutions for post harvest conservation of calla lily in cold chamber

    Directory of Open Access Journals (Sweden)

    Elka Fabiana Aparecida Almeida

    2007-10-01

    Full Text Available As informações sobre a conservação pós-colheita de copo-de-leite são escassas, apesar da sua importância comercial. Este trabalho teve como objetivo testar soluções de condicionamento para aumentar a durabilidade dessas inflorescências. Assim, testou-se o efeito do tratamento das hastes de copo-de-leite em soluções de condicionamento com hipoclorito de sódio (2%, ácido cítrico (200mg L-1 e cloreto de cálcio (1000mg L-1. Avaliou-se também a influência da imersão pré-armazenamento das inflorescências em solução com Hidrosan® e a utilização deste conservante em solução de condicionamento das hastes para armazenamento em câmara fria. As inflorescências foram avaliadas diariamente quanto à durabilidade a partir do critério de classificação estabelecido (classes A1, A2, B e C e pela medida do comprimento e largura da espata. O pré-tratamento das inflorescências em Hidrosan® ou a colocação das hastes neste conservante em câmara fria ou nos demais produtos não influenciaram na durabilidade das inflorescências de copo-de-leite, que apresentaram uma longevidade total de 11 dias. Os diferentes produtos avaliados não influenciaram na largura e no comprimento da espata. Observou-se que, independentemente dos tratamentos, a largura da espata aumentou até o 7° dia e o comprimento até o 8° dia, diminuindo após este período. O aumento das dimensões da espata caracteriza o processo de abertura e a redução da mesma indica a senescência pela murcha.Information on post harvest conservation of calla lily is rare despite its commercial importance. This study was aimed at testing different conditioning solutions in order to increase inflorescence durability. The maintenance of calla lily stems on sodium hypochlorite (2%, citric acid (200mg L-1 and calcium chlorate (1000mg L-1 solutions was evaluated. The influence of a stem pre-storage immersion in Hidrosan® solution, as well as its use as a conditioning solution

  9. Latviešu literārā valoda 19. gs. 80.–90. gados

    Directory of Open Access Journals (Sweden)

    Aina Blinkena

    2011-11-01

    Full Text Available LETTISCHE SCHRIFTSPRACHE IN DEN 80.–90. J. DES 20. JHZusammenfassungDie Entwicklung der lettischen Schriftsprache hat sich in ihren verschiedenen Bestehungsetappen nicht gleichartig breit erforscht geworden.Die Sprache den letzten Jahrzehnten des 19. Jh. haben die Sprachwissenschaftler weniger Aufmerksamkeit geschenkt, doch in dieser Zeit vollziehen sich aktive Prozesse, die zur heutige Sprachnorm füren.In diesen Jahren hat sich die nationale Kultur gebildet, es entsteht und entwickelt sich die Literatur verschiedener Genres und Stile, die zur Klassik der lettischen Literatur geworden ist, es entwickelt sich schnell das Buchwesen. In 1886–1900 sind mehr als 3500 Titel von Büchern herausgegeben, es bestehen 100 Verlage.Große Rolle für die Erforschung und Pflege des Lettischen hat die Wissenschaftliche Kommission des Rigaer Lettischen Vereins (gegr. 1868 gespielt, die die orthographischen Prinzipien vervollkommen hat und in den von der Kommission herausgegebenen Schriften wurden die theoretischen Forschungen über die lettischen Sprache veröffentlicht. Es bildete sich die wissenschaftliche Terminologie. Die Arbeit haben die ersten akademisch gebildeten Sprachwissenschaftler der lettischen Nation K. Mühlenbach, J. Kauliņš, J. Endzelīns, P. Šmits begonnen, deren Werke als eine Brücke zum 20. Jahrhundert führt.

  10. [Luuletused] / no igauņu valodas atdzejojis Guntars Godiņš

    Index Scriptorium Estoniae

    fs, pseud., 1971-

    2005-01-01

    Sisu: "kas mēs esam..." ; "Dzejnieki dzejo par dzejoshanu..." ; "ko gan es iesāktu bez Tevis Ave..." ; "strādāju arhīvā..."; "mīli mani no deviņiem līdz pieciem..." ; "kad cilvēks nomirst..." ; "skarbs vīrs no rīta iziet laukā..."

  11. Aspects of bulblet growth of lily in vitro

    NARCIS (Netherlands)

    Askari Rabori, N.

    2016-01-01

    Many geophytes have a high ornamental value. They are preferably propagated by micropropagation because in this way large quantities of uniform, disease-free starting material are produced in a short period of time. In comparison with shoots, bulblets have several clear advantages as starting

  12. Cryopreservation of seeds of lily [Lilium Iedebourii (Baker) Bioss ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-18

    Aug 18, 2009 ... Behzad Kaviani*, Davood Hashem Abadi, Ali Mohammadi Torkashvand and Shahram. Sedaghat Hoor. Department of Horticultural Science, Faculty of Agriculture, Islamic Azad University, Rasht Branch, Rasht, Iran. Accepted 20 March, 2009. Cryopreservation of germplasm at liquid nitrogen (-196°C) is a ...

  13. Studies on the chromosomes of tropical lilies 2: karyotype of ...

    African Journals Online (AJOL)

    Further to the work on the members of the West Tropical African “Lilies”, the karyotype of Gloriosa superba is reported. Chromosome count from root tip cells showed 2n = 56 and the karyotype consists of 16 pairs of metacentric chromosomes and 12 pairs of sub-metacentries. Journal of Applied Chemistry and Agricultural ...

  14. Hydroponic technology for lily flowers and bulbs production using ...

    African Journals Online (AJOL)

    Aghomotsegin

    2015-07-22

    Jul 22, 2015 ... nutrient Film technique with application of rainwater as nutrient solution and some common nutrient ... equipments ICP- MS Instrument and ICP- OES Instrument were used to determine all nutrient elements .... area of 126.11 cm2 per flower. Table 2 results show that the application of flower buds and bulb ...

  15. Characterization of cadmium uptake by the water lily Nymphaea aurora.

    Science.gov (United States)

    Schor-Fumbarov, Tamar; Keilin, Zvika; Tel-Or, Elisha

    2003-01-01

    This study characterizes cadmium (Cd) uptake by the waterlily Nymphaea aurora, (Nymphaeaceae) in two systems: a model hydroponic Cd solution and heavily polluted sludge from two sites in Israel. The uptake of Cd from hydroponic solution resulted in Cd storage in petioles and laminae of Nymphaea, as well as in the roots. The pH of the solution affected Cd solubility and availability, with pH 5.5 yielding maximum Cd content in the plant (140 mg Cd per g DW). Cd uptake was reduced by the addition of EDTA to the hydroponic growth medium, although EDTA enhanced heavy metal uptake by terrestrial plants. Nymphaea efficiently reduced the concentration of Cd in heavy metal polluted urban and industrial sludge and the amount of Cd uptake was enhanced by the addition of KCl to the sludge and by adjustment of the pH to 5.5. The inherent growth patterns of Nymphaea plants allowed Cd uptake by the shoot and root, and resulted in maximum contact between the various plant parts and the growth media. Thus, Nymphaea has potential as an optimal, highly effective phytoremediation tool for the removal of Cd from polluted waste sources.

  16. Response of arum lily calli to culture filtrate of Pectobacterium ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    . Kumar JV, Kumari BDR, Sujatha G, Castan E (2008). Production of plants resistant to Alternaria carthami via organogenesis and somatic embryogenesis of safflower cv. NARI-6 treated with fungal culture filtrates. Plant Cell ...

  17. Hydroponic technology for lily flowers and bulbs production using ...

    African Journals Online (AJOL)

    Aghomotsegin

    2015-07-22

    , Ferric sulfate, magnesium sulfate anhydrous, manganese sulfate monohydrate, potassium chloride, potassium iodide, potassium nitrate, sodium phosphate monobasic, sodium sulfate anhydrous, zinc sulfate heptahydrate ...

  18. Pavasarnakts : [luuletused] / Andres Ehin ; Andress Ehins, no igaņu valodas atdzejojis Guntars Godiņš

    Index Scriptorium Estoniae

    Ehin, Andres, 1940-2011

    2005-01-01

    Sisu: Pavasarnakts ; Būt suņa dzīvoklim ; "baltajā naktī..." ; Atmiņu bilde ; "ceļas vējsh" ; Sarkankrūtīsha saprāts ; Redzējums ; "dziļi zem zemes dzīvo..." ; Esmu, esmu, esmu... ; Nūdeles un makarona mīlestība ; "aiz vemmorskas bodes..." ; Haiku : [6 haikut] ; Esmu jūsu pazudusī mashīna ; Pakārtais ievārījums : (fragments)

  19. Autorteksts kā nacionālā korpusa un rakstnieka valodas vārdnīcas resurss

    Directory of Open Access Journals (Sweden)

    Maija Baltiņa

    2012-04-01

    Full Text Available AUTHOR’S TEXT AS A RESOURCE FOR THE NATIONAL CORPUS AND THE WRITER’S LANGUAGE DICTIONARYSummaryA dictionary of a writer’s language is a vocabulary that has been methodically collected, analyzed and commented upon and represents the language as used by a particular author. The existence of such dictionaries indicates the level of the specific cultural environment, the stage of development of humanities and the capacity of computer resources.In the first stage of the project, the corpus of the writer’s language is created by collecting all the necessary texts of a selected author in a digital form. In the second stage, linguistic analysis of the corpus of the writer’s language is carried out using the existing and improved technologies (software and software tools. And, finally, in the third stage, on the basis of the corpus of the writer’s language a dictionary of the writer’s language is created according to set thematic, philological and stylistic intentions. The analysis is carried out on three levels: computational linguistic, philological and cultural semiotic.The computerized environment provides a precise quantitative characterization of the writer’s vocabulary (part of speech, word use, collocations etc.. From the philological point of view, vocabulary is analyzed with the help of software tools that help identify and demonstrate the stylistic characterization of the writer’s language, namely, the writer’s vocabulary and word use (e.g. metaphors, synonyms, similes etc.. Another benefit of computerized analysis is related to the intention to acquire a more complete and comprehensive idea about specific features of the writer’s language style.

  20. [Luuletused] / Kristīna Ehina ; no igauņu valodas atdzejojis Guntars Godiņš

    Index Scriptorium Estoniae

    Ehin, Kristiina, 1977-

    2005-01-01

    Sisu: No grāmatas Simuna diena: [Tekst raamatu "Simunapäev" tagakaanelt] ; "nemanot uzrodas migla..." ; "tavas bungas ir mēmas..." ; "tas laiks ir pienācis..." ; "mēs neatradām ceļu..." ; "guļu kā dūņas mezhā..." ; No grāmatas Gulbja kaulu pilsēta: [Tekst raamata "Luigeluulinn" tagakaanelt] ; "dzemdēt bērnus..." ; "tu sēdi pie galda raksti..." ; "kāda meitene..." ; "dodas karā mans brālis...". Luuletusi kogudest "Simunapäev" ja "Luigeluulinn"

  1. Ilustratīvā materiāla atveide „Mūsdienu latviešu valodas vārdnīcā”

    Directory of Open Access Journals (Sweden)

    Ieva Zuicena

    2012-04-01

    Full Text Available THE QUESTION OF ILLUSTRATIVE EXAMPLES IN EXPLANATORY DICTIONARIES AND THE DICTIONARY OF CONTEMPORARY LATVIAN LANGUAGESummaryThere are two kinds of illustrative examples that are used in explanatory dictionaries: quotations and combination of words (phrases. Quotations are usually included in large dictionaries of many volumes, but phrases are popular in ordinary explanatory dictionar­ies.In explanatory dictionaries illustrative examples have several functions: 1 to confirm that a corresponding word really exists in language; 2 to demonstrate how the word is used in a context; 3 to supply with additional information.In the Dictionary of Contemporary Latvian Language illustrative examples are mainly given in the form of phrases, although sometimes quotations are also used, because there are several word groups that need a larger context (e.g., words with a figurative meaning, stylistically marked words or meanings, interjections.

  2. Latviešu valodas nebalsīgo frikatīvo spraudzeņu intensitātes raksturojums

    Directory of Open Access Journals (Sweden)

    Inese Indričāne

    2014-11-01

    Full Text Available Intensity characteristics of the Latvian voiceless fricativesSummary In the present research the intensity of the prevocalic voiceless fricatives of the Standard Latvian in the context of vowels [i], [iː], [ɑ], [ɑː], [u], [uː] has been investigated. The aim of this study is to compare results obtained for each voiceless fricative of the Standard Latvian by different approaches to intensity measurements (obtaining the intensity values of 1 spectral peaks; 2 overall intensity in the selection of 40 ms; 3 relative intensity.There are four voiceless fricatives in the Standard Latvian: labiodental /f/, dental /s/, alveolar /ʃ/ and velar /x/. The place of articulation of fricative /x/ varies from velar in the context of back vowels to palatovelar or palatal in the context of front vowels.The results are based on the analysis of speech data provided by 5 speakers of the Standard Latvian (men at the age between 19 and 39 having no speech disorders in their pronunciation. The analysed material consists of isolated symmetrical /CVC/ syllables, e. g., sis [sis], sīs [siːs], sas [sɑs], sās [sɑːs], sus [sus], sūs [suːs]. Each syllable was pronounced 3 times by each speaker. The total number of analysed speech units is 320.Data processing was performed using the software Wave Pad 5.40 (NHC Software, Inc., Audacity 2.0.3 (SourceForge.net, AudacityTeam.org, Multi Speech 3700 (Kay Pentax, Praat 5.3.55 (Paul Boersma and David Weenink, SPSS 16 (IBM Corporation, Inc. and MS Excel 10 (Microsoft Corporation.The intensity of spectral peaks for each voiceless fricative of the Standard Latvian was determined using FFT spectra obtained by software Multi Speech 3700. All FFT spectra were obtained from 40 ms interval selected approximately in the middle part of voiceless fricative. The intensity value was determined for the highest peak in the FFT spectrum corresponding to the maximum of energy in the frequency range 0–10 000 Hz. Using software Praat 5.3.55 overall intensity for the same 40 ms selection for each voiceless fricative of the Standard Latvian was obtained. Overall intensity in the selection of 40 ms was measured also in the middle part or steady state of the following vowel. According to these data, mean value (VSV, standard deviation (SN as well as minimal (Min. and maximal (Maks. value was calculated for peak intensity (table 1-2, column I and overall intensity in the 40 ms selection (for voiceless fricatives: table 1-2, column II; for following vowels: table 1-2, column III. The term relative intensity (table 1-2, column IV in the present research is refered to the ratio between the mean value of overall intensity of voiceless fricative and following vowel.  Comparing three approaches used to determine intensity of voiceless fricatives, more consequent results are obtained by measuring overall intensity in the 40 ms selection and relative intensity. However, only relative intensity presents the most objective characteristics of the voiceless fricatives of the Standard Latvian since this approach takes into account not only properties of voiceless fricatives and influence of phonetic context but also several conditions related to the recording process (e. g., variations in loudness of voice or different recording level. According to the mean value of overall intensity and the value of relative intensity it is possible to separate voiceless sibilants [s], [ʃ] from voiceless non-sibilants [f], [x] in the context of all vowels, whereas the mean value of intensity obtained for spectral peaks of the voiceless non-sibilant [x] in the context of rounded vowels [u], [uː] overlap with the corresponding mean value of both voiceless sibilants.

  3. Apģērba nosaukumi 17. gadsimta latviešu valodas vārdnīcās

    Directory of Open Access Journals (Sweden)

    Ilga Jansone

    2011-12-01

    Full Text Available LES NOMS DES VÊTEMENTS DANS LES DICTIONNAIRES DU XVII-e SIÈCLERésuméL’article est consacré à l’analyse des noms des vêtements dans les dictionnaires lettons du XVII-e siècle (G.Mancelius „Lettus, das ist Wortbuch Sampt angehengtem täglichem Gebrauch der Lettischen Sprache; Allen und jeden Aussheimischen die in Churland Semgallen und Lettischem Liefflande bleiben und sich redlich nehren wollen zu Nutze verfertigt durch Georgium Mancelium Semgall.“ [Manc] Riga 1638, Dicti­onnaire letton-allemand de J.Langius de 1685 avec une brève grammaire lettonne [Lg.] (d’après la photocopie du manuscrit édité et complété avec un aperçu par E.Blesse en 1936 à Riga; Dictionnaire de Ch.Fürecker „Lettisches und Teutsches Wörterbuch zusammen geschrieben und mit fleiss gesamlet von Christopher Fürecker“ (Riga 1997 [Kr.].Tous les dictionnaires du XVII-e siècle sont bilingues avec le letton dans les positions active ou passive. Tenant comple d’une expérience minime de la lexicographie en Europe et ses premiers pas en Lettonie, on peut remarquer plusieurs imprécisions, notamment la structure des entrées n’est pas élaborée; l’ordre alphabé­tique n’est pas toujous observé, par conséquent il est impossible de donner des statistiques précises sur des mots inclus dans tel ou tel groupement thématique.Dans les dictionnaires du XVII-e siècle il n’est pas possible de préciser les vêtements masculins des vêtements féminins (à cause des traits spécifiques de dictionnaires bilingues, par contre, on peut distinguer plusieurs groupements thématiques pour des vêtements: généralités; vêtements de dessus; vêtements; couvre-chefs et couvre-épaules; chaussures; gants, chaussettes et bas; accessoires; noms des éléments vestimentaires. Plusieurs noms des vêtements ou de leurs éléments enregistrés dans les dictionnaires du XVII-e siècle ont gardé leur structure morphologique jusqu’à nos jours (des différences phonétiques sont généralement liées à l’orthographie imprécise, mais il y a aussi des changements qui se rapportent à la terminaison, à la finale, par exemple, ohders, aussi wohders Lg. 182; uhswalcka Lg. 271, vswalckas Manc. 98, 102, apsehja Fīr. 176, bannitis Fīr. 38, sabaka Manc. 176, sahbaka Lg. 228, tuhbas sahbakas Lg. 317, cimbda Manc. 162, apauas Lg. 22, Fîr. 25, kabbats Lg.98; lindraks Fīr. 129 et lindruks Lg. 347’, peedroksne, peedruksne, peedrukne Fīr. 180, peedraukne Manc. 54Plusieurs noms des vêtements, fixées dans les dictionnaires de l’époque ont connu des changements sémantiques. On peut observer la restriction de sens (par exemple, pour le léxème auts, soit l’élargissement de sens (pour le léxème kažoks, par exemple. Certaines noms, désignant le vêtements ou ses éléments, sont disparus de la langue littéraire ou se sont conservés dans les systèmes périphériques de la langue lettonne.D’après leurs origines ces noms se rapportent soit au fonds principal (sagša, josta etc., soit ce sont des emprunts aux langues germaniques (bikses, lindraki, knope, knipele etc., soit aux langues slaves (mētelis, kažoks, zābaks, soit aux langues romanes (bannitis, tupele, vamzis.

  4. Dziesmas vārdu krājuma apguvei angļu valodas nodarbībās pirmsskolā

    OpenAIRE

    Japina, Līga

    2017-01-01

    Agrīna valodu mācīšanās kļūst arvien populārāka visā Eiropā pēdējo desmitgažu laikā, un šo tendenci var novērot arī Latvijā, angļu valodu apgūst pirmsskolas izglītības iestādēs un bērnudārzos visā valstī. Bērni nemācās svešvalodu tāpat kā pieaugušie, tāpēc ir nepieciešams, lai valodu mācītu pirmsskolas audzēkņiem atbilstoši viņu vecumam un briedumam, lai nodrošinātu to, ka mācības ir efektīvas un metodes, kas tiek izmantotas, ir piemērotas audzēkņiem. Galvenā mācību forma bērniem pirmskolā ir...

  5. Līdzsvarots mūsdienu latviešu valodas tekstu korpuss un tā tekstu atlases kritēriji

    Directory of Open Access Journals (Sweden)

    Kristīne Levāne-Petrova

    2012-04-01

    Full Text Available THE BALANCED CORPUS OF MODERN LATVIAN AND THE TEXT SELECTION CRITERIASummaryRecently The Balanced Corpus of Modern Latvian (~3.5 million running words has been created in the Institute of Mathematics and Computer Science (IMCS (see http://www.korpuss.lv. The Corpus has been compiled from printed and electronic materials created after 1990. The Corpus is automatically morphologically tagged: for each token all the syntactically valid interpretations are stored.Texts for the Corpus were chosen according to different text selection criteria: for instance, time, media, domain, etc. This article discusses the text selection criteria chosen for this Corpus, problems related to Corpus design and text selection criteria, solutions found for these problems and future plans regarding the Corpus.

  6. Een stad, drie rooikoppe, sewe dae. Adeline en Lili Radloff. Pretoria ...

    African Journals Online (AJOL)

    dink duidelik verklap dat hy met 'n diep verbitterdheid rassisties, seksisties en homo- fobies is. Reeds met die “proloog” word daar begin om subtiel spanning op te bou en te sorg dat die leser begin bespiegel. Daar is hoofstukke wat slegs uit dialoog of. 'n telefoonoproep bestaan—'n goeie illustrasie van die skryfreël show, ...

  7. Deterrence, Lily Pads, And Regionally Aligned Forces: Keys To The Successful Application Of Strategic Landpower

    Science.gov (United States)

    2016-05-26

    unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT The US military uses prepositioned stocks located in Western Germany in conjunction with regionally...closer to Russia facilitates a forward deterrence posture. The US military must move current prepositioned stocks from Western Germany to allied nation...17 Sustainment of Prepositioned Stocks

  8. Establishment of the total RNA extraction system for lily bulbs with ...

    African Journals Online (AJOL)

    NaCl concentration of both CTAB and SDS protocols was increased in order to get rid of the polysaccharides in scales. The resulting RNA is of high-quality, as judged by agarose gel electrophoresis and UV-spectroscopic analysis. Furthermore, the middle scales obtain the highest RNA yield followed by the exterior and the ...

  9. Use of 2n gametes for inducing intergenomic recombination in lily hybrids

    NARCIS (Netherlands)

    Barba Gonzalez, R.; Lim, K.B.; Ramanna, M.S.; Tuyl, van J.M.

    2004-01-01

    Genetic recombination is an important pre-requisite for transferring specific genetic traits across distantly related plant species. With a view to transfer some of the desirable characters like resistances against viruses, Fusarium and Botrytis, besides many horticultural traits, we have made

  10. Inflorescence bulbils of tiger lily in vivo and bulbils culture in vitro

    African Journals Online (AJOL)

    Aghomotsegin

    bulblets, roots and number, weight (g), length (cm) of shoots per bulbils were collected after eight weeks of culture. The statistical analysis system (SAS, 2012) was used to show the effect of different factors in the study parameters. Significant difference-LSD test was used in this study to significant compare between means.

  11. Evaluation of the corrosion inhibition potentials of green-tip forest lily ...

    African Journals Online (AJOL)

    Plant extracts are excellent alternatives as corrosion inhibitors because of availability, low toxicity, biodegradability and low cost. In this study, corrosion tests were performed on mild steel to evaluate the effect of concentration of inhibitor, varying immersion period and temperature on the corrosion inhibition properties of ...

  12. Expression pattern of INNER NO OUTER homologue in Nymphaea (water lily family, Nymphaeaceae).

    Science.gov (United States)

    Yamada, Toshihiro; Ito, Motomi; Kato, Masahiro

    2003-10-01

    Two homologues of INNER NO OUTER ( INO) in Nymphaea alba and N. colorata (Nymphaeaceae) were isolated and the expression pattern of the N. alba INO homologue NaINO was examined by in situ hybridization. The INO homologues obtained have a portion similar to INO in the predicted amino acid sequences between the conserved zinc finger-like and YABBY domains. In an in situ hybridization analysis, NaINO is expressed in the outer epidermis of the outer integument, inner integument, and the tip of the nucellus. The pattern observed in the outer integument is very similar to that of Arabidopsis thaliana, while the expression in the inner integument and nucellus is not observed in A. thaliana.

  13. Agrobacterium-mediated transformation of Easter lily (Lilium longiflorum cv. Nellie White)

    Science.gov (United States)

    Conditions were optimized for transient transformation of Lilium longiflorum cv. Nellie White using Agrobacterium tumefaciens. Bulb scale and basal meristem explants were inoculated with A. tumefaciens strain AGL1 containing the binary vector pCAMBIA 2301 which has the uidA gene that codes for ß-gl...

  14. In vitro micro-propagation of Longiflorum-Asiatic (LA) hybrids lily ...

    African Journals Online (AJOL)

    Journal Home > Vol 11, No 70 (2012) > ... disinfection in 75% alcohol for 10 to 60 s, disinfection in 2% NaClO solution for 15 min; the optimum ... naphlene acetic acid (NAA) + 90 g·L-1 sucrose, and 25°C and in darkness; the optimum medium ...

  15. Evaluation of macronutrient demand in calla lily (Zantedeschia aethiopica)

    DEFF Research Database (Denmark)

    Carneiro, Daniella N. M.; Lopes Coelho, Lívia; Paiva, Patrícia D. O.

    2015-01-01

    part (leaves, rhizomes, roots and flower stalks) and then calculated the dry mass accumulation and the nutrient contents. A randomized block study design was applied, with 4 replicates, totaling 48 plots. The aerial parts of the plants showed macronutrient content and accumulation in the sequences K...

  16. Features of ionogenic group composition in polymeric matrix of lily pollen wall.

    Science.gov (United States)

    Meychik, N R; Matveyeva, N P; Nikolaeva, Yu I; Chaikova, A V; Yermakov, I P

    2006-08-01

    The composition of ionogenic groups and ion-exchange capacity were studied in the polymeric matrix of cell walls isolated from the pollen grain and tissues of vegetative organs (leaves and stems) of Lilium longiflorum Thunb. The ion-exchange capacity was evaluated at different pH values and ionic strength of 100 mM. In the two-layered pollen wall and the somatic cell walls four types of ionogenic groups were found: amino groups, two carboxyl groups (represented by residues of uronic and hydroxycinnamic acids), and phenolic OH-groups. The groups of all four types are present in the intine, whereas the exine contains one type of anion-exchange and two types of cation-exchange groups. The contents of each type group and their ionization constants were determined. The qualitative and quantitative compositions of structural polymers of the pollen intine and somatic cell walls are significantly different. It is suggested that hydroxycinnamic acids should be involved in cross-linking of polysaccharide chains in both the intine and somatic cell primary walls, and such cross-links play a crucial role in the structural organization and integrity of the pollen grain wall.

  17. Schwerpunktseminar : "Dazugehören? Umgang mit Minderheiten" / Liliāna Vancāne

    Index Scriptorium Estoniae

    Vancāne, Liliāna

    2016-01-01

    17. -20. märtsini 2016 Tartus toimunud seminarist "Dazugehören? Umgang mit Minderheiten. Estland und Lettland gestern-heutu-morgen". Seminarist sotsiaalse kuuluvuse ja vähemuste teemal. Suurepäraselt korraldatud ürituse parim osa oli töötuba

  18. MOF QVT grafiskas formas realizācija

    OpenAIRE

    Boroviks, Dmitrijs

    2009-01-01

    Maģistra darbā tiek realizēts MOF QVT Relational valodas grafiskais redaktors. Darbā galvenā uzmanība tiek pievērsta QVT Relational valodas redaktora būvei izmantojot transformācijas vadīto arhitektūru. Izveidoto redaktoru turpmāk varēs izmantot MOF QVT valodas izplatīšanai.

  19. Effect of benzyladenine on the abundance and quality of flower yield in the calla lily (Zantedeschia spreng.

    Directory of Open Access Journals (Sweden)

    Beata Janowska

    2012-12-01

    Full Text Available The soaking of rhizomes, 15–18 cm in circumference in the cultivars 'Black Magic' and 'Mango' as well as 20+ cm in 'Albomaculata', with leaf buds 0.5–2 cm in length, in solutions of benzyladenine at concentrations of 100, 350 and 600 mg × dm-3 lasted 30 and 60 minutes. After this procedure, slightly dried rhizomes were planted into 20-cm pots. Rhizome soaking in BA at concentrations of 350–600 mg × dm-3 for 60 minutes increases the yield of flowers 3–4 times in 'Black Magic', 'Mango', and 'Albomaculata'. BA at concentrations of 350–600 mg × dm-3 retards the flowering of the cultivars 'Black Magic', 'Mango', and 'Albomaculata'. However, at 100 mg × dm-3 it brings flowering forward in 'Mango' and 'Albomacu- lata'. BA at a concentration of 600 mg × dm-3 inhibits the growth of peduncles, while at a concentration of 100–600 mg × dm-3 it causes the formation of longer spathes in the cultivar 'Albomaculata'. In 'Black Magic' at a concentration of 350–600 mg × dm-3 and in 'Mango' at a concentration of 100–600 mg × dm-3, it causes the development of flowers with a smaller weight.

  20. Diverse retrotransposon families and an AT-rich satellite DNA revealed in giant genomes of Fritillaria lilies

    Czech Academy of Sciences Publication Activity Database

    Ambrožová, K.; Mandáková, T.; Bureš, P.; Neumann, Pavel; Leitch, I. J.; Koblížková, Andrea; Macas, Jiří; Lysák, M.

    2011-01-01

    Roč. 107, č. 2 (2011), s. 255-268 ISSN 0305-7364 R&D Projects: GA ČR GA521/07/0284; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50510513 Keywords : Fritillaria * Liliaceae * repetitive DNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.030, year: 2011

  1. Comparative ovule and megagametophyte development in Hydatellaceae and water lilies reveal a mosaic of features among the earliest angiosperms.

    Science.gov (United States)

    Rudall, Paula J; Remizowa, Margarita V; Beer, Anton S; Bradshaw, Elizabeth; Stevenson, Dennis W; Macfarlane, Terry D; Tuckett, Renee E; Yadav, Shrirang R; Sokoloff, Dmitry D

    2008-05-01

    The embryo sac, nucellus and integuments of the early-divergent angiosperms Hydatellaceae and other Nymphaeales are compared with those of other seed plants, in order to evaluate the evolutionary origin of these characters in the angiosperms. Using light microscopy, ovule and embryo sac development are described in five (of 12) species of Trithuria, the sole genus of Hydatellaceae, and compared with those of Cabombaceae and Nymphaeaceae. The ovule of Trithuria is bitegmic and tenuinucellate, rather than bitegmic and crassinucellate as in most other Nymphaeales. The seed is operculate and possesses a perisperm that develops precociously, which are both key features of Nymphaeales. However, in the Indian species T. konkanensis, perisperm is relatively poorly developed by the time of fertilization. Perisperm cells in Trithuria become multinucleate during development, a feature observed also in other Nymphaeales. The outer integument is semi-annular ('hood-shaped'), as in Cabombaceae and some Nymphaeaceae, in contrast to the annular ('cap-shaped') outer integument of some other Nymphaeaceae (e.g. Barclaya) and Amborella. The megagametophyte in Trithuria is monosporic and four-nucleate; at the two-nucleate stage both nuclei occur in the micropylar domain. Double megagametophytes were frequently observed, probably developed from different megaspores of the same tetrad. Indirect, but strong evidence is presented for apomictic embryo development in T. filamentosa. Most features of the ovule and embryo sac of Trithuria are consistent with a close relationship with other Nymphaeales, especially Cabombaceae. The frequent occurrence of double megagametophytes in the same ovule indicates a high degree of developmental flexibility, and could provide a clue to the evolutionary origin of the Polygonum-type of angiosperm embryo sac.

  2. The establishment of suspension and meristem cultures for the development of a protoplast regeneration and fusion system in Lily

    NARCIS (Netherlands)

    Famelaer, I.; Ennik, E.; Tuyl, van J.M.; Meijer, H.; Creemers-Molenaar, J.

    1996-01-01

    The present results indicate that established morphogenic suspension cultures can be obtained from crosses between cultivars of L. longiflorum and from a cross between Asiatic hybrid 'Orlito' x 'Connecticut King'. Meristem cultures were obtained from L. longiflorum 'Gelria' and Oriental hybrid 'Star

  3. Shedding some light over the floral metabolism by arum lily (Zantedeschia aethiopica spathe de novo transcriptome assembly.

    Directory of Open Access Journals (Sweden)

    Elizabete de Souza Cândido

    Full Text Available Zantedeschia aethiopica is an evergreen perennial plant cultivated worldwide and commonly used for ornamental and medicinal purposes including the treatment of bacterial infections. However, the current understanding of molecular and physiological mechanisms in this plant is limited, in comparison to other non-model plants. In order to improve understanding of the biology of this botanical species, RNA-Seq technology was used for transcriptome assembly and characterization. Following Z. aethiopica spathe tissue RNA extraction, high-throughput RNA sequencing was performed with the aim of obtaining both abundant and rare transcript data. Functional profiling based on KEGG Orthology (KO analysis highlighted contigs that were involved predominantly in genetic information (37% and metabolism (34% processes. Predicted proteins involved in the plant circadian system, hormone signal transduction, secondary metabolism and basal immunity are described here. In silico screening of the transcriptome data set for antimicrobial peptide (AMP -encoding sequences was also carried out and three lipid transfer proteins (LTP were identified as potential AMPs involved in plant defense. Spathe predicted protein maps were drawn, and suggested that major plant efforts are expended in guaranteeing the maintenance of cell homeostasis, characterized by high investment in carbohydrate, amino acid and energy metabolism as well as in genetic information.

  4. ABOUT INVISIBLE QUOTATION MARKS IN ‘THE DEAD’ [LILY, GABRIEL, AND THE VENTRILOQUISM OF THE JOYCEAN NARRATOR

    Directory of Open Access Journals (Sweden)

    Omar Rodovalho

    2014-07-01

    Full Text Available A lot of Portuguese and Brazilian translations of Dubliners having been made in the last decades (at least seven already in the market, and other two coming, some aspects of its prose still remain invisible to the Brazilian and Portuguese reader, aspects that permit a very close link to the ulterior works of Joyce. Our aim, so, is to have a good look at some of these aspects that keep asking for translations.

  5. Iron (FeII Chelation, Ferric Reducing Antioxidant Power, and Immune Modulating Potential of Arisaema jacquemontii (Himalayan Cobra Lily

    Directory of Open Access Journals (Sweden)

    Rasleen Sudan

    2014-01-01

    Full Text Available This study explored the antioxidant and immunomodulatory potential of ethnomedicinally valuable species, namely, Arisaema jacquemontii of north-western Himalayan region. The tubers, leaves, and fruits of this plant were subjected to extraction using different solvents. In vitro antioxidant studies were performed in terms of chelation power on ferrous ions and FRAP assay. The crude methanol extract of leaves was found to harbour better chelating capacity (58% at 100 μg/mL and reducing power (FRAP value 1085.4±0.11 μMFe3+/g dry wt. than all the other extracts. The crude methanol extract was thus further partitioned with solvents to yield five fractions. Antioxidant study of fractions suggested that the methanol fraction possessed significant chelation capacity (49.7% at 100 μg/mL and reducing power with FRAP value of 1435.4 μM/g dry wt. The fractions were also studied for immune modulating potential where it was observed that hexane fraction had significant suppressive effect on mitogen induced T-cell and B-cell proliferation and remarkable stimulating effect on humoral response by 141% and on DTH response by 168% in immune suppressed mice as compared to the controls. Therefore, it can be concluded that A. jacquemontii leaves hold considerable antioxidant and immunomodulating potential and they can be explored further for the identification of their chemical composition for a better understanding of their biological activities.

  6. One of the Fastest-Growing Economies in the EU / Olavi Grünvald, Lili Kirikal

    Index Scriptorium Estoniae

    Grünvald, Olavi

    2007-01-01

    Eesti on jätkuvalt Euroopa Liidu üks kiiremini areneva majandusega riikidest, ülevaade Eesti olulisematest majandusnäitajatest. Diagramm: Real GDP growth; Real wages and labour productivity; Inflation and GDP in 2006. Tabel: Main economic indicators of Estonia

  7. The property and effect of bioplastic pots on the growth and developmental physiology of Lily and Begonia

    Science.gov (United States)

    Three different injection molded bioplastic (BP) pots, BP 29, BP 32, and BP 45 pots, containing processed feather fibers, were evaluated. Growth and flowering of Lilium hybrid ‘Triumphator’ and Begonia ‘Bonfire’ were evaluated in new and reused BP pots. Net photosynthesis was measured and macro- and...

  8. Ectopic expression of LLAG1, an AGAMOUS homologue from lily (Lilium longiflorum Thunb.) causes floral homeotic modifications in Arabidopsis

    NARCIS (Netherlands)

    Benedito, V.A.; Visser, P.; Tuyl, J.M. van; Angenent, G.C.; Vries, S.C. de; Krens, F.A.

    2004-01-01

    The ABC model for floral development was proposed more than 10 years ago and since then many studies have been performed on model species, such as Arabidopsis thaliana, Antirrhinum majus, and many other species in order to confirm this hypothesis. This led to additional information on flower

  9. Ectopic expression of LLAG1, an AGAMOUS homologue from lily (Lilium longiflorum Thunb.) causes floral homeotic modifications in Arabidopsis.

    NARCIS (Netherlands)

    Benedito, V.A.; Visser, P.B.; Tuyl, van J.M.; Angenent, G.C.; Vries, de S.C.; Krens, F.A.

    2004-01-01

    The ABC model for floral development was proposed more than 10 years ago and since then many studies have been performed on model species, such as Arabidopsis thaliana, Antirrhinum majus, and many other species in order to confirm this hypothesis. This led to additional information on flower

  10. Uudised : Üliõpilaste kammermuusika festival. Lili Kaelase stipendium. Uudisteos ja lautokõlad raekojas / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2000-01-01

    7.-10. dets. EMAs toimuvast rahvusvahelisest üliõpilaste kammermuusika festivalist. Täna antakse EMAs üle L. Kaelase Muusikafondi stipendiumid EMA üliõpilastele. Kontserdist sarjas "Ajastu muusikas ja sõnas" 10. dets. Tallinna Raekojas

  11. Autentiskie teksti skolēnu paredzēšanas prasmju attīstīšanai angļu valodas stundās pamatskolā

    OpenAIRE

    Lokmane-Šabovica, Iveta

    2008-01-01

    Šodien Latvijā tiek organizēti profesionālās izglītības semināri un citi izglītojoši pasākumi, kas pievēršas un analizē skolēnu nevēlēšanos piedalīties lasīšanas aktivitātēs skolā. Šī nevēlēšanās ir balstīta uz teksta izpratnes grūtībām, vienveidīgu pieeju, veidiem, kā teksti tiek piedāvāti un lasītizpratnes uzdevumu izvēli. Pasīva piedalīšanās lasīšanas aktivitātēs ietekmē skolēnu iztēli un prāta attīstību. Diplomdarbs tika rakstīts, lai noskaidrotu veidus, kā attīstīt skolēnu paredzēšanas p...

  12. Runāto un dziedāto latviešu valodas patskaņu [ī], [ā] un [ū] kvalitātes salīdzinājums

    Directory of Open Access Journals (Sweden)

    Juris Grigorjevs

    2011-12-01

    Full Text Available THE COMPARISON OF THE QUALITY OF SPOKEN AND SUNG LATVIAN VOWELS [i:], [ɑ:] AND [u:]SummaryNumerous studies in phonetics have attempted to investigate the differences between spoken and sung vowels. The majority of these studies dealt with the articulatory and acoustic changes observed in opera singers, however, there were several studies which compared the production of vowels by opera and choir singers. This article presents a pilot study performed on the basis of an audio material acquired from one informant (mezzo-soprano, where the acoustic quality of spoken Latvian vowels [i:], [ɑ:] and [u:] has been compared to the quality of the same vowels sung in isolation (in octave of La Minor, i.e., from A3 to A4, labeled in this article as octave of Do Major because of cer­tain reasons and sung in the verse of a song. It was observed during the current study that the transition from the chest register to the middle register had taken place between C4 and D4, which is normally observed in mezzo-sopranos. To make the interpretation of the influence of a variable pitch on the vowel formant pattern easier, all Latvian vowels were plotted in the psycho-physical F2ʹ/F1 (bark plane. The observed changes in F1 re­flect the tuning of the first vocal resonance to the pitch that is acquired by a jaw opening. Gradual larynx lowering and lip rounding can be the reason for lowering of F2ʹ value for [i:], reduced lip rounding — for increasing of F2ʹ value for [u:], but rising of the tongue tip — for increasing of F2ʹ value for [ɑ:]. The observed changes question the assumption that vowels in singing preserve their quality except for very low and very high registers (the octave under investigation does not belong to such registers. The minor differences observed in vowels sung in the verse from vowels sung in isolation can be explained by the influence of immediate phonetic context. It can be concluded that the data obtained in this investigation, in general, correspond to the findings of similar studies performed for other languages.

  13. Jauktā mācīšanās skolēnu iesaistīšanai angļu valodas stundās 7.klasē

    OpenAIRE

    Podziņa, Laura

    2017-01-01

    Mūsdienu tehnoloģijas strauji mainās un attīstās, bet izglītības sistēmā un mācīšanas metodēs tik pamanāmas izmaiņas nenotiek. Jauktā mācīšanās apvieno tradicionālo frontālo mācīšanu un datorizēto mācīšanos. Diplomdarba autors izpēta jauktās mācīšanās jēdzienu, analizē dažādus jauktās mācīšanās modeļus un padziļināti koncentrējas uz metodēm, lai iesaistītu skolēnus mācību stundās. Izvēlētā pētījuma metode ir situācijas analīze. Tā izvēlēta, lai izpētītu skolēnu un skolotājas viedokli par jauk...

  14. Baltijas jūras somu cilmes aizguvumu izplatība latviešu valodas izloksnēs (pēc LVDA materiāliem

    Directory of Open Access Journals (Sweden)

    Brigita Bušmane

    2011-11-01

    Full Text Available VERBREITUNG VON ENTLEHNUNGEN OSTSEEFINNISCHER HERKUNFT IN DEN MUNDARTEN DES LETTISCHEN (ANHAND VON MATERIALIEN DES LVDAZusammenfassungIm Band „Lexik“ des Dialektatlas des Lettischen (LVDA sind 100 Karten enthalten, die 119 lexikalische Gruppen umfassen und den Gebrauch sowie die Verbreitung von ca. 6600 Wörtern (samt Varianten in den Mundarten des Lettischen aufdecken, 1,5% davon reflektieren die Relationen zwischen dem Lettischen und den ostseefinnischen Sprachen.In den Mundarten und auch in der lettischen Standardsprache werden die Wörter pīlādzis (< liv. pīlag und virca (< liv. vīrtsa od. estn. virts weitgehend gebraucht.Die meisten Entlehnungen sind in Livland fixiert worden. In den livischen Mundarten Nordwestlivlands sind die Entlehnungen sonnis ‘Schafsbock’ (< liv. sonn, vgl. estn. sōńń, konna ‘grauer od. brauner Frosch’ (< estn. konn verbreitet, in einem größeren Areal – kunna; seltener kommen die Bezeichnungen stoģis und stuģis ‘(Roggen-Haufen’ (< estn. tugi, ķedrītis ‘Spindel (am Spinnrad’ (< liv. keddǝ̂r, estn. kedr, aķis ‘(Roggen-Haufen’ (< estn. hakk, tosa ‘Kohlendampf’ (< estn. toss; vgl. tosa auch ‘Dunst, Dampf; stickige Luft’ vor.In Nordostlivland wurde die Entlehnung ņiras ‘Überreste geschmolzenen Fettes’ (< estn. nired belegt, um Piebalga – die Bezeichnung derselben razīnas samt Varianten (wohl < estn. razu, in Lizums, Ranka und Sinole iet tūkās und in Alūksne iet tukās ‘eine Wöchnerin besuchen’ (anscheinend aus estn. tuhk, in Lejasciems aķis ‘Dohle’ (< estn. hakk, in Veclaicene mustikas ‘Heidelbeere’ (< estn. mustikas, in Alūksne, Veclaicene und auch Vecsaule zu Zemgale – als Hybridbezeichnung mustenes ‘Heidelbeere’ (vgl. estn. must ‘schwarz’ festgehalten.In einem breiten Areal in Livland – um Limbaži, Kārķi, Piebalga, Alūksne – kommt die Entlehnung pese ‘(Birken-Schwamm’ vor (< estn. pess. Um Rūjiena und Rencēni ist die Bezeichnung luca ‘Quappe’ (< liv. resp. estn. luts, um Alūksne die Variante lucka verbreitet.Vorwiegend in den livischen Mundarten Nordwestlivlands sowie in einigen Mundarten um Engure, Pūre wurde die Bezeichnung tirpa ‘kleiner länglicher Heuhaufen’ aufgezeichnet, entstanden unter dem Einfluss der ostseefinnischen Sprachen aus dem ererbten Wort stirpa (vgl. estn. tirp. In Zemgale wurden außer den bereits erwähnten tirpa und mustenes noch folgende Wörter belegt: kukurs bzw. kukuriņš ‘(Flachs-Knospen’ (< liv. kukkǝ̂r, die auch in Nordostkurland und Nordwestlivland verbreitet sind. Bezeichnungen wie iet kacībās ‘eine Wöchnerin besuchen’ (vgl. wotisch kattsoa ‘sehen, aufsehen’, estn. katsuma ‘sehen, besuchen’, tilkas ‘triefender, fließender Speichel (beim Menschen, auch beim Vieh’ (< estn. tilk; vgl. tilka ‘Eiszapfen’ kommen sporadisch auch in Livland und bei Saldus in Kurland vor.In Kurland kommt außer den Entlehnungen kukurs (kukuriņš und tirpa die Bezeichnung kangas ‘Trittwebstuhl’ (< liv. kān̊gas weitgehend vor. Vorläufig nur aus Dundaga ist die Bezeichnung der Eidechse sizliņš (< liv. šizāliki, estn. sizalik und aus Venta die Bezeichnung des Blutegels (Hirudinea pižers (< liv. pizàr erhoben.In Latgale, vorwiegend in seinem zentralen Teil, seltener im Süden, sporadisch in Augšzeme, auch in Ļaudona zu Livland, werden die Entlehnung ķete ‘Linkshänder’ (< estn. käsi Kasusformen oder ihre Varianten gebraucht.Die Materialien des LVDA bezeugen also, dass die meisten Entlehnungen ostseefinnischer Herkunft in den von Liven besiedelten Gebieten in dem an Estland angrenzenden Territorium sowie in Zemgale um Bauska aufgezeichnet worden sind.

  15. Comparison between embryoid and shoot primordia methods of ...

    African Journals Online (AJOL)

    Growth and development from shoot primordia and embryoids obtained from the Asiatic Hybrid Lily and the Oriental Hybrid Lily were studied. Shoot primordium and embryoid formation of the Asiatic Hybrid Lily was more successful than the Oriental Hybrid Lily. The highest shoot primordium formation medium of the Asiatic ...

  16. Toxicologic Assessment of a Commercial Decolorized Whole Leaf Aloe Vera Juice, Lily of the Desert Filtered Whole Leaf Juice with Aloesorb

    Science.gov (United States)

    Winters, Wallace D.; Scott, Michael; David, Andrew; Gillis, Glenn; Stoufflet, Thaya; Nair, Anand; Kousoulas, Konstantine

    2013-01-01

    Aloe vera, a common ingredient in cosmetics, is increasingly being consumed as a beverage supplement. Although consumer interest in aloe likely stems from its association with several health benefits, a concern has also been raised by a National Toxicology Program Report that a nondecolorized whole leaf aloe vera extract taken internally by rats was associated with intestinal mucosal hyperplasia and ultimately malignancy. We tested a decolorized whole leaf (DCWL) aloe vera, treated with activated charcoal to remove the latex portion of the plant, for genotoxicity in bacteria, acute/subacute toxicity in B6C3F1 mice, and subchronic toxicity in F344 rats. We found this DCWL aloe vera juice to be nongenotoxic in histidine reversion and DNA repair assays. Following acute administration, mice exhibited no adverse signs at 3- or 14-day evaluation periods. When fed to male and female F344 rats over 13 weeks, DCWL aloe led to no toxicity as assessed by behavior, stools, weight gain, feed consumption, organ weights, and hematologic or clinical chemistry profiles. These rats had intestinal mucosal morphologies—examined grossly and microscopically—that were similar to controls. Our studies show that oral administration of this DCWL aloe juice has a different toxicology profile than that of the untreated aloe juice at exposures up to 13 weeks. PMID:23554812

  17. A new species of Western Atlantic sea lily in the family Bathycrinidae (Echinodermata: Crinoidea), with a discussion of relationships between crinoids with xenomorphic stalks.

    Science.gov (United States)

    Mironov, Alexandr N; Pawson, David L

    2014-10-16

    A new species in the family Bathycrinidae is described from abyssal depths from the Bahamas. It is referred to the recently established genus Discolocrinus, which formerly comprised a single species D. thieli Mironov, 2008 from the Eastern Pacific. Discolocrinus iselini n. sp. is characterized by large body size, high tegmen with tube-like upper region, extremely elongated IBr1 and IBr2, large knobby processes on primibrachials, and overgrowth of soft tissue on the pinnules, the tissue containing numerous perforated or imperforate ossicles of varying size and form. Differences between Discolocrinus and other bathycrinids may seem to be of taxonomic importance at the family level, but knowledge of the morphology and variability of both species of Discolocrinus is incomplete and, until a richer material becomes available, the genus should remain in family Bathycrinidae. Representatives of five families with xenomorphic stalks were examined to characterize the genera on the basis of number or form of knobby processes. These processes occur in two families with differing external morphology: ten-armed Bathycrinidae and five-armed Bourgueticrinidae. They also occur in the comatulid family Atelecrinidae. This similarity might seem to indicate a close relationship between the three families. However, morphological analysis supports the separation of the families Caledonicrinidae and Septocrinidae from Bathycrinidae despite the fact that they share a xenomorphic stalk and IBr2ax. These conclusions are in agreement with results of recent molecular studies.

  18. Toxicologic Assessment of a Commercial Decolorized Whole Leaf Aloe Vera Juice, Lily of the Desert Filtered Whole Leaf Juice with Aloesorb

    Directory of Open Access Journals (Sweden)

    Inder Sehgal

    2013-01-01

    Full Text Available Aloe vera, a common ingredient in cosmetics, is increasingly being consumed as a beverage supplement. Although consumer interest in aloe likely stems from its association with several health benefits, a concern has also been raised by a National Toxicology Program Report that a nondecolorized whole leaf aloe vera extract taken internally by rats was associated with intestinal mucosal hyperplasia and ultimately malignancy. We tested a decolorized whole leaf (DCWL aloe vera, treated with activated charcoal to remove the latex portion of the plant, for genotoxicity in bacteria, acute/subacute toxicity in B6C3F1 mice, and subchronic toxicity in F344 rats. We found this DCWL aloe vera juice to be nongenotoxic in histidine reversion and DNA repair assays. Following acute administration, mice exhibited no adverse signs at 3- or 14-day evaluation periods. When fed to male and female F344 rats over 13 weeks, DCWL aloe led to no toxicity as assessed by behavior, stools, weight gain, feed consumption, organ weights, and hematologic or clinical chemistry profiles. These rats had intestinal mucosal morphologies—examined grossly and microscopically—that were similar to controls. Our studies show that oral administration of this DCWL aloe juice has a different toxicology profile than that of the untreated aloe juice at exposures up to 13 weeks.

  19. Toxicologic assessment of a commercial decolorized whole leaf aloe vera juice, lily of the desert filtered whole leaf juice with aloesorb.

    Science.gov (United States)

    Sehgal, Inder; Winters, Wallace D; Scott, Michael; David, Andrew; Gillis, Glenn; Stoufflet, Thaya; Nair, Anand; Kousoulas, Konstantine

    2013-01-01

    Aloe vera, a common ingredient in cosmetics, is increasingly being consumed as a beverage supplement. Although consumer interest in aloe likely stems from its association with several health benefits, a concern has also been raised by a National Toxicology Program Report that a nondecolorized whole leaf aloe vera extract taken internally by rats was associated with intestinal mucosal hyperplasia and ultimately malignancy. We tested a decolorized whole leaf (DCWL) aloe vera, treated with activated charcoal to remove the latex portion of the plant, for genotoxicity in bacteria, acute/subacute toxicity in B6C3F1 mice, and subchronic toxicity in F344 rats. We found this DCWL aloe vera juice to be nongenotoxic in histidine reversion and DNA repair assays. Following acute administration, mice exhibited no adverse signs at 3- or 14-day evaluation periods. When fed to male and female F344 rats over 13 weeks, DCWL aloe led to no toxicity as assessed by behavior, stools, weight gain, feed consumption, organ weights, and hematologic or clinical chemistry profiles. These rats had intestinal mucosal morphologies-examined grossly and microscopically-that were similar to controls. Our studies show that oral administration of this DCWL aloe juice has a different toxicology profile than that of the untreated aloe juice at exposures up to 13 weeks.

  20. Toxicologic Assessment of a Commercial Decolorized Whole Leaf Aloe Vera Juice, Lily of the Desert Filtered Whole Leaf Juice with Aloesorb

    OpenAIRE

    Inder Sehgal; Winters, Wallace D.; Michael Scott; Andrew David; Glenn Gillis; Thaya Stoufflet; Anand Nair; Konstantine Kousoulas

    2013-01-01

    Aloe vera, a common ingredient in cosmetics, is increasingly being consumed as a beverage supplement. Although consumer interest in aloe likely stems from its association with several health benefits, a concern has also been raised by a National Toxicology Program Report that a nondecolorized whole leaf aloe vera extract taken internally by rats was associated with intestinal mucosal hyperplasia and ultimately malignancy. We tested a decolorized whole leaf (DCWL) aloe vera, treated with activ...

  1. Contribution of explant carbohydrate reserves and sucrose in the medium to bulb growth of lily regenerated on scale segments in vitro

    NARCIS (Netherlands)

    Langens-Gerrits, M.M.; Kuijpers, A.M.; Klerk, de G.J.M.; Croes, A.

    2003-01-01

    Bulb size is an important factor determining phase change in Lilium: phase change only occurs in bulblets over a certain threshold weight. After phase change has occurred, bulblets sprout with a stem with many leaves. Juvenile bulblets sprout with only a few leaves. The factors contributing to bulb

  2. Jan Hus: prekliatemu kazateľovi nasadili papierovú čiapku a sadisticky ho upálili

    Czech Academy of Sciences Publication Activity Database

    Pišna, Jan

    2015-01-01

    Roč. 2, - (2015) ISSN 1339-844X Institutional support: RVO:68378068 Keywords : Hus, Jan * reformation * the Council of Constance * anniversary Subject RIV: AJ - Letters, Mass-media, Audiovision https://dennikn.sk/179333/jan-hus-prekliatemu-kazatelovi-nasadili-papierovu-ciapku-a-sadisticky-ho-upalili/

  3. Environ: E00615 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00615 Scilla scilloides bulb Crude drug Scilla scilloides [TAX:49652] Liliaceae (l...ily family) Scilla scilloides bulb (dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00615 Scilla scilloides bulb ...

  4. Environ: E00596 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00596 Tulipa edulis bulb Crude drug Tulipa edulis, Tulipa [TAX:13305] Liliaceae (l...ily family) Tulipa edulis bulb (dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00596 Tulipa edulis bulb ...

  5. Environ: E00616 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00616 Allium macrostemon bulb Crude drug Allium macrostemon [TAX:91198] Liliaceae ...(lily family) Allium macrostemon bulb (dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00616 Allium macrostemon bulb ...

  6. Environ: E00352 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available odoratum [TAX:82207], Polygonatum macropodium, Polygonatum prattii, Polygonatum [TAX:16195] Liliaceae (lily...ried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00352 Polygonatum rhizome ...

  7. Environ: E00284 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available fficinale [TAX:142615], Dendrobium nobile [TAX:94219] Ruscaceae (lily-of-the-valley family) Dendrobium stem ...Crude drugs [BR:br08305] Monocot plants Ruscaceae (lily-of-the-valley family) E00284 Dendrobium ...

  8. Drug: D06911 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06911 Crude ... Drug Lilium bulb (JP17); Lily bulb; Byakugo Starch [CPD:C00369], ... E00187 Therapeutic category: 5100 ... Liliaceae (lily family) Lilium lancifolium bulb (steamed) ... PubChem: 51091253 ...

  9. Environ: E00347 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00347 Allium leaf sheath Crude drug Allyl sulfide Allium fistulosum [TAX:35875] Liliaceae (lily family) All...ium leaf sheath Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00347 Allium leaf sheath ...

  10. Dicty_cDB: CHE136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kifnylvlviglqlnldyvkkviqlehmvqvfyhqqvkwntf* likqknyhlihlthailniqlqhsnhftmlqkvskkqknk*dnllialknhfqfvtihtl nql...-- ---fvqykvyslleis*mv*lsvysmqlnildihpyhyihqnqivvmny*vmfhy*lili slilvkrlv*lqlvllm

  11. Dicty_cDB: SFJ815 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KI ASTYKHGDEIPRIDYTEEEIKT--- ---fvqykvyslleis*mv*lsvysmqlnildihpyhyihqnqivvmny*vmfhy*lili slilvkrlv*lqlvllmk...ifnylvlviglqlnldyvkkviqlehmvqvfyhqqvkwntf* likqknyhlihlthailniqlqhsnhftmlqkvskkqknk*dnllialknhfqfvtihtl nqxk

  12. Teātra paņēmieni bērnu patstāvīgās mācīšanās stratēģiju attīstībai angļu valodas stundās 5.klasē

    OpenAIRE

    Bartuša, Natālija

    2011-01-01

    Mūžizglītības ideja, kurā viens no pamatfaktoriem ir patstavīgā mācīšanās, kļūst aizvien izplatītāka. Diplomdarba autore pat uzsvērtu to, ka tā nav vairs tikai “moderna ideja”, “tukša skaņa” vai kas tamlīdzīgs, bet gan moderna tendence mūsdienu multikulturālajā pasaulē. Viens no svarīgākajiem jebkuras būtnes instinktiem ir tas, kas saistās ar izdzīvošanu, cīņu par iespēju dzīvot, turklāt, lai “izdzīvotu” ir jābut elastīgam, jāspēj pielāgoties pasaulei, kas nepārtraukti mainās. Mūsdienās šķi...

  13. Atsevišķu latviešu un lietuviešu valodas adjektīvu semantiskā diferenciācija: latv. šķīsts, liet. skýstas; latv. skaists, liet. skaistùs; latv. tikls, liet. tiklùs

    Directory of Open Access Journals (Sweden)

    Anta Trumpa

    2011-11-01

    Full Text Available Die semantische differenziation von manchen adjektiven der lettischen und litauischen sprache: lett. šķīsts, lit. skýstas; lett, skaists, lit. skaistùs; lett, tikls, lit. tiklùsZusammenfassungDiesen Wortpaaren von semantisch unterschiedlichen Adjektiven der lettischen und litauischen Spra­che (lett. šķīsts ‘tugendhaft, unschuldig, keusch’ : lit. skýstas ‘flüssig; nicht ernst gemeint, unreif’; lett. skaists ‘schön’ : lit. skaistùs ‘grell, klar, rosig; ehrlich, keusch’; lett. tikls ‘tugendhaft, keusch’ : lit. tiklùs ‘treu, leichtgläubig; ehrlich, anständig’ kann man zu Bezeichnungen der Eigenschaften der Sit­tlichkeit zählen, weil mindestens ein Wort im Paar (lett. šķīsts, lett. tikls, lit. tiklùs und lit. skaistùs eine mit Sittlichkeit verbündete Eigenschaft charakterisiert.Die Aufgabe dieses Artikels ist mit der Analyse von diesen Wortpaaren zu konstatieren, welche Sprache die ältere Bedeutung beibehaltet hat, ungefähre Ursachen der Bedeutungsveränderung festzu­stellen und zu bestimmen, ob sie für ganze Gruppe charakteristisch sind.Lit. skýstas hat die ältere Bedeutung ‘flüssig’ beibehaltet. Im Lettischen war anfänglich zwei Be­deutungen: ‘flüssig’ (in Mundarten und ‘rein, sauber’. Die erste Bedeutung ist noch in unseren Zeiten nur als die Erscheinung der Mundarten erhalten worden, aber in der Schriftsprache ist vielleicht wegen des Einflusses der religiösen Texten die Bedeutungsverengung ‘sauber, rein’ → ‘rein von Sünden, tu­gendhaft, keusch’ geschehen.Mehrdeutiges lit. skaistùs hat vermutlich auch die ältere Bedeutung ‘klar, hell’ beibehaltet, aber die Bedeutung ‘tugendhaft, keusch’ hat sich voraussichtlich als übertragene Bedeutung von der Bedeutung ‘rein, hell’ entwickelt und heute ist sie nicht besonders oft verwendet. Im Lettischen ist die Bedeutungs­veränderung ‘hell’ → ‘schön’ geschehen und ist vermutlich die ältere Bedeutung ‘hell’ im Kollokation skaists laiks ‘schönes Wetter’ beibehalten worden.Im lett. tikls ist die Bedeutungsverengung geschehen: ‘ehrlich, tugendhaft im weiteren Sinne’→ ‘sexuell scheu, keusch’. In den litauischen Mundarten ist neben den Adjektiv tiklùs ‘ehrlich’ auch homo­nymisches tiklùs ‘leichtgläubig’ beibehalten worden.Nach der Analyse dieser Wortpaaren kann man manche Zusammenhänge bemerken. Erstens, in allen drei Fällen ist die ältere Bedeutung das litauisches Wort beibehalten. Zweitens, die Bedeutungsentwick­lungen von lett. šķīsts ‘sauber, rein’ → ‘rein von Sünden, tugendhaft, keusch’ und von lit. skaistùs ‘tugendhaft, keusch’ → ‘rein, hell’ sind vielleicht wegen des Einflusses des Christentums geschehen. Drittens, heute sind diese Bezeichnungen der Eigenschaften der Sittlichkeit ziemlich selten verwendet, meistens, in den religiosen Texten.

  14. City of Freeport, Florida, State Road 20 Water Main Installation, Final Environmental Assessment, Eglin Air Force Base, Florida

    Science.gov (United States)

    2010-07-01

    of technology, culture, mass depopulation, and upheaval as a result of introducing foreign pathogens such as smallpox, measles, and influenza (Saunt...Pine Lily LT - Lilium iridollae Panhandle Lily LE - Lilium michauxii Carolina Lily LE - Lindera subcoriacea Bog Spice Bush LE - Linum westii

  15. GREAT I Study of the Upper Mississippi River. Technical Appendixes. Volume 5. Fish and Wildlife.

    Science.gov (United States)

    1980-09-01

    pentapentala Lotus Nuphar variegatum Yellow Water Lily Nymphaea odorata Sweet 𔃾ater Lily Nymphaea tuberosa White Water Lily Family Pontederiaceae Pontederia ... cordata Pickerelweed 2u Family Scirpus Scirpus fluviatilis River Bulrush Scirpus validus Soft-stemmed Bulrush Family Sparganiaceae Sparganium...continued Class Symbol Type Description Aquatic and Pt Pontederia (pickerelweed) Marsh Vegetation Pg Phragmites (reed grass) Py Polygonum (smartweed

  16. Environ: E00314 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00314 Blackberry lily root Crude drug Iridin [CPD:C10465], Irigenin [CPD:C17957], ...944] Iridaceae (iris family) Blackberry lily root Crude drugs [BR:br08305] Monocot plants Iridaceae (iris family) E00314 Blackberry lily root ...

  17. Usaldusväärne teejuht läti kohanimemaastikul / Lembit Vaba

    Index Scriptorium Estoniae

    Vaba, Lembit, 1945-

    2016-01-01

    Arvustus: Balode, Laimute, Bušš, Ojārs. No Abavas līdz Zilupei : vietvārdu cilmes īsā vārdnīca = From Abava to Zilupe : the origin of Latvian geographical names : a short dictionary. Rīga : Latviešu valodas aģentūra, 2015

  18. Who Loves Prescriptivism and Why? Some Aspects of Language Correctness in Latvia

    Science.gov (United States)

    Strelevica-Ošina, Dace

    2016-01-01

    Taking into account the crosscultural differences in prescriptive attitudes in various linguistic communities, a theory of three types of prescriptivism--human-oriented, language-oriented, and error-oriented prescriptivism--has been offered [Strelevica-Ošina, Dace. [2011] 2012. "Kapec mes gribam, lai valoda ir pareiza? Ieskats preskriptivisma…

  19. Trasplante simultáneo de riñón y páncreas en pacientes con diabetes mellitus de tipo 1, Clínica Fundación Valle del Lili, Cali, 2001-2013

    OpenAIRE

    Echeverri Junca, Gabriel Jaime; Serrano, Óscar Javier

    2014-01-01

    Clinical outcomes in patients with Type 1 diabetes mellitus (DM 1) after simultaneous kidney-pancreas transplantation (SRP) and end stage renal disease have shown to be a therapeutic option with successful clinical results, making it the best metabolic control option for this population group. Objective. Clinical results show the short and medium term DM1 patients undergoing simultaneous kidney transplantation - Pancreas (SRP) in our institution. Material and method. Institutional registry of...

  20. Synthesis, characterisation and electrochemical intercalation kinetics of nanostructured aluminium-doped Li[Li0.2Mn0.54Ni0.13Co0.13]O2 cathode material for lithium ion battery

    CSIR Research Space (South Africa)

    Jafta, CJ

    2012-08-01

    Full Text Available of applied voltage. The enhanced conductivity of the LMNCA has been related to the higher amount of the Mn3+ cation in the lattice, aided by the increased c-lattice that enhances the diffusivity of Li during the electrochemical cycling. LMNCA showed enhanced...

  1. Experiencia y resultados en cirugía de disección aórtica tipo A durante una década en la Fundación Valle del Lili, Cali, Colombia

    Directory of Open Access Journals (Sweden)

    Eduardo J Echeverry

    2013-09-01

    Full Text Available Antecedentes: la disección aórtica tipo A continúa siendo una enfermedad con alto riesgo de muerte, que por ende requiere un diagnóstico rápido y manejo quirúrgico inmediato. Objetivo: reportar la experiencia y los resultados en cirugía de disección aórtica tipo A durante una década. Métodos: se realizó un estudio descriptivo, retrospectivo, mediante la revisión de historias clínicas de los pacientes atendidos entre enero de 2001 y diciembre de 2010. Se seleccionaron 58 pacientes con diagnóstico de disección aórtica tipo A, que cumplían con los criterios de inclusión y se analizaron variables demográficas, clínicas, intra y post-operatorias. Resultados: 79,3% de los pacientes fueron hombres; con una mediana de edad de 56 años. Los tiempos promedio para pinza aórtica, bomba y arresto fueron 136, 223 y 39 minutos, respectivamente. Los procedimientos más frecuentes fueron reemplazo de aorta ascendente y cirugía de Bentall en 34,5% de los casos cada uno. La mediana de estancia en la unidad de cuidado intensivo fue de seis y doce días para el total de hospitalización. Se reportaron complicaciones en 36,2% de los casos; la principal fue sepsis de cualquier causa en 20% de los pacientes. La mortalidad intrahospitalaria fue de 24% y la supervivencia a 28 días fue superior a 70%. Conclusiones: según nuestra casuística, la mortalidad observada no difiere mucho a la que se reporta en registros multicéntricos internacionales, en los cuales sigue siendo elevada, lo cual resalta la importancia del diagnóstico temprano y el manejo quirúrgico inmediato, que implica un esfuerzo humano e institucional considerable. Palabras clave: síndrome aórtico agudo, disección de aorta, cirugía cardíaca, mortalidad. Background: type A aortic dissection is still a disease with a high risk of death. Therefore it requires prompt diagnosis and immediate surgical management. Objective: to report our experience and results in surgery of type A aortic dissection during a decade. Methods: a descriptive, retrospective study, by reviewing medical records of patients treated between January 2001 and December 2010 was realized. 58 patients diagnosed as type A aortic dissection who met the inclusion criteria were selected, and demographic, clinical, intra and post-operative variables were analyzed. Results: 79.3% of the patients were men, with a median age of 56 years. The mean times for aortic clamp, pump and arrest were 136, 223 and 39 minutes, respectively. The most frequent procedures were ascending aortic replacement and Bentall surgery in 34.5% of cases each one. The median stay in the ICU was six days and overall hospitalization was twelve days. Complications were reported in 36.2% of cases. The main one was sepsis from any cause in 20% of patients. In-hospital mortality was 24% and survival at 28 days was higher than 70%. Conclusions: according to our casuistics, the observed mortality is not very different to that reported in international multicenter registries which remains still high. This fact highlights the importance of early diagnosis and immediate surgical management, implying a significant human and institutional effort.

  2. Seroprevalencia del virus linfotrópico humano de tipos I y II en donantes del Banco de Sangre de la Fundación Valle del Lili, Cali, Colombia, 2008-2014

    Directory of Open Access Journals (Sweden)

    Carmenza Macía

    2016-08-01

    Conclusión. Se encontró una alta prevalencia de pruebas reactivas para el HTLV I-II en comparación con otros estudios. Los resultados de este estudio son un punto de partida para el desarrollo de estudios poblacionales.

  3. STUDI FENOLOGI PERBUNGAAN Lilium longiflorum Thunb.

    Directory of Open Access Journals (Sweden)

    Ni Wayan Deswiniyanti

    2013-04-01

    Full Text Available Lily (Lilium longiflorum Thunb. was known as ornamental plants, especially as cut flower. Lily varieties in Indonesia are still lacking and the price is quite expensive but demand of lily is increased steadily. The first step for successful plant breeding is understanding phenophysiology of the plants, in particular flowering phenology. The aim of this research is to provide information on flowering lily phenology, to be a basic knowledge in improving for planning plant breeding programs. In this research, plants were observed from bud initiation until fruit production (phase F0-F4. Additional morphologies observed such as: high plant, leaf shape and color, shape and type of root or bulb. Result shows that period of phase F0-F3 of sampled lily is 52 days. The plant height of lily is about 50-150 cm, has elongated single lancet leaf shape, green leaf, bulbs, and has fiberous root.

  4. Whole transcriptome profiling of the vernalization process in Lilium longiflorum (cultivar White Heaven) bulbs

    OpenAIRE

    Villacorta-Martin, Carlos; N??ez de C?ceres Gonz?lez, Francisco F.; de Haan, Jorn; Huijben, Kitty; Passarinho, Paul; Lugassi-Ben Hamo, Maya; Zaccai, Michele

    2015-01-01

    Background Vernalization is an obligatory requirement of extended exposure to low temperatures to induce flowering in certain plants. It is the most important factor affecting flowering time and quality in Easter lily (Lilium longiflorum). Exposing the bulbs to 4??C gradually decreases flowering time up to 50?% compared to non-vernalized plants. We aim to understand the molecular regulation of vernalization in Easter lily, for which we characterized the global expression in lily bulb meristem...

  5. Drug: D06911 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available herapeutic category: 5100 Liliaceae (lily family) Lilium lancifolium bulb (steamed) Therapeutic category of drugs... in Japan [BR:br08301] 5 Crude drugs and Chinese medicine formulations 51 Crude drugs 510 Crude drugs... 5100 Crude drugs D06911 Lilium bulb (JP16) Traditional Chinese Medicine in Japan [... bulbus; Lily bulb; Byakugo Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) D06911 Lilium bulb PubChem: 51091253 ...

  6. Environ: E00144 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e), Apoverticine, Peimiphine, Peimidine, Peimitidine, Peiminoside, Fritimine Fritillaria verticillata [TAX:59070] Same as: D06774 Lil...iaceae (lily family) Fritillaria bulb Major component: P

  7. Omamoodi ime - ilmunud on eesti-läti sõnaraamat / Lembit Vaba

    Index Scriptorium Estoniae

    Vaba, Lembit 1945-

    2015-01-01

    Arvustus: Igauņu-latviešu vārdnīca / Latviešu valodas aģentūra ; sastādītāji: Valts Ernštreits, Marika Muzikante, Maima Grīnberga = Eesti-läti sõnaraamat / Läti keele agentuur ; koostajad: Valts Ernštreits, Marika Muzikante, Maima Grīnberga. Rīga ; Tallinn : Eesti Keele Sihtasutus, 2015

  8. Kaua oodatud sõnaraamat / Tuuli Tuisk

    Index Scriptorium Estoniae

    Tuisk, Tuuli

    2013-01-01

    Arvustus: Līvõkīel-estikīel-leţkīel sõnārōntõz = Liivi-eesti-läti sõnaraamat = Lībiešu-igauņu-latviešu vārdnīca / [koostamine:] Tiit-Rein Viitso, [toimetamine:] Valts Ernštreits. Riga : Latviešu valodas aģentūra ; Tartu : Tartu Ülikool, 2012

  9. First report of Nerine yellow stripe virus in Amaryllis in the United States

    Science.gov (United States)

    Ornamental flower bulbs (including true bulbs, bulbils, corms, tubers and rhizomes) are increasingly important floriculture crops. Amaryllis is a small genus of flowering bulbs, with two species. The South African native, Amaryllis belladonna, also known as belladonna lily, Jersey lily, naked lady,...

  10. Biotechnological advances in Lilium

    NARCIS (Netherlands)

    Bakhshaie, Mehdi; Khosravi, Solmaz; Azadi, Pejman; Bagheri, Hedayat; Tuyl, van Jaap M.

    2016-01-01

    Modern powerful techniques in plant biotechnology have been developed in lilies (Lilium spp., Liliaceae) to propagate, improve and make new phenotypes. Reliable in vitro culture methods are available to multiply lilies rapidly and shorten breeding programs. Lilium is also an ideal model plant to

  11. African Crop Science Journal - Vol 8, No 2 (2000)

    African Journals Online (AJOL)

    Comparison between embryoid and shoot primordia methods of plantlet production for Asiatic hybrid lily and Oriental hybrid lily. H. Sugiura, S. G. Agong, A. Enami, H. Kaneko, T. Honma. http://dx.doi.org/10.4314/acsj.v8i2.27701 · Interspecific hybridisation of Lathyrus sativus (Guaya) with wild Lathyrus species and embryo ...

  12. Environ: E00444 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00444 Allium tuberosum seed Allii tuberosi semen Crude drug Allium tuberosum [TAX:...4683] Liliaceae (lily family) Allium tuberosum mature seed (dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00444 Allium tuberosum seed ...

  13. Interspecific hybridization of flower bulbs: a review

    NARCIS (Netherlands)

    Tuyl, van J.M.

    1997-01-01

    In order to introduce new characters such as resistances, flower shape and colour, from wild species into the cultivar assortment of lily it is necessary to overcome interspecific crossing barriers.. Several techniques have been used for wide interspecific lily crosses with species and cultivars

  14. Environ: E00187 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00187 Lilium bulb (JP16) Lily bulb Byakugo Crude drug Starch [CPD:C00369], Protein... [CPD:C00017], Fat, Alkaloid Lilium lancifolium [TAX:79002], Lilium brownii [TAX:82312] Same as: D06911 Liliaceae (lily family) Lilium lancifolium bulb (steamed) ...

  15. Environ: E00427 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00427 Allium chinense bulb Allii chinensis bulbus Crude drug Allium chinense [TAX:...130426] Liliaceae (lily family) Allium chinense bulb (boiled, dried) Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00427 Allium chinense bulb ...

  16. Environ: E00396 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00396 Veratrum root Crude drug Veratrine Veratrum nigrum [TAX:203100], Veratrum maackii [TAX:82471] Lilia...ceae (lily family) Veratrum root and rhizome Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00396 Veratrum root ...

  17. Environ: E00399 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available de [CPD:C17963], Demecolcine [CPD:C11250] Colchicum autumnale [TAX:45005] Liliaceae (lily family) Colchicum ...autumnale seed and bulb Major component: Colchicine [CPD:C07592] Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) E00399 Colchicum seed; Colchicum bulb ...

  18. Influence of plant species on population dynamics, genotypic diversity and antibiotic production by indigenous Pseudomonas spp

    NARCIS (Netherlands)

    Bergsma-Vlami, M.; Prins, M.E.; Raaijmakers, J.M.

    2005-01-01

    The population dynamics, genotypic diversity and activity of naturally-occurring 2,4-diacetylphloroglucinol (DAPG)-producing Pseudomonas spp. was investigated for four plant species (wheat, sugar beet, potato, lily) grown in two different soils. All four plant species tested, except lily and in some

  19. Drug: D06810 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ianum, Polygonatum cyrtonema [TAX:195526], Polygonatum [TAX:16195] Same as: E00176 Ruscaceae (lily-of-the-valle...nishing Ying D06810 Polygonatum rhizome Crude drugs [BR:br08305] Monocot plants Ruscaceae (lily-of-the-valley family) D06810 Polygonatum rhizome PubChem: 47208461 ...

  20. Monet's Reflections

    Science.gov (United States)

    Petrovich-Cheney, Laura

    2007-01-01

    From 1899 until his death in 1926, Claude Monet painted a series of watercolor landscapes of his water lily garden and Japanese bridge in Giverny, France. Monet eventually abandoned the banks entirely as subject matter and concentrated solely on the water. These paintings, particularly "The Water Lilies," show a surface in which the shimmering…

  1. Microwave irradiation controls the manganese oxidation states of nanostructured (Li[Li0.2Mn0.52Ni0.13Co0.13Al0.02]O2) layered cathode materials for high-performance lithium ion batteries

    CSIR Research Space (South Africa)

    Jafta, CJ

    2015-02-01

    Full Text Available as LMNC-mic and LMNCA-mic). The nanoparticulate nature of these layered cathode materials were confirmed by SEM. The crystallinity and layeredness were determined from the XRD analysis. The XPS measurements proved a definite change in the oxidation states...

  2. Evidence for a shape-based recognition of odorants in vivo in the human nose from an analysis of the molecular mechanism of lily-of-the-valley odorants detection in the Lilial and Bourgeonal family using the C/Si/Ge/Sn switch strategy.

    Science.gov (United States)

    Wolf, Steffen; Gelis, Lian; Dörrich, Steffen; Hatt, Hanns; Kraft, Philip

    2017-01-01

    We performed an analysis of possible mechanisms of ligand recognition in the human nose. The analysis is based on in vivo odor threshold determination and in vitro Ca2+ imaging assays with a C/Si/Ge/Sn switch strategy applied to the compounds Lilial and Bourgeonal, to differentiate between different molecular mechanisms of odorant detection. Our results suggest that odorant detection under threshold conditions is mainly based on the molecular shape, i.e. the van der Waals surface, and electrostatics of the odorants. Furthermore, we show that a single olfactory receptor type is responsible for odor detection of Bourgeonal at the threshold level in humans in vivo. Carrying out a QM analysis of vibrational energies contained in the odorants, there is no evidence for a vibration-based recognition.

  3. Successful expression in pollen of various plant species of in vitro synthesized mRNA introduced by particle bombardment.

    Science.gov (United States)

    Tanaka, T; Nishihara, M; Seki, M; Sakamoto, A; Tanaka, K; Irifune, K; Morikawa, H

    1995-05-01

    Gold particles coated with beta-glucuronidase (GUS) mRNA with a 5' cap structure that had been synthesized in vitro were introduced, by use of a pneumatic particle gun, into pollen grains of lily (Lilium longiflorum), freesia (Freesia refracta) and tulip (Tulipa gesneriana). A fluorometric assay for the GUS activity indicated that in vitro synthesized GUS mRNA introduced into these pollen cells by particle bombardment was successfully expressed. GUS activity in extracts of the bombarded lily pollen became detectable fluorometrically within 30 min after bombardment, peaked at 6 h, then gradually decreased. This activity changed as a function of the developmental stage of the pollen cell of lily.

  4. Līdzskaņu ģ un ķ izrunas īpatnības bērnu un pieaugušo valodā

    Directory of Open Access Journals (Sweden)

    Dace Markus

    2013-10-01

    Full Text Available Raksta mērķis ir meklēt valodas skaņu jaukšanas vai aizstāšanas iemeslus, analizējot 2,5 un 5 gadus vecu māsu runas ierakstus, salīdzināt tos ar literārās valodas un dialekta runātāju, kā arī agrāk veiktiem bērnu  runas analīzes rezultātiem, ar logopēdu un fonētiķu atziņām. Analizēto bērnu runas materiālu veido vārdi puķe, kaķis, ķemme, kuģis, ģitāra, ģimene, kuros gan vārda sākumā, gan vidusdaļā analizēti palatālie slēdzeņi ģ un ķ. Salīdzinājumam tika ierakstīti arī vārdi ar līdzskaņiem č un dž: lāči, džemperis, čalis, džakuzi. Latviešu valodā akustiskās pazīmes bērnu runā tiek pētītas pirmo reizi.Pieaugušo runā ieraksta materiālu veido CVC struktūras zilbes, kurās C ir latviešu valodas līdzskanis ģ un ķ, bet V – viens no latviešu valodas patskaņiem a, ā, e, ē, e, ē, i, ī, o, ō, u, ū, piemēram, ģaģ, ģeģ, ģiģ, ģoģ, ģuģ utt. Rakstā analizēti CVC struktūras zilbju sākuma līdzskaņi. Zilbes ierunāja 5 infor­manti, kuriem latviešu valoda ir dzimtā valoda un kuru izruna atbilst lat­viešu literārās valodas normām.Visu informantu ieraksts veikts ar datorprogrammu Multi Speech, analīzē izmantota programma Praat.Rakstā secināts, ka valodas skaņu jaukšanas pamatā var būt skaņu fonētiskā līdzība, piemēram, gan palatālo slēdzeņu ķ un ģ, gan alveolāro afrikātu č un dž spektri ir kompakti un akūti un apliecina palatālo slēdzeņu un afrikātu līdzību, kas sekmē skaņu jaukšanu. Tā kā pāreja no divskaņa ie un divskaņa o [uo] pirmā komponenta uz otro vērojama divskaņa pēdējā trešdaļā, nevis vidū, tas var radīt iespaidu par garu pirmo komponentu, tātad – attiecīgi par garo patskani ī (divskanī ie un par garo patskani ū (divskanī o, kā tos atveido bērni (ie > ī un o [uo] > ū.Būtu vēlams turpināt bērnu runas analīzi, lai pārliecinātos, cik bieži un kādā vecumā vērojama vecāko m

  5. [Tiit-Rein Viitso. Līvõkīel-estikīel-leţkīel sõnārōntõz] / Eberhard Winkler

    Index Scriptorium Estoniae

    Winkler, Eberhard, 1955-

    2013-01-01

    Arvustus: Līvõkīel-estikīel-leţkīel sõnārōntõz = Liivi-eesti-läti sõnaraamat = Lībiešu-igauņu-latviešu vārdnīca / [koostamine:] Tiit-Rein Viitso, [toimetamine ja läti vasted:] Valts Ernštreits. Riga : Latviešu valodas aģentūra ; Tartu : Tartu Ülikool, 2012

  6. Current status of sea turtle protection in Lamu Seascape, Kenya ...

    African Journals Online (AJOL)

    Current status of sea turtle protection in Lamu Seascape, Kenya: Trends in nesting, nest predation and stranding levels. Mike Olendo, Cosmas Nzaka Munga, Gladys Moragwa Okemwa, Harrison Ong'anda, Lilian Mulupi, Lily Mwasi, Hassan Mohamed ...

  7. Plaadid / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2002-01-01

    Uutest plaatidest Liquido "Alarm!Alarm!", Van Morrison "Down The Road", "Eesti pop 2002", "Very Best of MTV Unplugged", Karavan "Agu Tammeoru laulud", Natalie Imbruglia "White Lilies Island", Ibizarre "Ambient Collection vol. 5", Jose Cura "Boleros"

  8. Thin Cell Layer technology in ornamental plant micropropagation ...

    African Journals Online (AJOL)

    ... successful using conventional methods. This review examines the fundamentals behind TCLs, and their application in ornamental plant micropropagation and transformation. Key words: Chrysanthemum, lily, somatic embryogenesis, thin cell layer, tobacco, transformation. African Journal of Biotechnology Vol. 2 (12), pp.

  9. Film, mis muutis (veini)maailma / Andre Peremees

    Index Scriptorium Estoniae

    Peremees, Andre

    2005-01-01

    Mängufilmis "Külili" joodud veinid ja veinikasvatuse piirkond on saanud Ameerikas ülipopulaarseks. Veinispetsialist maitses kõiki kultusfilmis mainitud veine Itaalia veinimessil "Vinitaly". Lisaks "Kuidas mulle filmiveinid maitsesid"

  10. Biotechnological advances in Lilium.

    Science.gov (United States)

    Bakhshaie, Mehdi; Khosravi, Solmaz; Azadi, Pejman; Bagheri, Hedayat; van Tuyl, Jaap M

    2016-09-01

    Modern powerful techniques in plant biotechnology have been developed in lilies (Lilium spp., Liliaceae) to propagate, improve and make new phenotypes. Reliable in vitro culture methods are available to multiply lilies rapidly and shorten breeding programs. Lilium is also an ideal model plant to study in vitro pollination and embryo rescue methods. Although lilies are recalcitrant to genetic manipulation, superior genotypes are developed with improved flower colour and form, disease resistance and year round forcing ability. Different DNA molecular markers have been developed for rapid indirect selection, genetic diversity evaluation, mutation detection and construction of Lilium linkage map. Some disease resistance-QTLs are already mapped on the Lilium linkage map. This review presents latest information on in vitro propagation, genetic engineering and molecular advances made in lily.

  11. Suvel Saksamaale turiste toonud Saksa firma lõpetas tegevuse / Kristjan Jõevere

    Index Scriptorium Estoniae

    Jõevere, Kristjan

    2006-01-01

    Lõbusõidulaeva Lili Marleen operaatorfirma Holiday Kreuzfahrten, mis ainsana tegi reise Saaremaa uude sadamasse, lõpetas tegevuse. Tallinna Sadama avalike suhete juhi Sven Ratassepa sõnul pole karta, et sadam suvel kasutuna seisaks

  12. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Arovane "Lilies", The Remote Viewer "You're going to love our defeatist attitude", B. Fleishcmann und Herbert Weixelbaum present Duo 505 "Late", The Go Find "Miami", Corker Conboy "Six For Five"

  13. Oxidation processes on conducting carbon additives for lithium-ion batteries

    KAUST Repository

    La Mantia, Fabio

    2012-11-21

    The oxidation processes at the interface between different types of typical carbon additives for lithium-ion batteries and carbonates electrolyte above 5 V versus Li/Li+ were investigated. Depending on the nature and surface area of the carbon additive, the irreversible capacity during galvanostatic cycling between 2.75 and 5.25 V versus Li/Li+ could be as high as 700 mAh g-1 (of carbon). In the potential region below 5 V versus Li/Li+, high surface carbon additives also showed irreversible plateaus at about 4.1-4.2 and 4.6 V versus Li/Li+. These plateaus disappeared after thermal treatments at or above 150 °C in inert gas. The influence of the irreversible capacity of carbon additives on the overall performances of positive electrodes was discussed. © 2012 Springer Science+Business Media Dordrecht.

  14. Household Safety: Preventing Poisoning (For Parents)

    Science.gov (United States)

    ... and nail polish remover. Keep kids away from houseplants — and plants around your yard — that can be ... that are nonpoisonous. A few examples of toxic houseplants include: rhododendron, English ivy, lily of the valley, ...

  15. Uutes eesti nukufilmides mängivad näitlejad / Kristiina Davidjants

    Index Scriptorium Estoniae

    Davidjants, Kristiina, 1974-

    2008-01-01

    Rao Heidmetsa filmist "Kaasasündinud kohustused" ja Riho Undi nukufilmist "Lili" : Nukufilm 2008. Mõlemad esilinastuvad täna kinos Sõprus. Stuudio Nukufilm tegevusest, tööst 3D-animatsiooni kallal

  16. Environ: E00145 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 06], Ophiopogon ohwii, Ophiopogon [TAX:100502] Same as: D06775 Ruscaceae (lily-of-the-valley family) Ophiopogon tuber Major component: Ophiopogonin [CPD:C17041 C17038 C17043 C17042] ...

  17. Dicty_cDB: VSD491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : kf*iyf*lfyl*pfyvlviwqmpdildaklvkp*ykkq*ipyqnmelqnkkltirftvyv tqfqh*ahvvn*llqfmekp*lily*mvkvltklvnslmsvirnv...ktspktttn*lin** ink*tiiylfqkk--- ---kf*iyf*lfyl*pfyvlviwqmpdildaklvkp*ykkq*ipyqnmelqnkkltirft vyvtqfqh*ahvvn

  18. Drug: D10764 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10764 Crude ... Drug Allium chinense bulb (non-JP); Allii chinensis bulbus ... A...llium chinense G.Don [TAX:130426] ... Same as: E00427 ... Liliaceae (lily family) Allium chinense bulb ... PubChem: 310920482 ...

  19. Environ: E00427 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00427 Allium chinense bulb (non-JP) Allii chinensis bulbus Crude drug ... Allium chi...nense [TAX:130426] Same as: D10764 Liliaceae (lily family) Allium chinense bulb (boiled, dried) ...

  20. AcEST: BP918765 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Philydrum... 160 3e-38 tr|B3SGS7|B3SGS7_9LILI NADH dehydrogenase subunit B OS=Helmholt...RR3|A0ARR3_9LILI NADH dehydrogenase subunit B OS=Helmholtz... 160 3e-38 tr|Q9GFM5|Q9GFM5_CALFL NADH dehydrog...SSAL 382 >tr|B3SGS7|B3SGS7_9LILI NADH dehydrogenase subunit B OS=Helmholtzia acorifolia GN=ndhB PE=4 SV=1 Le...TFARIVSFGLRTGTDNIRDYAGLYTKDPFLALSSAL 382 >tr|A0ARR3|A0ARR3_9LILI NADH dehydrogenase subunit B OS=Helmholtzia

  1. Remedial Investigation Addendum Report Data Item A009. Volume 4: Appendices I-Z

    Science.gov (United States)

    1993-12-01

    spp. OBL Water Lily Nuphar spp. OBL Pale Smartweed Polygonum lapathifolium FACW+ f Pickerelweed Pontederia cordata OBL Pondweed Potamogeton spp. OBL...Water Lily Nymphaea odorata OBL Pale Smartweed Polygonum lapathifolium FACW+ Pickerelweed Pontederia cordata OBLI Pondweed Potamogeton spp. OBL Common...northern arrowhead (Sagittaria cuneata), and pickerelweed (Pontedaria cordata ) were all noted in this community and comprise 80-90% of the plant species

  2. Distribution and Abundance of Eurasian Watermilfoil (Myriophyllum spicatum L.) and Curly-Leaf Pondweed (Potamogeton crispus L.) in Shawano Lake, Wisconsin

    Science.gov (United States)

    2007-09-01

    Najas spp. Naiad N Submersed 13.4 Nuphar advena (Aiton) Aiton f. Yellow pond lily N Floating 1.6 Nymphaea odorata Aiton White water lily N Floating 0.3...M. sibiricum Komarov 7.7 (1.53) 4 M. spicatum L. 96.99 (21.68) 30 Najas spp. 20.15 (5.21) 43 Potamogeton amplifolius Tuck. 10.05 (6.55) 10 P

  3. Flood Control Root River Basin, Minnesota.

    Science.gov (United States)

    1977-03-01

    Epigaea repens) b. Gentian genera (Gentiana sp.) c. Lily genera (Lilium sp.) d. Lotus lily (Nelumbo lutea ) e. Orchid family (Orchidaceae) 2.58 Within...Fraxinus nigra Rare Black birch Betula lutea Rare (1) Curtis, J. T., The Vegetation of Wisconsin, Wisconsin University Press. Madison, Wisconsin, 1959. A-1...Abundant Culver’s-root Veronicastrwn virginicum Uncommon Marsh blue violet Viola cucullata Abundant Downy yellow violet Viola pubescens Abundant Summer grape

  4. AcEST: DK945130 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bosomal protein S7 OS=Xeronema call... 145 1e-33 tr|A0ARV9|A0ARV9_9LILI 30S ribosomal protein S7 OS=Luzuriag...TH++AEAN+AFAHFR Sbjct: 114 RNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >tr|A0ARV9|A0ARV9_9LILI 30S ribosomal protein S7 OS=Luz

  5. The establishment of a slow-growth conservation system in vitro for ...

    African Journals Online (AJOL)

    The establishment of a slow-growth conservation system in vitro for two wild lily species. D Yun-peng, L Wen-yuan, Z Ming-fang, H Heng-bin, J Gui-xia. Abstract. There are abundant resources of wild lily in China. To achieve a sustainable use for these resources, a slow-growing preservation system should be well ...

  6. AcEST: BP917107 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 140 4e-32 tr|B3SGS7|B3SGS7_9LILI NADH dehydrogenase subunit B OS=Helmholtz... 140 4e-32 tr|B3SGS6|B3SGS6...nit B (Fragment) O... 140 4e-32 tr|A0ARR3|A0ARR3_9LILI NADH dehydrogenase subunit B OS=Helmholt

  7. Biochemical responses of isolated lung CSCs after application of low intensity laser irradiation

    Science.gov (United States)

    Abrahamse, Heidi; Crous, Anine

    2016-03-01

    Studies have shown that using high fluences of Low Intensity Laser Irradiation (HF-LILI) produce apoptotic effects on normal and neoplastic cells. This study aimed to determine whether HF-LILI induce cell death in lung CSCs. Lung CSCs were isolated using the stem cell marker CD 133, characterized using flow cytometry, and applied in experiments which included treatment with LILI at wavelengths of 636, 825 and 1060 nm with fluences ranging from 5 J/cm2 to 40 J/cm2. Viability and proliferation studies, using Alamar blue assay and adenosine triphosphate luminescence (ATP), indicated an increase when treating lung CSCs with low fluences of 5 - 20 J/cm2 and a decrease in viability and proliferation as well as an increase in apoptosis when applying a fluence of 40 J/cm2 indicated by flow cytometry using Annexin V and propidium iodide (PI) dyes. Results indicate that LILI, when treating lung CSCs, can induce either a bio-stimulatory or bio-inhibitory effect depending on the wavelength and fluence used. This study indicated successful apoptotic induction of lung CSCs. Future experiments should be able to conclude the exact mechanism behind HF-LILI, which can be used in the targeted treatments of CSC elimination, implementing HF-LILI in the same manner as PDT in the absence of a photosensitizer.

  8. Lasīšana kā līdzeklis intereses paaugstināšanai par angļu valodu 7.klasē

    OpenAIRE

    Gavrilova, Natālija

    2011-01-01

    Šī darba mērķis bija noskaidrot un praksē reāli pārbaudīt, kādus interaktīvus uzdevumus var izmantot, lai palielinātu interesi par angļu valodu 7.klases skolēniem. Motivēt skolēnus lasīt vairāk ir ļoti svarīgi, lai sasniegtu labākus rezultātus svešvalodas mācīšanās procesā. Darba gaitā tika izpētīta teorētiskā literatūra par svešvalodas mācīšanās motivāciju, lasīšanu un skolotāja lomu lasīšanai veltītā stundā, analizēta literatūra par pusaudžu vecuma skolēnu psihologiskajām īpatnīb...

  9. Mācību saturs lasītprasmes attīstīšanai pamatizglītības pirmajā posmā

    OpenAIRE

    Tarasova, Renata

    2009-01-01

    Diplomdarbā tiek aplūkots mācību saturs lasītprasmes attīstīšanai pamatizglītības pirmajā posmā. Lasāmie teksti ir latviešu valodas apguves avots un vienlaicīgi arī iespēja apgūt apkārtējo pasauli. Diplomdarba mērķis ir pētīt un analizēt mācību saturu lasītprasmes attīstīšanai pamatizglītības pirmajā posmā, izstrādāt ieteikumus darba pilnveidošanai. Diplomdarbam ir trīs daļas. 1. daļā analizēta lasītprasmes būtības skaidrojums dažādās teorijās. Otrajā daļā analizēts latviešu valodas mācību...

  10. Runāšanas prasmju mācīšana dažāda vecuma studentiem

    OpenAIRE

    Mamikoņjana, Veronika

    2012-01-01

    Runašana ir viens no nozīmīgākajiem katras valodas aspektiem tā kā tā ir galvenais valodas saziņas veids. Turklāt, runāšana ir ļoti sarežģīts process kas prasa daudzu orgānu darbu. Tieši tāpēc ir svarīgi attīstīt runāšanas prasmes. Pastāv vairākās modeles, metodes, teorijas un klases aktivitātes kuri var tikt izmantoti šīm nolūkam. Skolotājam ir jāizlemj, kurus no tiem izvēlēties lai padarīt nodarbību efektīvu un lietderīgu. Lai izdarīt to veiksmīgi skolotājam ir jāņem vērā mācīšanas/mācīšanā...

  11. К постановке вопроса об атласе морской и рыболовецкой лексики балтийского моря

    Directory of Open Access Journals (Sweden)

    Benita Laumane

    2011-05-01

    Full Text Available JAUTĀJUMĀ PAR BALTIJAS JŪRAS ZVEJNIECĪBAS UN JŪRNIECĪBAS LEKSIKAS ATLANTURezumējumsAtsevišķas Baltijas jūras areālā sastopamās valodas, kuras pēc savas izcelšanās ir ļoti dažā­das, vieno vairākas kopīgas parādības fonētikā, bet jo vairāk leksikā. Daudz nozīmīga par Baltijas jūras krastos dzīvojošo tautu un valodu (baltu, skandināvu, Baltijas somugru sakariem varē­tu dot Baltijas jūras zvejniecības un jūrniecības leksikas atlants.Kaut arī zināms, ka balti dzīvo pie jūras jau mūsų ēras sākumā, taču zvejniecības leksikai lingvisti veltījuši maz uzmanības. Pētot jūras zvejas leksiku, jāizvirza jautājums par substrāta ele­mentu iespēju zvejniecības leksikā, piem., tādi ir ar jūras faunu saistītie nosaukumi, kas latviešu valodā aizgūti no lībiešu vai igauņu valodas, bet kam šais valodās trūkst drošas etimologijas. Īpašu vietu ieņem jautājums par kuršu valodas elementu saglabāšanos Rietumkurzemes piekrastes zvej­nieku leksikā. Kuršu valodas pēdas, jādomā, glabā ari Lietuvas zvejnieku valoda, jo Lietuvas piek­rasti ap Palangu un Klaipēdu vēl līdz pat XIII gadsimtam apdzīvo galvenokārt tikai kurši.Lingvistiskais un etnogrāfiskais materiāls par zvejniecību (jūras un saldūdeņu dos arī jaunas, vārīgas liecības par materiālās kultūras attīstību Baltijas jūras rajonā.

  12. Generation and analysis of expressed sequence tags in the extreme large genomes Lilium and Tulipa

    Directory of Open Access Journals (Sweden)

    Shahin Arwa

    2012-11-01

    Full Text Available Abstract Background Bulbous flowers such as lily and tulip (Liliaceae family are monocot perennial herbs that are economically very important ornamental plants worldwide. However, there are hardly any genetic studies performed and genomic resources are lacking. To build genomic resources and develop tools to speed up the breeding in both crops, next generation sequencing was implemented. We sequenced and assembled transcriptomes of four lily and five tulip genotypes using 454 pyro-sequencing technology. Results Successfully, we developed the first set of 81,791 contigs with an average length of 514 bp for tulip, and enriched the very limited number of 3,329 available ESTs (Expressed Sequence Tags for lily with 52,172 contigs with an average length of 555 bp. The contigs together with singletons covered on average 37% of lily and 39% of tulip estimated transcriptome. Mining lily and tulip sequence data for SSRs (Simple Sequence Repeats showed that di-nucleotide repeats were twice more abundant in UTRs (UnTranslated Regions compared to coding regions, while tri-nucleotide repeats were equally spread over coding and UTR regions. Two sets of single nucleotide polymorphism (SNP markers suitable for high throughput genotyping were developed. In the first set, no SNPs flanking the target SNP (50 bp on either side were allowed. In the second set, one SNP in the flanking regions was allowed, which resulted in a 2 to 3 fold increase in SNP marker numbers compared with the first set. Orthologous groups between the two flower bulbs: lily and tulip (12,017 groups and among the three monocot species: lily, tulip, and rice (6,900 groups were determined using OrthoMCL. Orthologous groups were screened for common SNP markers and EST-SSRs to study synteny between lily and tulip, which resulted in 113 common SNP markers and 292 common EST-SSR. Lily and tulip contigs generated were annotated and described according to Gene Ontology terminology. Conclusions

  13. Identification of the tapetum/microspore-specific promoter of the pathogenesis-related 10 gene and its regulation in the anther of Lilium longiflorum.

    Science.gov (United States)

    Hsu, Ssu-Wei; Liu, Ming-Che; Zen, Kuo-Chang; Wang, Co-Shine

    2014-02-01

    A tapetum/microspore-specific pathogenesis-related (PR) 10 gene was previously identified in lily (Lilium longiflorum Thunb.) anthers. In situ hybridization and RNA blot analysis indicated that the lily PR10 genes are expressed specifically and differentially in the tapetum of the anther wall and in microspores during anther development. The accumulation of PR10 transcripts was exogenously induced by gibberellic acid (GA) and was suppressed by ethylene. Studies using inhibitors of GA and ethylene revealed that the lily PR10 is modulated by an antagonistic interaction between GA and ethylene. The treatment of norbornadien, an ethylene inhibitor, caused the tapetum to become densely cytoplasmic and highly polarized, whereas uniconazole, an inhibitor of GA biosynthesis, arrested tapetal development to a status close to that of control. The expression of the lily PR10g promoter in transgenic Arabidopsis was determined using the β-glucuronidase (GUS) reporter gene indicated that the decisive fragment required for anther specificity is located -1183 bp to -880 bp upstream of the transcription start site. The PR10gPro::barnase transgenic lines exhibited complete male sterility because of the disruption of the tapetum and the deformation of microspore/pollen. The anther specificity of lily PR10 highlights the importance of the tapetum/microspore-specific PR10g promoter for future biotechnological and agricultural applications. Copyright © 2013. Published by Elsevier Ireland Ltd.

  14. Factor affecting the capacity retention of lithium-ion cells

    Science.gov (United States)

    Ohzuku, Tsutomu; Ueda, Atsushi; Yamamoto, Norihiro; Iwakoshi, Yasunobu

    Capacity failure due to the imbalance of coulombic efficiencies between positive and negative electrodes in a lithium-ion (shuttlecock) cell was examined by fabricating two types of cells, i.e., Li[Li 1/3Ti 5/3]O 4/LiNiO 2 and carbon/LiNiO 2. Rechargeable capacity of a lithium-ion cell consisting of Li[Li 1/3Ti 5/3]O 4 and LiNiO 2 faded more rapidly than that of a cell based on natural graphite and LiNiO 2 in spite of superior coulombic efficiency of Li[Li 1/3Ti 5/3]O 4 (very close to 100%) compared with that of natural graphite (about 98%). The important role of the electrolyte upon the capacity retention of lithium-ion cells is described and specific problems to extend cycle life are discussed.

  15. The effects of low-intensity He-Ne laser irradiation on erythrocyte metabolism.

    Science.gov (United States)

    Luo, Gang-Yue; Sun, Li; Wei, En-Xiu; Tan, Xiaodong; Liu, Timon Cheng-Yi

    2015-12-01

    Low-intensity laser irradiation (LILI) can improve the deformability of red blood cells (RBCs). It might be due to the LILI effects on adenosine triphosphate (ATP) level. However, ATP content may not be a valid surrogate marker for RBC deformability. The LILI effects on RBC glycolysis were studied in this paper. Hypertonic RBCs were used in this study. After 5 min irradiation with low-intensity He-Ne laser irradiation (LHNL) at 632.8 nm and 4.4 mW/cm(2), the concentration of intracellular glucose and the activities of phosphofructokinase (PFK) and glyceraldehyde-3-phosphate dehydrogenase (GAPDH) were measured, respectively. There was no significant change in intracellular glucose concentration. The activity of PFK decreased significantly, but the activity of GAPDH increased significantly. In hypertonic RBCs, LHNL irradiation may decrease the activity of energy-consuming enzymes, but increases the activity of energy-generating enzymes in glycolysis, to improve the RBC deformability.

  16. Shedding Light on a New Treatment for Diabetic Wound Healing: A Review on Phototherapy

    Directory of Open Access Journals (Sweden)

    Nicolette N. Houreld

    2014-01-01

    Full Text Available Impaired wound healing is a common complication associated with diabetes with complex pathophysiological underlying mechanisms and often necessitates amputation. With the advancement in laser technology, irradiation of these wounds with low-intensity laser irradiation (LILI or phototherapy, has shown a vast improvement in wound healing. At the correct laser parameters, LILI has shown to increase migration, viability, and proliferation of diabetic cells in vitro; there is a stimulatory effect on the mitochondria with a resulting increase in adenosine triphosphate (ATP. In addition, LILI also has an anti-inflammatory and protective effect on these cells. In light of the ever present threat of diabetic foot ulcers, infection, and amputation, new improved therapies and the fortification of wound healing research deserves better prioritization. In this review we look at the complications associated with diabetic wound healing and the effect of laser irradiation both in vitro and in vivo in diabetic wound healing.

  17. Transcriptome-Wide Analysis of Botrytis elliptica Responsive microRNAs and Their Targets in Lilium Regale Wilson by High-Throughput Sequencing and Degradome Analysis

    Directory of Open Access Journals (Sweden)

    Xue Gao

    2017-05-01

    Full Text Available MicroRNAs, as master regulators of gene expression, have been widely identified and play crucial roles in plant-pathogen interactions. A fatal pathogen, Botrytis elliptica, causes the serious folia disease of lily, which reduces production because of the high susceptibility of most cultivated species. However, the miRNAs related to Botrytis infection of lily, and the miRNA-mediated gene regulatory networks providing resistance to B. elliptica in lily remain largely unexplored. To systematically dissect B. elliptica-responsive miRNAs and their target genes, three small RNA libraries were constructed from the leaves of Lilium regale, a promising Chinese wild Lilium species, which had been subjected to mock B. elliptica treatment or B. elliptica infection for 6 and 24 h. By high-throughput sequencing, 71 known miRNAs belonging to 47 conserved families and 24 novel miRNA were identified, of which 18 miRNAs were downreguleted and 13 were upregulated in response to B. elliptica. Moreover, based on the lily mRNA transcriptome, 22 targets for 9 known and 1 novel miRNAs were identified by the degradome sequencing approach. Most target genes for elliptica-responsive miRNAs were involved in metabolic processes, few encoding different transcription factors, including ELONGATION FACTOR 1 ALPHA (EF1a and TEOSINTE BRANCHED1/CYCLOIDEA/PROLIFERATING CELL FACTOR 2 (TCP2. Furthermore, the expression patterns of a set of elliptica-responsive miRNAs and their targets were validated by quantitative real-time PCR. This study represents the first transcriptome-based analysis of miRNAs responsive to B. elliptica and their targets in lily. The results reveal the possible regulatory roles of miRNAs and their targets in B. elliptica interaction, which will extend our understanding of the mechanisms of this disease in lily.

  18. Fra "en rigtig pige" til "en gravid mand"

    DEFF Research Database (Denmark)

    Heede, Dag

    2012-01-01

    Nedslag i to eksempler på "transreproduktion": Lili Elbe, en transkvinde, der i 1931 døde efter en række kønsskifteoperationer og Thomas Beatie, en transmand, der i 2008 fødte et barn udgav en bog om det.......Nedslag i to eksempler på "transreproduktion": Lili Elbe, en transkvinde, der i 1931 døde efter en række kønsskifteoperationer og Thomas Beatie, en transmand, der i 2008 fødte et barn udgav en bog om det....

  19. Photochemical mechanisms of biological action of low-intensity laser irradiation

    Science.gov (United States)

    Klebanov, Gennady I.; Poltanov, Evgeny A.

    2004-08-01

    Low-intensity laser irradiation (LILI) is effectively used in clinical practice but the mechanisms of its stimulating action are still far from being understood completely and considered in the scientific literature only hypothetically. The main effects of LILI proved both in clinics and in experiments are bactericidal effect, vasodilatation, improved microcirculation, formation and growth of new microvessels, acceleration of wound healing, relieving of pain syndrome. We put forward a free radical conception underlying these effects. In this paper the experimental evidences of this conception is considered.

  20. Runāšanas prasmju pilnveide, izmantojot stāstus

    OpenAIRE

    Dakse, Madara

    2016-01-01

    Runāšanas prasmes tiek izmantotas katru dienu. Runa ir valodas prasme, kas palīdz komunicēt. Tas ir sarežģīts process, kas iekļauj citas valodu prasmes un runas orgānus. Tāpēc ir svarīgi attīstīt runāšanas prasmes. Bakalaura darba tēma ir "Runāšanas prasmju pilnveide, izmantojot stāstus". Darba mērķis ir pierādīt, ka, izmantojot stāstu metodi mācīšanā, var uzlabot runāšanas prasmes. Darbā izmantotās pētniecības metodes ir literatūras apskats, gadījumu izpēte un triangulācijas metode. Izvirzīt...

  1. Servera puses programmēšanas valodu atbalsts un izstrādes vižu instalēšana un konfigurēšana tīmekļa serverī

    OpenAIRE

    Polis, Jānis

    2011-01-01

    Kvalifikācijas darba tēma ir „Servera puses programmēšanas valodu atbalsts un izstrādes vižu instalēšana un konfigurēšana tīmekļa serverī”. Darba mērķis ir izveidot pilnvērtīgu tīmekļa servera prototipu, ko paredzēts izmantot vienas kompānijas ietvaros, kas atbalsta vairākas tīmekļa servera puses programmēšanas valodas un izstrādes vides, lai varētu veidot dažāda veida tīmekļa vietnes. Kā arī izstrādāt mājas lapu, kas reklamētu uzņēmuma produkciju. Šis serveris tiks veidots ...

  2. Sinonīmu rindas krievu un latviešu valodā funkcionēšanas aspektā.

    OpenAIRE

    Kārkliņa, Kristīne

    2014-01-01

    Bakalaura darbs veltīts krievu un latviešu valodas sinonīmu rindu sastatīšanas paņēmieniem, pamatojoties uz lietvārdiem, kas apzīmē emocijas, un vārdu sinonīmu leksiski semantiskajai analīzei. Darba teorētiskajā daļā tiek izskatītas problēmas, kas saistītas ar jēdzieniem „sinonīmija”, „sastatīšana” un „funkcionēšana”. Pētījums var ieinteresēt studentus filologus, lingvistus, kas nodarbojas ar kontrastīvās lingvistikas jautājumiem un sinonīmu rindu funkcionēšanu dažādās valodās, psihologus...

  3. Vēderdejotājas vizuālais attēlojums Rietumu un Austrumu kultūrā

    OpenAIRE

    Lasmane, Dana

    2009-01-01

    Dana Lasmane. Diplomdarbs par tēmu: „Vēderdejotājas vizuālais attēlojums Rietumu un Austrumu kultūrā”, Latvijas Universitāte, Rīga, 2009. Darbs veikts grafiskā dizaina nozarē. Diplomdarba autore veiks padziļinātu literatūras analīzi par deju, dejas valodu, vēderdeju vēsturi, vēderdeju stiliem, vēderdeju tērpiem, papildus meklējot literatūru par mākslas valodas vizuālā attēla radīšanas principiem un simboliem, gan korporatīvās identitātes grafisko dizainu, kā arī reklāmu un...

  4. Estudio de los factores que afectan la replicación y empaquetamiento de dna en cápsides de virus adeno-asociado 2 en células de insecto /

    OpenAIRE

    Gallo Ramirez, Lili Esmeralda

    2012-01-01

     tesis que para obtener el grado de Doctorado en Ciencias Bioquímicas, presenta Lili Esmeralda Gallo Ramirez ; asesor Laura Alicia Palomares Aguilera174 páginas : ilustracionesDoctorado en Ciencias Bioquímicas UNAM, Instituto de Biotecnologia, 2012

  5. From Homer to Hoke: A Small Step for African American Mankind.

    Science.gov (United States)

    Turner, Patricia A.

    1991-01-01

    Explores links between two films, "Lilies of the Field" (1962) and "Driving Miss Daisy" (1987), their portrayal of African-American men in relationships with White women, and audience and critic responses to the films. Little has changed in the Hollywood perceptions since the earlier film was made. (JB)

  6. Think I t Over

    Indian Academy of Sciences (India)

    expressed in closed form? Anagrams of Wiiliam Burnside: I WARN DUMB LILIES. SIMILAR, BLUE WIND. I WILL SUM IN BREAD. MEDUSA ILL; WIN RIB. I WILL DREAM IN BUS. BILL; I MUSE INWARD. INLA W IS MULE BIRD. I DRAW IN SEMI-BULL. I WILL DUB SEMINAR. BILL; I MUSE DARWIN. I AM ILL; WIN RED BUS.

  7. Preparation and characterization of Co9S8 nanocrystalline and ...

    Indian Academy of Sciences (India)

    2008-08-13

    Aug 13, 2008 ... Peng-Fei Yin1 2 Li-Li Sun1 3 You-Lu Gao2 Sheng-Yue Wang2. College of Science, Chongqing Jiaotong University, Chongqing 400074, P.R. China; Department of Physics, Southeast University, Nanjing 210096, P.R. China; Department of Physics, Third Military Medical University, Chongqing 400038, P.R. ...

  8. Cloning and expression analysis of an anthocyanidin synthase gene ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 93; Issue 2. Cloning and expression analysis of an anthocyanidin synthase gene homologue from Brassica carinata. Mingli Yan Suping Ding Lili Liu Xiaoming Yin Jiabin Shu. Research Note Volume 93 Issue 2 August 2014 pp 513-516 ...

  9. Skriftens krydsfelt i diskursen om transkønnethed

    DEFF Research Database (Denmark)

    Thomsen, Bodil Marie Stavning

    2016-01-01

    Anmeldelse af en tysk afhandling om den danske maler, Einar Wegeners, transkønnede forvandling til Lilli Elbe. Med tekstanalytisk afsæt i Lili Elbes dagbøger, fotografier og pressemateriale samt medicinske kilder analyserer afhandlingen de tekst- og diskursteoretisk omstændigheder og kontekster...

  10. Environmental Assessment: Construction and Operation of an Alternate Drone Launch System at Tyndall Air Force Base

    Science.gov (United States)

    2008-05-01

    coast lupine Lupinus westianus ce T Scrub, dunes Harper’s yellow-eyed grass Xyris scabrifolia T Wet prairie Henry’s spider lily Hymenocallis...Egretta tricolor SSC Marshes, ponds White ibis Eudocimus albus SSC Marshes, lakes REPTILES Alligator snapping turtle Macroclemys temmincki ce SSC

  11. Author Details

    African Journals Online (AJOL)

    Aliero, AA. Vol 8, No 1 (2015) - Articles Nutritional composition, antinutritional factors and elemental analysis of Nymphaea lotus (water lily) Abstract PDF. ISSN: 2006-6996. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

  12. Stimulative Effects of Low Intensity He-Ne Laser Irradiation on the Proliferative Potential and Cell-Cycle Progression of Myoblasts in Culture

    Directory of Open Access Journals (Sweden)

    Cui-Ping Zhang

    2014-01-01

    Full Text Available Low intensity laser irradiation (LILI was found to promote the regeneration of skeletal muscle in vivo but the cellular mechanisms are not fully understood. Myoblasts, normally quiescent and inactivated in adult skeletal muscle, are a type of myogenic progenitor cells and considered as the major candidates responsible for muscle regeneration. The aim of the present study was to study the effect of LILI on the growth potential and cell-cycle progression of the cultured myoblasts. Primary myoblasts isolated from rat hind legs were cultured in nutrient-deficient medium for 36 hours and then irradiated by helium-neon laser at a certain energy density. Immunohistochemical and flow cytometric analysis revealed that laser irradiation could increase the expression of cellular proliferation marker and the amount of cell subpopulations in the proliferative phase as compared with the nonirradiated control group. Meanwhile, the expressions of cell-cycle regulatory proteins in the laser-treated myoblasts were markedly upregulated as compared to the unirradiated cells, indicating that LILI could promote the reentry of quiescent myoblasts into the cell division cycle. These results suggest that LILI at certain fluences could promote their proliferation, thus contributing to the skeletal muscle regeneration following trauma and myopathic diseases.

  13. Elucidating and mining the Tulipa and Lilium transcriptomes

    NARCIS (Netherlands)

    Moreno-Pachon, N.M.; Leeggangers, Melissa; Nijveen, Harm; Severing, Edouard; Hilhorst, Henk; Immink, Richard G.H.

    2016-01-01

    Genome sequencing remains a challenge for species with large and complex genomes containing extensive repetitive sequences, of which the bulbous and monocotyledonous plants tulip and lily are examples. In such a case, sequencing of only the active part of the genome, represented by the

  14. Use of gibberellin in floriculture

    African Journals Online (AJOL)

    Yomi

    ornamental in: 13o Congresso Brasileiro de Floricultura e Plantas. Ornamentais. São Paulo. Summary. Campinas. p. 28. Dias-Tagliacozzo GM, Gonçalves C, Castro CEF (2003b). Maintaining postharvest quality of lily in: Brazilian Congress of Physiology. Summary. Brazilian Journal of Plant Physiology, Campinas. 15: p.

  15. 1 - 5_Wasagu et al

    African Journals Online (AJOL)

    USER

    According to Alma (1974), Native. American use the roots tea for cough, tuberculosis treatment, inflamed glands and mouth sore to stop bleeding. Also the mixture of roots with lemon juice served to remove freckles and pimples. The search for the lesser known and underutilized crops which includes water lily, many of ...

  16. Complete genome sequences of two highly divergent Japanese isolates of Plantago asiatica mosaic virus

    NARCIS (Netherlands)

    Komatsu, Ken; Yamashita, Kazuo; Sugawara, Kota; Verbeek, Martin; Fujita, Naoko; Hanada, Kaoru; Uehara-Ichiki, Tamaki; Fuji, Shin Ichi

    2017-01-01

    Plantago asiatica mosaic virus (PlAMV) is a member of the genus Potexvirus and has an exceptionally wide host range. It causes severe damage to lilies. Here we report on the complete nucleotide sequences of two new Japanese PlAMV isolates, one from the eudicot weed Viola grypoceras (PlAMV-Vi), and

  17. Expression of GFSKLYFamide-like neuropeptide in the digestive ...

    African Journals Online (AJOL)

    TOSHIBA

    2015-06-23

    Jun 23, 2015 ... The sea cucumber Holothuria scabra, also called sandfish, is an echinoderm species in the class Holothuroidea, order Aspidochirotida, family Holothuriidae and genus H. Metriatyla scabra (Jaeger, 1833). Other classes in the echinoderm phylum are starfish (Astroidea), sea urchin. (Echinoidea), sea lilies ...

  18. Eelarvamustest lahti / Katt Hansen

    Index Scriptorium Estoniae

    Hansen, Katt

    2003-01-01

    PÖFFi naistekeskseid mängufilme : taanlase Morten Arnfredi "Õnne tänav", tšehh Michaela Pavlatova "Truudusetud mängud", prantsuse filmid "29 Palms" (Bruno Dumont) ja "Väike Lili" (Claude Miller) ning prantsuse-tuneesia "Satin Rouge" (Raja Amari)

  19. Giant pulmonary hydatid cyst mimicking elevated diaphragm: A ...

    African Journals Online (AJOL)

    shows one or more homogenous round or oval masses with smooth borders surrounded by normal lung tissue on chest radiograph.[3] Water lily sign and crescent sign are pathognomic for ruptured hydatid cyst. Ruptured hydatid can also produce cumbo's sign, serpent sign and monod's sign.[1]. Access this article online.

  20. Dicty_cDB: SSA794 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tcistmlmpitql vn*mltikvlvsmvnvefvimltvvptllkvkvpqelvysqvnsqlstlqagllvdtmkn qskfg*qfssv*lf*f*lstswv...vysqvnsqlstlqagllvdtmkn qskfg*qfssv*lf*f*lstswvs*rnnkyrfvk*yfffl*LILYNVHQIFSISMNLVPC KKFDKDGDDCIAYKNVEASNLLT...qvnsqlstlqagllvdtmknqskfg*qfssv*lf*f* lstswvs*rnnkyrfvk*yfffl*lily Homology vs CSM-cDNA Score E Sequences pr

  1. Schrodinger's Uncertainty Principle?

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. Schrödinger's Uncertainty Principle? - Lilies can be Painted. Rajaram Nityananda. General Article Volume 4 Issue 2 February 1999 pp 24-26. Fulltext. Click here to view fulltext PDF. Permanent link:

  2. VV\\Afvv

    Indian Academy of Sciences (India)

    42 Homi Bhabha and Cosmic Ray Research in India. B V Sreekantan. 52 Schrodinger's Uncertainty Principle? - Lilies can be Painted. Rajaram Nityananda. 55 J J Thomson - A 'Thinking' Experimentalist. Rohini Godbole. 58 Wegener and his Theory of Continental Drift. 76. 83. Ramesh Chander. Dark Matter in the Universe.

  3. Estonia's cinematic boom year / Adam Krowka

    Index Scriptorium Estoniae

    Krowka, Adam

    2008-01-01

    Mängufilm Mati Undi romaani ainetel "Sügisball" (režissöör Veiko Õunpuu) võitis mitmetel rahvusvahelistel filmifestivalidel auhindu. Eesti filmikunstist, filmide rahastamisest ja filmilevist 2007. aastal. Kommenteerivad Lily Pilt EFSA-st ja näitleja, stsenarist Rain Tolk

  4. Plaadisoovitus

    Index Scriptorium Estoniae

    2006-01-01

    Uutest heliplaatidest Razorlight, lordi "The Arocalypse", Marie Fredriksson "Min Bäste Vän", Muse "Black Holes & Revelations", Lily Allen "Alright, Still", "Just1 Hits", "Summer Jam 2006", "On The Beach. Vol 2", "Zero 7", "Ultimate Dance", Sergio Mendes "Pure Bossa Nova", Keane "Under The Iron Sea"

  5. lkyaNgonde : a preliminary analy- sis*

    African Journals Online (AJOL)

    recognized by /ama-- am-/. /iii-/ occurs before C- commencing stems and lily-/ occurs before V- commencing stems. lama-/ occurs before all C- commencing stems and /am-. / before all V-commencing stems. 4. (a) C- Commencing stems ilikumbulu I amakumbulu 'hoe/hoes' iliya~o I amaya~o. 'cassava' ilisiku I amasiku.

  6. 1. X toimus Hanila Muuseumi Seltsi pidulik koosolek... / Laine Vesker

    Index Scriptorium Estoniae

    Vesker, Laine

    2005-01-01

    Anti üle tunnistused seltsi auliikmetele, kelleks on Lennart Meri, Heinz Valk, Saima Mägi, Lily Kocins, Helmut Polberg, Mai Schröder, Eimar Kaasik, Hermi Vain, Elmar Vesker, Õie Pärna, Marju Heldema, Piret Leiumaa ja Salme Valdmets

  7. Los primeros isabelinos: maestros de genios

    Directory of Open Access Journals (Sweden)

    Arturo Laguado

    1964-10-01

    Full Text Available Cuando William Shakespeare empezó a escribir, en la última década del siglo XVI, ya el drama inglés había logrado un extraordinario desarrollo. Los llamados Poetas Universitarios no se contentaron con seguir las huellas de John Lily, su maestro.

  8. Arbitrarily primed sequence-related amplified polymorphism (AP ...

    African Journals Online (AJOL)

    Additionally, 80 SRAP primers were used to screen markers in seven plant species (Chinese cabbage, Chinese kale, eggplant, pepper, cucumber, rose and lily), which indicated obvious polymorphism. The primers of AP-SRAP combine simply and reliably. It can overcome the limitation of the number of standard SRAP ...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 206 ... Heather Mackenzie, Carole Fogg, Amy Drahota, Sue Halson-Brown, Rebecca Stores, Ann Dewey. Vol 9, No 3 (2016), How to interpret an unenhanced ... John Lagu Nyungura, Thomas Akim, Anthony Lako, Abe Gordon, Lily Lejeng, Gibson William. Vol 5, No 2 (2012), Is myocardial infarction common ...

  10. Mechanisms of vegetative propagation in bulbs

    NARCIS (Netherlands)

    Moreno-Pachón, Natalia

    2017-01-01

    Vegetative propagation is very important for the survival of species with long juvenile and adult vegetative phases, as it is the case for bulbous plants. Bulbous plants are ornamental geophytes with a bulb as an underground storage organ. Among flower bulbs, tulip and lily are the two commercially

  11. Biogeography of Nymphaeales: Extant patterns and historical events.

    Science.gov (United States)

    This study is the first, comprehensive attempt to elucidate the history of the order Nymphaeales—water-lilies and relatives—in time and space. On the basis of a dense taxon sampling that covers all genera of Nymphaeales and all subgenera of the genus Nymphaea and sound phylogenetic hypotheses we est...

  12. Cassava Ivorian bacilliform virus is a member of the genus Anulavirus.

    Science.gov (United States)

    Scott, Simon W; MacFarlane, Stuart A; McGavin, Wendy J; Fargette, Denis

    2014-10-01

    The complete genomic sequence of Cassava Ivorian bacilliform virus (CIBV) is described. The virus has a genomic organization similar to that of pelargonium zonate spot virus (PZSV), the type member of the genus Anulavirus, but it is most closely related to a second, recently described, anulavirus, Amazon lily mild mottle virus (ALiMMV).

  13. Cassava Ivorian bacilliform virus is a member of the genus Anulavirus

    OpenAIRE

    Scott, S. W.; MacFarlane, S.A.; McGavin, W. J.; Fargette, Denis

    2014-01-01

    The complete genomic sequence of Cassava Ivorian bacilliform virus (CIBV) is described. The virus has a genomic organization similar to that of pelargonium zonate spot virus (PZSV), the type member of the genus Anulavirus, but it is most closely related to a second, recently described, anulavirus, Amazon lily mild mottle virus (ALiMMV).

  14. Greenhouse Production: A Series of Learning Activity Packages.

    Science.gov (United States)

    Gibson, J. C.; And Others

    Designed for use when the student or the class is expected to grow a crop using the high school greenhouse, these learning activity packages are sequenced in typical greenhouse cropping fashion: (1) poinsettias in the fall, (2) Easter lilies (bulb crop) in the winter, (3) bedding plants (seed crop) in the spring, and (4) a nursery crop (from…

  15. Analysis of “indice” and comparing it with “opening the future” in Nizami’s Khosrow and Shirin and Leili and Majnun

    Directory of Open Access Journals (Sweden)

    Abdollah vasegh abbasi

    2016-09-01

    But, Majnun's night prayer is decorated with stars and lights of months. In this opening the future the narrator describes stars and planets and zodiac and houses of them in sky. However this pleasant description of night and day, indices a suit happening that will occur in the near future: getting Lily's letter to the Majnun.

  16. Personal Affairs: Child Development Services

    Science.gov (United States)

    1997-07-15

    and air quality systems which are responsive to the needs of children and consistent with control of airborne bacteria and disease. To eliminate...Echeveria, Eugenia, Fig. Grape Ivy, Hens & Chicks, Hibiscus, Honeysuckle, Hoya, Impatiens, Jade Plant, Kalanchoe. Lily, Lipstick Plant, Magnolia

  17. Hydrobiological constraints of trace metals in surface water, coastal ...

    African Journals Online (AJOL)

    SERVER

    2007-10-18

    Oct 18, 2007 ... Trace metals concentrations in surface water, sediment and water lily (Nymphaea lotus) samples from the banks of Calabar River, ... Key words: Trace metals, coastal sediment, Nymphaea lotus, Calabar River Estuary. INTRODUCTION ..... The linear correlation coefficients calculated for heavy metal in the ...

  18. Reading Matters: Supporting the Development of Young Adolescent Readers.

    Science.gov (United States)

    Humphrey, Jack W.; Lipsitz, Joan; McGovern, John T.; Wasser, Judith Davidson

    1997-01-01

    Since 1987, Indiana Middle Grades Reading Network, funded by Lily Endowment, initiated a variety of projects designed to promote young adolescents' reading. A Reading Bill of Rights was developed to create communities of readers. Some valuable lessons emerged: attention must be given to teens' reading needs; schools must be central; students need…

  19. DOCIS :a Model to Simulate Carbohydrate Balance and Development of Inflorescence during Vase Life

    NARCIS (Netherlands)

    Meeteren, van U.; Peppel, van de A.; Gelder, van H.

    2001-01-01

    The concept of a dynamic and deterministic model (DOCIS) was developed to simulate post harvest development of an inflorescence during vase life based on carbohydrate content at harvest. The model was partly parameterized using lily ‘Enchantment’. The inflorescence as a system was defined by the

  20. Fabrika kukolnõhh grjoz / Svetlana Karabut

    Index Scriptorium Estoniae

    Karabut, Svetlana

    2008-01-01

    Külaskäik Nukufilmi stuudiosse Niine tänaval. Stuudiot tutvustab produtsent Kerdi Oengo, jälgitakse kuidas valmib lõik filmile "Lili Marleen" (Marili Toome ja Ulvi Tiidu käe all). Rao Heidmets kommenteerib oma filmi "Kaasasündinud kohustused" võttetehnikat ja põhjendab miks valmivad stuudios just lühianimafilmid

  1. Antimicrobial and phytochemical properties of aqueous extracts of ...

    African Journals Online (AJOL)

    The genus Gladiolus, embraces 260 species of a perennial herb belonging to the lily family: Iridaceae. In West Africa Gladiolus corm is used in food, and in ethnomedicines for treating gonorrhea and other infections. Often, the corm is used in combination with other plant materials, hence it is not known if the corm alone has ...

  2. Association analysis of multiple traits by an approach of combining P ...

    Indian Academy of Sciences (India)

    Administrator

    Association analysis of multiple traits by an approach of combining P-values. LILI CHEN1,2,*, YONG WANG1, YAJING ZHOU2. 1 Department of Mathematics, School of Sciences, Harbin Institute of Technology,Harbin. 150001,P. R. China;. 2 Department of Statistics, School of Mathematical Sciences, Heilongjiang University ...

  3. Flower Development of Lilium longiflorum: Characterization of MADS-box transcription factors

    NARCIS (Netherlands)

    Benedito, V.A.

    2004-01-01

    Lily (Liliumspp.) is among the most traditional and beloved ornamental flowers worldwide. The genus Lilium comprises almost one hundred species, among which is the primary subject of our research, described in this thesis, the species Lilium

  4. Somatic embryogenesis and plant regeneration in Lilium longiflorum Thunb

    NARCIS (Netherlands)

    Tribulato, A.; Remotti, P.C.; Löffler, H.J.M.; Tuyl, van J.M.

    1997-01-01

    Friable callus was obtained from styles and flower pedicels of Lilium longiflorum Snow Queen and the Oriental lily hybrid Star Gazer on Murashige and Skoog (MS) media containing either 2 μM dicamba or 2 μM picloram. Cell suspension cultures were established by suspending the callus of L. longiflorum

  5. The establishment of a slow-growth conservation system in vitro for ...

    African Journals Online (AJOL)

    AJL

    2012-01-26

    Jan 26, 2012 ... College of Landscape Architecture, National Engineering Research Center for Flowers, Beijing Forestry University,. Beijing 100083, P. R. China. Accepted 15 December, 2011. There are abundant resources of wild lily in China. To achieve a sustainable use for these resources, a slow-growing preservation ...

  6. A Crafts-Oriented Approach to Computing in High School: Introducing Computational Concepts, Practices, and Perspectives with Electronic Textiles

    Science.gov (United States)

    Kafai, Yasmin B.; Lee, Eunkyoung; Searle, Kristin; Fields, Deborah; Kaplan, Eliot; Lui, Debora

    2014-01-01

    In this article, we examine the use of electronic textiles (e-textiles) for introducing key computational concepts and practices while broadening perceptions about computing. The starting point of our work was the design and implementation of a curriculum module using the LilyPad Arduino in a pre-AP high school computer science class. To…

  7. Nutritional composition, antinutritional factors and elemental ...

    African Journals Online (AJOL)

    Nutritional composition, antinutritional factors and elemental analysis of Nymphaea lotus (water lily). RSU Wasagu, M Lawal, LG Galadima, AA Aliero. Abstract. The study is aimed at evaluating nutritional composition, antinutritional factors and elemental analysis of three parts (roots sample RS, seed sample SS and leave ...

  8. Correction to Sahakyan and Delaney (2005)

    Science.gov (United States)

    Sahakyan, Lili; Delaney, Peter F.

    2005-01-01

    This article reports an error concerning the article "Directed Forgetting in Incidental Learning and Recognition Testing: Support for a Two-Factor Account" by Lili Sahakyan and Peter F. Delaney ("Journal of Experimental Psychology: Learning, Memory, and Cognition," Vol. 31, No. 4, pp. 789-801). The article was misidentified in the July issue as an…

  9. The metabolic incorporation of label from myoinositol-2-3H by the growing young anther of Lilium lorlgiflorum

    Directory of Open Access Journals (Sweden)

    H. Miki-Hirosige

    2014-01-01

    Full Text Available Fine structural autoradiography involving the incorporation of myo-inositol-2-3H (MI-2-3H unto lily anther during development has been used to explore the metabolic processes of microspore development and the interation between the devlaping microspore and degenerating tapetal cells.

  10. aids knowledge, attitude and behavioural pattern among

    African Journals Online (AJOL)

    aIttliemieal Pathology/Immunology, College of Health Sciences,. Ladoke Aklntola University of Technology, FIB 4400, Ologbo, Iigerh. Correspondence to: Dr. 0. 0. Opaleye hmmaw,ummmummmpummummmmnopmmm. MWIMWHVIADBmMMAWqMIuMMh the '3: , Lily-sit ' toattltndetowudamlnfiontaamlalooonlnl'ormatlon.

  11. Bulletin of Animal Health and Production in Africa - Vol 60, No 3 (2012)

    African Journals Online (AJOL)

    Survey of bacterial and parasitic organisms causing disease and lowered production in indigenous chickens in southern Nyanza, Kenya · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O William, O2 Portas, B Lily, O Samwel, O Maurice, O Rubin, 251-256 ...

  12. JPRS Report, Soviet Union, Political Affairs

    Science.gov (United States)

    1989-05-18

    scientific institute which this year has celebrated its Beautiful statice, narcissus and calla lilies are raised by 27th anniversary is the head...government decora- sense) father-in-law who worshiped ritual procedures no tion for one of these blitz inspections. This, however, was less than wild

  13. Identification of differentially expressed sequences in bud ...

    African Journals Online (AJOL)

    The suppression subtractive hybridization (SSH) method conducted to generate large-scale expressed sequence tags (EST) was designed to identify gene candidates related to the morphological and physiological differences between the stage before bud differentiation and the stage of bud differentiation of lily. The results ...

  14. Download this PDF file

    African Journals Online (AJOL)

    Philemon Kaganda

    INTRODUCTION. Aloe is a succulent of the lily family. It is native to Africa and is widely distributed across the continent. Plant occurring Aloe species are vera and barbadensis. The aloe plant has fleshy leaves which can be extracted to: 1. Gel. 2. latex. The gel is the leaf pulp or mucilage, a thin clear jelly-like substance ...

  15. Determining the effects of Trichoderma harzianum and some ...

    African Journals Online (AJOL)

    use

    2011-10-31

    Oct 31, 2011 ... some mycorrhizal fungi on plant growth and against. Rhizoctania solani Kühn in Lilium ... conducted in 2 stages: at stage 1, effects of Tr, BRDI and Glomus sp. on growth of lily plants were observed and four treatments, ... watering, the nutrient element contents of bulbs, nutrient level of growing medium, age.

  16. The Children's House

    Science.gov (United States)

    Peller, Lili E.

    2013-01-01

    Lili Peller's "The Children's House" essay begins where Maria Montessori left off in her description of space articulations. Peller does not name Montessori specifically as she always had a desire to become independent in her own right as a neo-Freudian child analyst. But the Haus Der Kinder founded in summer of 1922 suggests a total…

  17. High Capacity Cathode and Carbon Nanotube-Supported Anode for Enhanced Energy Density Batteries

    Science.gov (United States)

    2017-09-07

    The lithium rich product was then synthesized from the hollow microspheres following the rest of the Jiang et al. procedure. The XRD in Figure 9...extraction capacity to 90 mAh/gCNT. In the 30th cycle the small remnant “ shoulder ” feature of the profile at ~1.2 V vs. Li/Li+ has decreased more

  18. Profiling of genes central to human mitochondrial energy metabolism following low intensity laser irradiation

    Science.gov (United States)

    Houreld, Nicolette N.; Masha, Roland; Abrahamse, Heidi

    2012-09-01

    Background: Wound healing involves three overlapping phases: inflammation, granulation and tissue remodelling. If this process is disrupted, delayed wound healing ensues, a common complication seen in diabetic patients. Low intensity laser irradiation (LILI) has been found to promote healing in such patients. However, the exact mechanisms of action are poorly understood. Purpose: This study aimed to profile the expression of key genes involved in mitochondrial respiration. Materials and Methods: Diabetic wounded fibroblast cells were exposed to a wavelength of 660 nm and a fluence of 5 J/cm2 and incubated for 30 min. Total RNA was isolated and 1 μg reverse transcribed into cDNA which was used for real-time polymerase chain reaction (PCR) array analysis. The array contained genes important for each of the mitochondrial complexes involved in the electron transport chain (ETC). Adenosine triphosphate (ATP) levels were also determined post-irradiation by ATP luminescence. Results: Genes involved in complex IV (cytochrome c oxidase), COX6B2 and COX6C, and PPA1 which is involved in complex V (ATP synthase) were significantly up-regulated. There was a significant increase in ATP levels in diabetic wounded cells post-irradiation. Discussion and Conclusion: LILI stimulates the ETC at a transcriptional level, resulting in an increase in ATP. This study helps understand the mechanisms of LILI in diabetic wound healing, and gives information on activation of genes in response to LILI.

  19. The direct transformation of ethanol to ethyl acetate over Cu/SiO 2 ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 126; Issue 4. The direct transformation of ethanol to ethyl acetate over Cu/SiO2 catalysts that contain copper phyllosilicate. Xue Yu Shubo Zhai Wanchun Zhu Shuang Gao Jianbiao Yan Hongjing Yuan Lili Chen Jiahuan Luo Wenxiang Zhang Zhenlu Wang. Volume ...

  20. Thidiazuron, a non-metablized cytokinin, shows promise in extending the life of potted plants

    Science.gov (United States)

    Application of low concentrations of thidiazuron (N-phenyl-N’-1,2,3-thiadiazol-5-yl urea, TDZ) has been shown to be a very effective means of delaying leaf yellowing in cut flowers such as alstroemeria, stock, lilies and tulips. We examined the possible use of this compound for delaying leaf yellow...

  1. International Journal of Engineering, Science and Technology - Vol ...

    African Journals Online (AJOL)

    electrolysis pretreatment · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Shuchuan Peng, Lili Zhao, Xixi Liu, Dong Chen. http://dx.doi.org/10.4314/ijest.v2i7.63748 ...

  2. Retreat to Eden: Time and the Cosmos in Monet's Images of Giverny.

    Science.gov (United States)

    Call, Michael

    1997-01-01

    Attempts to explain Claude Monet's obsession with water lilies in the last 25 years of his life through an interdisciplinary approach combining ideas from the history of landscape design, social history, and anthropology. Offers Monet's gardens at Giverny (France), his series paintings, and the railroad as some possible influences on his painting.…

  3. Pop : The Corrs "Best Of" / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2001-01-01

    Heliplaatidest: The Corrs "Best Of", Ryan Adams "Gold", Green Day "International Superhits!", Techno Animal "The Brotherhood of The Bomb", Dr. Dre & kompanii "The Wash Soundtrack", Natalie Imbruglia "White Lilies Island", Carlos Santana "Divine Light - Reconstruction & Mix Translation: Bill Laswell", Enigma "LoveSensualityDevotion - The Remix Collection"

  4. A Molecular Cytogenetic Analysis of Introgression in Backcross Progenies of Intersectional Lilium Hybrids

    NARCIS (Netherlands)

    Khan, N.; Marasek Ciolakowska, A.R.; Xie, S.L.; Ramanna, M.S.; Arens, P.; Tuyl, van J.M.

    2012-01-01

    The genus Lilium is comprised of about 100 species and has been divided into seven taxonomic sections. The abundance and diversity of species within the genus Lilium offers numerous and rewarding possibilities to lily breeders. Species within the same section can be crossed by conventional

  5. Renal failure in a guinea pig (Cavia porcellus) following ingestion of oxalate containing plants

    OpenAIRE

    Holowaychuk, Marie K.

    2006-01-01

    A 1-year-old guinea pig presented with anorexia, lethargy, and weight loss, 1 week after ingesting a peace lily leaf. Laboratory findings were suggestive of renal failure and included elevated blood urea nitrogen and creatinine with concurrent isosthenuria. The guinea pig was euthanized 1 month later due to worsening clinical signs.

  6. Lilium longiflorum and molecular floral development: the ABCDE model

    NARCIS (Netherlands)

    Benedito, V.A.; Angenent, G.C.; Tuyl, van J.M.; Krens, F.A.

    2004-01-01

    Because lily (Lilium longiflorum Thunb.) is an important cut-flower crop, molecular characterisation of genes that are involved in flower morphology could help breeders to develop novel floral architectures in this species. The early ABC model for flower development emerged more than 10 years ago

  7. PHYSICOCHEMICAL AND FUNCTIONAL PROPERTIES OF FLOUR ...

    African Journals Online (AJOL)

    Chemical, physical and functional properties of flour obtained from the bulb of Lilium brownii were studied. Results obtained from analyses using AOAC and phenol-sulphuric acid methods show that lily flour has low protein (13.7%) but high carbohydrate contents (58.7%), respectively. Blanching had minimal effect on ...

  8. Microspore culture of Zantedeschia aethiopica: The role of ...

    African Journals Online (AJOL)

    Administrator

    2011-09-05

    Sep 5, 2011 ... lily calli to culture filtrate of Pectobacterium carotovorum subsp. Carotorum. Afr. J. Biotechnol. 8: 5362–5366. Nitsch JP, Nitsch C (1969). Haploid plants from pollen grains. Science,. 163:85-87. Obert B, Pretová A, Büter B, Schmid JE (2000). Effect of different saccharides on viability of isolated microspores ...

  9. A molecular cytogenetic analysis of chromosome behavior in Lilium hybrids

    NARCIS (Netherlands)

    Xie, S.L.

    2012-01-01

     Lily (Lilium) has become one of the top bulbous crops for the cut flower industry in the past two decades. The genus Lilium comprises of approximately 80 species, which have been classified into seven sections. Each section possesses distinctive phenotypic characters, such as flower color,

  10. Effects of calcium and humic acid treatment on the growth and ...

    African Journals Online (AJOL)

    Humic acid (HA) may facilitate plant growth by improving the nutrient uptake as well as through hormonal effects. Studies were conducted to investigate the effect of a mixture of calcium and HA on Oriental lily, which is sensitive to calcium deficiency. Two levels of Ca (3.5 and 7.0 meq/L) were combined with 500 mg/L HA ...

  11. Breeding for resistance to Fusarium oxysporum in flower bulbs

    NARCIS (Netherlands)

    Straathof, Th.P.; Löffler, H.J.M.; Linfield, C.A.; Roebroeck, E.J.A.

    1997-01-01

    Cultivation of the major flower bulb crops, e.g., lily, narcissus, gladiolus and tulip, is threatened by the soil-borne fungus Fusarium oxysporum. Fusarium infected bulb lots have lower yields and cause significant problems for bulb export and cut flower production. Besides cultivation practices and

  12. The Effect of Aquatic Plant Abundance on Shell Crushing Resistance in a Freshwater Snail

    Science.gov (United States)

    Chaves-Campos, Johel; Coghill, Lyndon M.; García de León, Francisco J.; Johnson, Steven G.

    2012-01-01

    Most of the shell material in snails is composed of calcium carbonate but the organic shell matrix determines the properties of calcium carbonate crystals. It has been shown that the deposition of calcium carbonate is affected by the ingestion of organic compounds. We hypothesize that organic compounds not synthesized by the snails are important for shell strength and must be obtained from the diet. We tested this idea indirectly by evaluating whether the abundance of the organic matter that snails eat is related to the strength of their shells. We measured shell crushing resistance in the snail Mexipyrgus churinceanus and the abundance of the most common aquatic macrophyte, the water lily Nymphaea ampla, in ten bodies of water in the valley of Cuatro Ciénegas, Mexico. We used stable isotopes to test the assumption that these snails feed on water lily organic matter. We also measured other factors that can affect crushing resistance, such as the density of crushing predators, snail density, water pH, and the concentration of calcium and phosphorus in the water. The isotope analysis suggested that snails assimilate water lily organic matter that is metabolized by sediment bacteria. The variable that best explained the variation in crushing resistance found among sites was the local abundance of water lilies. We propose that the local amount of water lily organic matter provides organic compounds important in shell biomineralization, thus determining crushing resistance. Hence, we propose that a third trophic level could be important in the coevolution of snail defensive traits and predatory structures. PMID:22970206

  13. Seasonal foraging responses of beavers to sodium-enhanced foods: An experimental assessment with field feeding trials

    Science.gov (United States)

    Strules, Jennifer; DeStefano, Stephen

    2015-01-01

    Salt drive is a seasonal phenomenon common to several classes of wild herbivores. Coincident with shifts of nutrient quality when plants resume growth in the spring, sodium is secondarily lost as surplus potassium is excreted. The beaver (Castor canadensis) is an herbivore whose dietary niche closely follows that of other herbivores that are subject to salt drive, but no published studies to date have assessed the likelihood of its occurrence. To quantify if beavers experience seasonal salt drive, we designed a field experiment to measure the foraging responses of beavers to sodium-enhanced foods. We used sodium-treated (salted) and control (no salt) food items (aspen [Populus tremuloides] and pine [Pinus spp.] sticks) during monthly feeding trials at beaver-occupied wetlands. If conventional ontogeny of salt drive was operant, we expected to observe greater utility of sodium-treated food items by beavers in May and June. Further, if water lilies (Nymphaea spp. and Nuphar spp.) supply beavers with sodium to meet dietary requirements as is widely speculated, we expected foraging responses to sodium-treated food items at wetlands where water lilies were absent to be greater than at wetlands where water lily was present. Aspen was selected by beavers in significantly greater amounts than pine. There was no difference between the mean percent consumed of salted and control aspen sticks by beavers at lily and non-lily wetlands, and no differences in temporal consumption associated with salted or control pine sticks at either wetland type. Salted pine was consumed in greater amounts than unsalted pine. We propose that the gastrointestinal or renal physiology of beavers may preclude solute loss, thereby preventing salt drive.

  14. Solid Electrolyte Interphase (SEI) at TiO2 Electrodes in Li-Ion Batteries: Defining Apparent and Effective SEI Based on Evidence from X-ray Photoemission Spectroscopy and Scanning Electrochemical Microscopy.

    Science.gov (United States)

    Ventosa, Edgar; Madej, Edyta; Zampardi, Giorgia; Mei, Bastian; Weide, Philipp; Antoni, Hendrik; La Mantia, Fabio; Muhler, Martin; Schuhmann, Wolfgang

    2017-01-25

    The high (de)lithiation potential of TiO2 (ca. 1.7 V vs Li/Li+ in 1 M Li+) decreases the voltage and, thus, the energy density of a corresponding Li-ion battery. On the other hand, it offers several advantages such as the (de)lithiation potential far from lithium deposition or absence of a solid electrolyte interphase (SEI). The latter is currently under controversial debate as several studies reported the presence of a SEI when operating TiO2 electrodes at potentials above 1.0 V vs Li/Li+. We investigate the formation of a SEI at anatase TiO2 electrodes by means of X-ray photoemission spectroscopy (XPS) and scanning electrochemical microscopy (SECM). The investigations were performed in different potential ranges, namely, during storage (without external polarization), between 3.0-2.0 V and 3.0-1.0 V vs Li/Li+, respectively. No SEI is formed when a completely dried and residues-free TiO2 electrode is cycled between 3.0 and 2.0 V vs Li/Li+. A SEI is detected by XPS in the case of samples stored for 6 weeks or cycled between 3.0 and 1.0 V vs Li/Li+. With use of SECM, it is verified that this SEI does not possess the electrically insulating character as expected for a "classic" SEI. Therefore, we propose the term apparent SEI for TiO2 electrodes to differentiate it from the protecting and effective SEI formed at graphite electrodes.

  15. Systematic Molecular Design of Ketone Derivatives of Aromatic Molecules for Lithium-Ion Batteries: First-Principles DFT Modeling.

    Science.gov (United States)

    Park, Jong Hoo; Liu, Tianyuan; Kim, Ki Chul; Lee, Seung Woo; Jang, Seung Soon

    2017-04-10

    The thermodynamic and electrochemical redox properties for a set of ketone derivatives of phenalenyl and anthracene have been investigated to assess their potential application for positive electrode materials in rechargeable lithium-ion batteries. Using first-principles DFT, it was found that 1) the thermodynamic stabilities of ketone derivatives are strongly dependent on the distribution of the carbonyl groups and 2) the redox potential is increased when increasing the number of the incorporated carbonyl groups. The highest values are 3.93 V versus Li/Li+ for the phenalenyl derivatives and 3.82 V versus Li/Li+ for the anthracene derivatives. It is further highlighted that the redox potential of an organic molecule is also strongly correlated with its spin state in the thermodynamically stable form. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Aquatic Plant/microbial Filters for Treating Septic Tank Effluent

    Science.gov (United States)

    Wolverton, B. C.

    1988-01-01

    The use of natural biological processes for treating many types of wastewater have been developed by NASA at the John C. Stennis Space Center, NSTL, Mississippi, during the past 15 years. The simplest form of this technology involves the use of aquatic plant/marsh filters for treatment of septic tank effluent. Septic tank effluent from single home units can be treated to advanced secondary levels and beyond by using a 37.2 sq m (400 sq ft) surface area washed gravel filter. This filter is generally 0.3 m (1 ft) deep with a surface cover of approximately 0.15 m (6 in.) of gravel. The plants in this filter are usually aesthetic or ornamental such as calla lily (Zantedeschia aethiopica), canna lily (Canna flaccida), elephant ear (Colocasia esculenta), and water iris (Iris pseudacorus).

  17. In vitro Propagation Techniques for Some Geophyte Ornamental Plants with High Economic Value

    Directory of Open Access Journals (Sweden)

    Arzu ÇIĞ

    2015-01-01

    Full Text Available Propagation of some ornamental plants has increased tremendously due to the demand for them as cut flowers, in addition to their usage for interior and exterior landscaping purposes. Geophytes (bulbous-tuberous are the most preferred group among the ornamental plants due to their aesthetic features, suitability to be cut flowers and their fragrance. These plants are highly propagated and consumed. The geophyte species which are highly profitable, globally traded and constituting 90% of the flower bulb market are Tulipa (tulip, Lilium (lily, Narcissus (daffodil, Gladiolus (gladioli, Iris (iris and Hyacinthus (hyacinth. In vitro propagation techniques, which provide disease-free mass production options, have started to be used increasingly to fulfil the demand for these species in the market. In this study, the results of in vitro propagation studies for some economically valuable tulip, lily, daffodil, gladiolus, iris and hyacinth species are provided.

  18. Cretaceous flowers of Nymphaeaceae and implications for complex insect entrapment pollination mechanisms in early angiosperms.

    Science.gov (United States)

    Gandolfo, M A; Nixon, K C; Crepet, W L

    2004-05-25

    Based on recent molecular systematics studies, the water lily lineage (Nymphaeales) provides an important key to understanding ancestral angiosperm morphology and is of considerable interest in the context of angiosperm origins. Therefore, the fossil record of Nymphaeales potentially provides evidence on both the timing and nature of diversification of one of the earliest clades of flowering plants. Recent fossil evidence of Turonian age (approximately 90 million years B.P.) includes fossil flowers with characters that, upon rigorous analysis, firmly place them within Nymphaeaceae. Unequivocally the oldest floral record of the Nymphaeales, these fossils are closely related to the modern Nymphaealean genera Victoria (the giant Amazon water lily) and Euryale. Although the fossils are much smaller than their modern relatives, the precise and dramatic correspondence between the fossil floral morphology and that of modern Victoria flowers suggests that beetle entrapment pollination was present in the earliest part of the Late Cretaceous.

  19. [Medicinal plants and symbols in the medieval mystic altarpiece].

    Science.gov (United States)

    Fischer, Louis-Paul; Verilhac, Régine; Ferrandis, Jean-Jacques; Trépardoux, Francis

    2011-01-01

    The medieval mystic altarpiece towers above the altar table. It is linked to the evocation of a religious mystery beyond our faculty of reasoning. Symbolism of an enclosed garden evokes the image of the Heavenly Garden isolated by a wall from the rest of earthly world. In this mystic chiefly Rhenan altarpiece the enclosed garden is that of Virgin Mary who in the Middle Ages was likened to the spouse in the song of songs. The Blessed Virgin is painted with flowers, lily, rose, violet, lily of the valley. Most of these are medicinal plants in order to implore a faith healing for the believers. All in all about fifty plants are showed on Rhenan altarpieces and on 14th century mystic altarpieces almost contemporary of Issenheim's altarpiece, some Italian, some Rhenan.

  20. Joint Maneuver Test Range on Eglin Air Force Base, Florida Final Environmental Assessment

    Science.gov (United States)

    2009-12-14

    Woodpecker Quercus laevis Turkey Oak Colinus virginianus Bobwhite Quail Q. marilandica Blackjack Oak Bubo virginianus Great Horned Owl Q. incana...floridanus Florida Black Bear Ilex vomitoria Yaupon Sciurus niger Fox Squirrel Ilex glabra Gallberry Cryptotis parva Least Shrew Licania michauxii Gopher...Heartleaf LT - Hymenocallis henryae Henry’s Spider Lily LE - Ilex amelanchier Serviceberry Holly LT - Juncus gymnocarpus Coville’s Rush LE - Kalmia

  1. The Subgenus Stegomyia of Aedes in the Afrotropical Region. 2. The Dendrophilus Group of Species (Diptera: Culicidae) (Contributions of the American Entomological Institute. Volume 29, Number 4, 1997)

    Science.gov (United States)

    1997-01-01

    tree forks, cut bamboos, leaf axils of Dracaena hookeriana, banana, pineapple , lily; bored bamboos, rot holes, stump holes, fern tree, bamboo stump...Antenna short, less than 0.5 length of head, without spicules; seta 1-A inserted in apical 0.5 of shaft, single; inner mouthbrushes apically pectinate ...92/617) [USNM]; same data except 27-V-1985, Huang & Pecor, leaf axils ( pineapple ), partially shaded, 3 M, 3 F, 6 individual rearings (4 1, 6 p) (SAMP

  2. Rewriting, Ideology, and Poetics in Goldblatt's Translation of Mo Yan's 天堂蒜薹之歌 (The Garlic Ballads)"

    OpenAIRE

    Du, Ping; Zhang, Lili

    2015-01-01

    In their article "Rewriting, Ideology, and Poetics in Goldblatt's Translation of Mo Yan's 天堂蒜薹之歌 (The Garlic Ballads)" Ping Du and Lili Zhang analyze Howard Goldblatt's translation of the novel in order to explore literary "rewriting" in translation. Du and Zhang posit that Goldblatt's translation reflects ideology in concealing, discarding, rewriting, and even losing some part in his translation. Further, they argue that the translation of the novel has beenperformed based on specific aspect...

  3. Phylogenomic Analyses of Echinodermata Support the Sister Groups of Asterozoa and Echinozoa

    OpenAIRE

    Reich, Adrian; Dunn, Casey; Akasaka, Koji; Wessel, Gary

    2015-01-01

    Echinoderms (sea urchins, sea stars, brittle stars, sea lilies and sea cucumbers) are a group of diverse organisms, second in number within deuterostome species to only the chordates. Echinoderms serve as excellent model systems for developmental biology due to their diverse developmental mechanisms, tractable laboratory use, and close phylogenetic distance to chordates. In addition, echinoderms are very well represented in the fossil record, including some larval features, making echinoderms...

  4. Epilepsia

    National Research Council Canada - National Science Library

    Beltran Felix, Geney

    2009-01-01

    ... por la epilepsia. La protagonista hace un recuento de su vida a partir de sus 30 anos, y en el se intercalan breves analepsis sobre su infancia en una familia disfuncional. Al comienzo, frente al cadaver fresco de la madre, Lily cree estar a salvo por fin de su enemiga. Pero la trama sugiere de que forma el pasado es tan categorico que ese fantasma --la voz materna-- ...

  5. Exploitation of Diversity for Morphological Traits in Lilium tsingtauense under Different Habitats

    OpenAIRE

    KiByung LIM; YOUNIS, Adnan; Jong TAEK PARK; Yoon JUNG HWANG

    2014-01-01

    In this study naturally growing morphological variation of Lilium tsingtauense (Korean wheel lily), from southern Chung San Island to northern Mount Seorak, was investigated in 16 habitats around the country. Morphological analysis revealed that this species had its own unique characteristics in different habitats. Flowers with luster are in actinomorphic form, with shades of orange, each plant having an average of 2.4 flowers that blossom upward. The shape of flower petals was from oval to o...

  6. La agroecología en el bachillerato técnico agropecuario del cantón Colta-provincia del Chimborazo.

    OpenAIRE

    Orozco González, Juan Manuel

    2015-01-01

    In this research we analyzed the situation of the Agroecology Agricultural Technical high schools from Canton Colta, Chimborazo Province, which today are called Intercultural Bilingual Education Units, those were: Intercultural Bilingual Education Unit Duchicela Shyri XII, from Community Llinllín at Columbe Parish; Intercultural Bilingual Education Unit Jacobo Yepez, from Community Guacona small at the Sicalpa Parish and Intercultural Bilingual Education Unit General Rumiñahui, Community Lily...

  7. Analisis Pengaruh Persepsi Teknologi, Persepsi Resiko terhadap Kepercayaan dan Dampaknya terhadap Kepuasan Belanja Online Mahasiswa di Pekanbaru

    OpenAIRE

    2014-01-01

    Analyze the influence of Perceived Technology, Perceived Risk Against Trust and Its Impact on Student Satisfaction in Online Shopping Pekanbaru under the guidance of Dr. Samsir, SE, M.Si and Dra. Hj. Lilis Sulistyowati, MM. The purpose of this study was to determine the effect of technology perception and the perception of risk in online trust and how trust-related online shopping satisfaction. This study also examines the impact of online trust in mediating the relationship between technolog...

  8. Lithium Insertion in LixMn2O4, 0

    DEFF Research Database (Denmark)

    West, Keld; Zachau-Christiansen, Birgit; Skaarup, Steen

    1996-01-01

    The electrochemical lithium insertion properties of highly crystalline LixMn2O4 are investigated in the approximate lithium insertion range 0 ... of the lithium insertion/extraction reactions is better at the higher voltages (versus Li/Li+), and particularly at the 4 V plateau. The lithium insertion/extraction reaction at the 1 V plateau although essentially reversible is associated with a significant voltage hysteresis....

  9. Transactional Distributed Shared Memory

    Science.gov (United States)

    1992-07-01

    consisted of Joshua Bloch, Dean Daniels, Richard Draves, Dan Duchamp , Jeffrey Eppinger, Elliot Jaffe, Toshihiko Kato, George Michaels, Lily Mummert, Randy...34 Non-blocking commit. The non-blocking commit protocol [LeLann 81, Duchamp 89] is a modification of two-phase commit to guarantee that at least one...Architecture, pages "*-442. IEEE, 1986. Computer Architecture News Volume 14 Number 2. [ Duchamp 89] Dan Duchamp . Transaction Management. PhD thesis, Carnegie

  10. Drug: D06774 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available rds for non-pharmacopoeial crude drugs Therapeutic category of drugs in Japan [BR:br08301] 5 Crude drugs and... Chinese medicine formulations 51 Crude drugs 510 Crude drugs 5100 Crude drugs D0...ss Cough suppressants and expectorants D06774 Fritillaria bulb Crude drugs [BR:br08305] Monocot plants Liliaceae (lily family) D06774 Fritillaria bulb PubChem: 47208425 ...

  11. Surgical video recording with a modified GoPro Hero 4 camera

    OpenAIRE

    Lin LK

    2016-01-01

    Lily Koo Lin Department of Ophthalmology and Vision Science, University of California, Davis Eye Center, Sacramento, CA, USA Background: Surgical videography can provide analytical self-examination for the surgeon, teaching opportunities for trainees, and allow for surgical case presentations. This study examined if a modified GoPro Hero 4 camera with a 25 mm lens could prove to be a cost-effective method of surgical videography with enough detail for oculoplastic and strabismus surgery. Me...

  12. Low-Level Laser Therapy in Russia: History, Science and Practice

    Science.gov (United States)

    Moskvin, Sergey Vladimirovich

    2017-01-01

    In Russia (formerly USSR) study of biomodulation action (BMA) mechanisms of low-intensity laser irradiation (LILI) began in 1964, immediately after the development of lasers. During the period from 1965 to 1972 several dozens of scientific conferences were held, hundreds of studies were published. Generally, secondary mechanisms and results of LILI effect on patients with various diseases were studied. This data was immediately implemented into practical medicine in the fields of oncology, surgery, dermatology and dentistry, and since 1974 low level laser therapy (LLLT) is included in the standard of state medical care. For 50 years no less than 1000 books were published (monographs, collections, methodical and clinical materials), thousands of researches were carried out. Primary mechanism and patterns of interaction of LILI with acceptors within cells can be represented in the following order: absorption of photon’s energy – emergence of a local temperature gradient – release of Ca2+ from intracellular stores – stimulating Ca2+–dependent processes. Understanding of this process allowed the explanation of all known secondary effects, optimized methods and extremely increased effectiveness of LLLT. Owing to the knowledge of BMA mechanisms of LILI, numerous associated and combined LLLT techniques were developed and are widely used nowadays: locally, on the projection of internal organs, laser acupuncture, reflexology, intracavitary, transdermal and intravenous laser blood illumination, magnetic-laser therapy, laser phoresis, laser-vacuum massage, biomodulation, etc. About 400 000 laser therapeutic devices are used in Russian practical healthcare. Unique, having no analogues in the world devices, are produced – red pulsed laser diodes (wavelength 635 nm, power 5-40 W, pulse duration 100 ns, frequency 10 000 Hz) are designed specially for effective laser therapy. PMID:28652897

  13. Soil-to-plant transfer of uranium and its distribution between plant parts in boreal forest; Forests ecosystems

    Energy Technology Data Exchange (ETDEWEB)

    Roivainen, P.; Makkonen, S.; Holopainen, T.; Juutilainen, J. (Univ. of Kuopio, Dept. of Environmental Science, Kuopio (Finland))

    2009-06-15

    This study focused on investigating the soil-to-plant transfers of natural uranium and its distribution in the vegetative parts of four plant species representing different plant types common in boreal forest: May lily (Maianthemum bifolium), narrow buckler fern (Dryopteris carthusiana), rowan (Sorbus aucuparia) and spruce (Picea abies). The results were also used to assess concentration ratios between soil and different plant parts. (LN)

  14. The College of Podiatry Annual Conference 2015: meeting abstracts

    OpenAIRE

    Tong, Jasper W. K.; Kong, Veni P.; Sze, Lily; Gale, Susie; Veto, John; Tunprasert, Thanaporn; Bradley, Victoria; Strike, Siobhan; Ashford, Robert; Naemi, Roozbeth; Chocklingam, Nachiappan; de Blasc, Xavi; Robinson, Vicki; Nicholls, Emily; Birch, Tabitha

    2016-01-01

    Table of content P3 Medial longitudinal arch development of school children Jasper W.K. Tong, Veni P. Kong P4 Is measuring the subtalar joint reliable? Lily Sze, Susie Gale, John Veto, Carla McArdle P5 Comparison of turning gait biomechanics between able-bodied and unilateral transtibial amputee participants Thanaporn Tunprasert, Victoria Bradley, Siobhan Strike P6 Comparison of walking gait biomechanics between able-bodied and unilateral transtibial amputee participants using a new model of ...

  15. Detsibill : Haige uudishimu. White label : Uma kiilsed mihed. Kuula / DJ Pickney Tiger

    Index Scriptorium Estoniae

    DJ Pickney Tiger, pseud., 1970-

    2006-01-01

    "Kollasest" ajakirjandusest. Heliplaadist Ilves, Pulk & Rahman "Murõt ei olõ". Heliplaatidest: Ro:Toro "Estonian Bagpipe", Tool "10.000days", Rise Against "The sufferer and the witness", "Hi Top Sampler: Fresh from Spain, Spain is Different. Vol 2", Lily Allen "Alright, Still", Stupid F "Nostalgilised helid", Los De Abajo "Los de Abajo vs. The Lunatics", Nuyorican Soul "Nuyorican Soul", Zutons "Tired of Hanging Araound", Razorlight "Razorlight", Ministry Of Sound "Dance Nation"

  16. AcEST: DK945786 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4 tr|Q9G2W3|Q9G2W3_MAGSO Ribosomal protein S13 OS=Magnolia soulang... 114 2e-24 tr|Q85IK7|Q85IK7_9ASPA Ribosomal protein S13 OS=Frees...ia sp. QC-2... 114 2e-24 tr|Q8HQ63|Q8HQ63_9LILI Ribosomal protein S13 OS=Alstroemer

  17. Conservation and canalization of gene expression during angiosperm diversification accompany the origin and evolution of the flower

    OpenAIRE

    Chanderbali, André S.; Yoo, Mi-Jeong; Zahn, Laura M; Brockington, Samuel F.; Wall, P Kerr; Gitzendanner, Matthew A.; Albert, Victor A; Leebens-Mack, James; Altman, Naomi S.; Ma, Hong; dePamphilis, Claude W; Soltis, Douglas E.; Pamela S Soltis

    2010-01-01

    The origin and rapid diversification of the angiosperms (Darwin's “Abominable Mystery”) has engaged generations of researchers. Here, we examine the floral genetic programs of phylogenetically pivotal angiosperms (water lily, avocado, California poppy, and Arabidopsis) and a nonflowering seed plant (a cycad) to obtain insight into the origin and subsequent evolution of the flower. Transcriptional cascades with broadly overlapping spatial domains, resembling the hypothesized ancestral gymnospe...

  18. Development of non-effervescent floating matrix tablets based on Euryale ferox seeds

    OpenAIRE

    Jeetendra Singh Negi; Vandana Jugran; Nikhil Kasliwal

    2011-01-01

    Euryale ferox (family Nymphaeaceae), a plant belonging to the water lily family, grows in water ponds and remains buoyant on water surface. Similarly, its edible seeds also remain afloat in a wide variety of liquid mediums. Thus, the purpose of this study was to develop non-effervescent floating matrix tablets using E. ferox seeds powder (EFSP). Different matrix tablets were prepared using hydroxy propyl methyl cellulose (HPMC) K4M, ciprofloxacin HCl and EFSP. The effects of various formulati...

  19. Molecular cloning and characterization of a pathogen- related ...

    African Journals Online (AJOL)

    ajl yemi

    2011-12-26

    Dec 26, 2011 ... induced by armyworm-feeding and we suppose that. CcPR10 may be involved in pyrethrum resistance to insect herbivore. In the present study, it was found that CcPR10 gene was rapidly induced by JA treatment. The lily PR10 genes are induced by methyl jasmonate (MeJA) in the anther and various other ...

  20. Blooming Knit Flowers: Loop-Linked Soft Morphing Structures for Soft Robotics.

    Science.gov (United States)

    Han, Min-Woo; Ahn, Sung-Hoon

    2017-04-01

    A loop-linked structure, which is capable of morphing in various modes, including volumetric transformation, is developed based on knitting methods. Morphing flowers (a lily-like, a daffodil-like, gamopetalous, and a calla-like flower) are fabricated using loop patterning, and their blooming motion is demonstrated by controlling a current that selectively actuates the flowers petals. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. African Journal of Biotechnology - Vol 10, No 68 (2011)

    African Journals Online (AJOL)

    Transformation of trehalose synthase gene (TPS Gene) into corn inbred line and identification of drought tolerance · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Chun-lin, Z Ming-yi, Z Yan-qin, Y Li-li, L Gai-mei, S Jie, L Zhong-ping, G Jjian-fang, 15253-15258 ...

  2. Treatment of adults with attention-deficit/hyperactivity disorder

    OpenAIRE

    Hechtman, Lily

    2008-01-01

    Dusan Kolar, Amanda Keller, Maria Golfinopoulos, Lucy Cumyn, Cassidy Syer, Lily HechtmanDepartment of Psychiatry, Montreal Children’s Hospital, McGill University, Montreal, CanadaAbstract: This review focuses on the treatment of attention deficit hyperactivity disorder (ADHD) in adults. It briefly addresses prevalence, diagnostic and differential diagnostic issues specific to adults. Stimulant medication, non-stimulant medication, and psychosocial treatments are thoroughly reviewed....

  3. Beyond New Waves: Gender and Sexuality in Sinophone Women's Cinema from the 1980s to the 2000s

    OpenAIRE

    Kang, Kai

    2015-01-01

    My dissertation bridges Chinese film studies, Sinophone studies, transnational feminism, and gender and sexuality studies through a comparative study of women's cinema in post-1976 China, post-1984 Hong Kong, and post-1987 Taiwan.In my dissertation, I examine five Sinophone women's films--Huang Shuqin's Woman, Demon, Human (1987), Li Yu's Fish and Elephant (2001), Zero Chou's Spider Lilies (2007), Ann Hui's Song of the Exile (1990), and Mabel Cheung's The Soong Sisters (1997). I investigate ...

  4. Browse Author Index - African Journals Online

    African Journals Online (AJOL)

    Items 1 - 32 of 32 ... A B C D E F G H I J K L M N O P Q R S T U V W X Y Z All. F. Fabian, Flora · Fagbemissi, Rose C · Fakande, Ibiyemi · Fantahun, Mesganaw · Fassin, Didier · Feldblum, Paul J · Ferreira, Ronél · Ferrer, Stuart RD · Ferrer, Stuart · Fiagbey, Emmanuel · Fidzani, Lily Clara · Fielding-Miller, Rebecca · Fieno, John

  5. The Ismail Center Hypertension Program: Application of Medical Nutrition Therapy

    OpenAIRE

    Darbishire, Lily

    2016-01-01

    Lily Darbishire is a registered dietitian nutritionist and graduate student at Missouri State University completing a master’s degree in public health. During her senior year in the dietetics program at Purdue University, Darbishire was involved in a service-learning–based hypertension clinic focusing on medical nutrition therapy. This article outlines her experiences and what she learned as a result of completing the program.

  6. Significant improvement of electrochemical performance of Cu ...

    Indian Academy of Sciences (India)

    rial due to its environmental safety, long life cycle and high energy density. It is isostructural with the naturally-occurring mineral tavorite, LiFePO4·OH or ambylgonite, LiAlPO4F and crystallizes with a triclinic structure (space group P).5 Besides, it has a relatively high potential of 4.2V (vs. Li+/Li) and a theoretical capacity of ...

  7. Breeding for resistance to Fusarium oxysporum in flower bulbs

    OpenAIRE

    Straathof, Th.P.; Löffler, H.J.M.; Linfield, C.A.; Roebroeck, E.J.A.

    1997-01-01

    Cultivation of the major flower bulb crops, e.g., lily, narcissus, gladiolus and tulip, is threatened by the soil-borne fungus Fusarium oxysporum. Fusarium infected bulb lots have lower yields and cause significant problems for bulb export and cut flower production. Besides cultivation practices and chemical protection, resistant cultivars can play an important role in preventing this disease. To breed Fusarium resistant cultivars, screening and selection tests have to be developed and geneti...

  8. Interface modifications by anion receptors for high energy lithium ion batteries

    Science.gov (United States)

    Zheng, Jianming; Xiao, Jie; Gu, Meng; Zuo, Pengjian; Wang, Chongmin; Zhang, Ji-Guang

    2014-03-01

    Li-rich, Mn-rich (LMR) layered composite has attracted extensive interests because of its highest energy density among all cathode candidates for lithium ion batteries (LIB). However, capacity degradation and voltage fading remain the major challenges for LMR cathodes prior to their practical applications. Here, we demonstrate that anion receptor, tris(pentafluorophenyl)borane ((C6F5)3B, TPFPB), substantially enhances the stability of electrode/electrolyte interface and thus improves the cycling stability of LMR cathode Li[Li0.2Ni0.2Mn0.6]O2. In the presence of 0.2 M TPFPB, Li[Li0.2Ni0.2Mn0.6]O2 shows an improved capacity retention of 76.8% after 500 cycles. It is proposed that TPFPB effectively confines the highly active oxygen species released from structural lattice through its strong coordination ability and high oxygen solubility. The electrolyte decomposition caused by the oxygen species attack is therefore largely mitigated, forming reduced amount of byproducts on the cathode surface. Additionally, other salts such as insulating LiF derived from electrolyte decomposition are also soluble in the presence of TPFPB. The collective effects of TPFPB mitigate the accumulation of parasitic reaction products and stabilize the interfacial resistances between cathode and electrolyte during extended cycling, thus significantly improving the cycling performance of Li[Li0.2Ni0.2Mn0.6]O2.

  9. Investigation of carbon-coated silicon oxide phase changes during charge/discharge by oxygen and lithium K-Edge X-ray absorption fine structure spectroscopy

    Science.gov (United States)

    Hirose, Takakazu; Morishita, Masanori; Yoshitake, Hideya; Sakai, Tetsuo

    2018-01-01

    To understand the phase changes associated with the charge/discharge mechanism during cycling, we evaluated the electronic states of oxygen and lithium atoms in the high-capacity anode material SiO-C using O and Li K-edge X-ray absorption fine structure (XAFS) spectroscopy. Multiple peaks observed in the O K-edge spectrum in the 532-548 eV range were likely related to Osbnd Si bonds. During the initial charge, when SiO-C occludes Li, a new peak related to Lisbnd O bonds appeared at 534 eV. During the initial discharge, this peak was maintained at potentials below 0.7 V vs. Li/Li+, but decreased at higher potentials, suggesting the presence of a phase change point near 0.7 V vs. Li/Li+. This change was also supported by the Li K-edge spectrum. An examination of the phase change after charge/discharge cycling at negative electrode termination potentials of 0.66 and 1.1 V vs. Li/Li+ confirmed that the phase structure was stable when cycling at potentials below the phase change point, but unstable at higher potentials. Thus, stable charge/discharge cycling can be achieved by designing batteries with negative electrode termination potentials that are lower than the potential at which the phase change occurs.

  10. Electrochemical behaviour of aluminium in non-aqueous electrolytes over a wide potential range

    Science.gov (United States)

    Suresh, P.; Shukla, A. K.; Shivashankar, S. A.; Munichandraiah, N.

    The electrochemical behaviour of aluminium in LiClO 4-propylene carbonate electrolyte is studied by cyclic voltammetry, steady-state polarisation, and ac impedance spectroscopy in the potential range -0.4-4.2 V versus Li/Li +. The open-circuit potential of Al is 1.57 V versus Li/Li +, which is about 0.2 V above the thermodynamic value of Al due to the presence of a surface passive film. In the positive potential region, Al is fairly stable between 1.57 and 3.5 V versus Li/Li + owing to the presence of the surface film. Nevertheless, the oxidation of Al occurs at potentials >3.5 V versus Li/Li +. The ac impedance data are analysed by using a non-linear least-squares fitting procedure, and the surface film resistance is found to be between 498 and 1032 kΩ cm -2. In the potential range 3.6-4.2 V versus Li/Li +, there is a breakdown of the passive film as demonstrated by a decrease in its resistance to 1.2-4.8 kΩ cm -2. This breakdown accompanies anodic oxidation of Al. Thus, there is a possibility of anodic degradation of the Al substrate that is usually used as the current-collector of positive electrodes of Li-ion batteries, if Al is exposed to the electrolyte. In the negative potential region, the deposition of uniform and non-dendritic Li occurs, which can be anodically stripped in a quasi-reversible process with high coulombic efficiency. Diffusion of Li into Al results in the formation of a surface layer of Li-Al alloy, as suggested by X-ray diffraction patterns. The quasi-reversible cathodic deposition and anodic stripping of Li with an exchange current density of 0.16 mA cm -2 indicates that Al is useful as a negative electrode in Li-batteries.

  11. Kulinārais diskurss un tā tulkošanas aspekti

    OpenAIRE

    Ļuļe, Zane

    2013-01-01

    21. gadsimtā vairāk nekā jebkad vēsturē uzmanība tiek pievērsta kulināriskajam dzīvesveidam, gastronomijas dažādiem aspektiem. Taču valodniecībā nozare vēl nav tik detalizēti un sistemātiski pētīta, lai varētu runāt par vienotiem principiem, pieejamiem leksikogrāfiskajiem avotiem un priekšrocībām šaurās un specifiskās nozares tulkošanā. Maģistra darbā „Kulinārais diskurss un tā tulkošanas aspekti” pētītas nozares un kulinārā diskursa īpatnības, analizējot teoriju un valodas lietojumu recepšu ...

  12. No platformas neatkarīgu mobilo lietotņu izstrāde ar rīku Apache Cordova

    OpenAIRE

    Zīmecs, Kristers

    2015-01-01

    Lai ar mobilo lietotņu palīdzību piesaistītu lielāku lietotāju skaitu, izstrādātājiem ir jāapgūst vairākas programmēšanas valodas un izstrādes vides. Apache Cordova projekts ir viens no populārākajiem no platformas neatkarīgu lietotņu izstrādes rīkiem un ļauj izstrādātājiem izstrādāt mobilās lietotnes vairākām mobilajām platformām, izmantojot plaši pielietotas tīmekļa tehnoloģijas – HTML, CSS un JavaScript. Galvenais darba mērķis ir izpētīt rīka Apache Cordova piedāvātās iespējas, noskaidr...

  13. Tekstuālās atšķirības dažādos Kurta Vonnegūta romāna "Kaķa šūpulis" tulkojuma izdevumos

    OpenAIRE

    Soprovska, Sigita

    2007-01-01

    Pētījuma “Tekstuālās atšķirības dažādos Kurta Vonnegūta romāna “Kaķa šūpulis” tulkojuma izdevumos” teorētiskajā daļā sniegts ieskats K. Vonnegūta un divu tulkojumu izdevumu tulkotāju profesionālajā darbībā, noskaidroti daiļliteratūras tulkošanas principi un abu izdevuma laiku valodas normas, kas attiecas uz analizējamo materiālu. Pētījuma praktiskajā daļā analizētas 210 vienības, kas iedalītas četrās grupās pēc tulkojuma atšķirībām abos izdevumos – leksēmu aizstāšana, nozīmes maiņa, sintaktis...

  14. Vu un šamanisko elementu loma Šan dinastijas (ap 1600.-1046.g. p.m.ē.) reliģiskajā sistēmā

    OpenAIRE

    Kaļimana, Tatjana

    2014-01-01

    Maģistra darbs “Vu un šamanisko elementu loma Šan dinastijas (ap 1600.–1046. g. p.m.ē.) reliģiskajā sistēmā” ir veltīts Šan dinastijas vu, viņu rituāliem un nozīmei Šan dinastijas laikā. Vu ir ķīniešu valodas termins, kas zinātniskajā literatūrā parasti tiek tulkots kā “šamanis”, kaut arī pētnieku starpā vienprātības šajā jautājumā nav. Šī darba mērķis, pirmkārt, ir noskaidrot, kas ir šamanisms un kādas ir tā klasiskās formas pamatpazīmes, un, otrkārt, izprast Šan dinastijas reliģiskās si...

  15. Vizuālā naratīva loma Džana Imou un Anga Lī wuxia filmu satura veidošanā

    OpenAIRE

    Volkova, Darja

    2016-01-01

    Bakalaura darba tēma ir “Vizuālā naratīva loma Džana Imou un Anga Lī wuxia filmu satura veidošanā”. Darbs ietver filmu “Tīģeris un Drakons” (“Crouching Tiger, Hidden Dragon”, 2000), “Varonis” (“Hero”, 2002) un “Lidojošo dunču nams” (“House of Flying Daggers”, 2004) analīzi ar mērķi noskaidrot wuxia žanra unikālo stilu, tā elementu pielietojumu uz ekrāna, kā arī vizuālā naratīva un kino valodas kopējās un atšķirīgās iezīmes pētāmo filmu satura veidošanā. Darba teorētiskajā daļā tiek sīkāk ...

  16. Kļūdu analīze Latvijas pilsētu tīmekļa vietņu tulkojumos vācu valodā

    OpenAIRE

    Surova, Jevgeņija

    2015-01-01

    Maģistra darba „Kļūdu analīze Latvijas pilsētu tīmekļa vietņu tulkojumos vācu valodā” mērķis ir sniegt ieguldījumu tūrisma jomas tekstu tulkošanas uzlabošanā, kā arī izstrādāt ieteikumus tūrisma tekstu tulkotājiem svešvalodā, norādot uz būtiskākajām kļūdām jeb nepilnībām. Šī mērķa sasniegšanai tika izvēlētas 10 Latvijas pilsētu un citas ar tūrismu saistītas tīmekļa vietnes, kuras pieejamas arī vācu valodā. Tulkojumi vācu valodā tika vērtēti un analizēti no vairākiem valodas un tulkošanas aspe...

  17. Publiskās runas prasmju mācīšana pieaugušajiem

    OpenAIRE

    Jansone, Diana

    2016-01-01

    Publiskā runa tiek uzskatīta par visnozīmīgāko valodas aspektu. Turklāt, publiskā runa ir ļoti sarežģīts process, jo tas prasa spēju sazināties gan mutiski, gan neverbāli, tādēļ attīstīt publiskās runas iemaņas ir ļoti svarīgi. Ir dažādas mācību tehnikas, metodes, teorijas un uzdevumi, kuras var tikt izmantotas, lai attīstītu publiskās runas iemaņas. Šī maģistra darba mērķis bija izpētīt īpatnības runas iemaņu pasniegšanā pieaugušajiem, kā arī analizēt komunikatīvās pieejas teorijas un rast e...

  18. Īpašības vārdu un emocijzīmju lietojums mikrobloga vietnes twitter.com ziņojumos

    OpenAIRE

    Šteina, Monta

    2017-01-01

    Šis bakalaura darbs ir veltīts īpašības vārdu un emocijzīmju lietojuma analīzei mikrobloga vietnes twitter.com ziņojumos. Pētījuma mērķis ir konstatēt, vai twitter.com lietotāji mēdz papildināt vai aizstāt īpašības vārdus ar emocijzīmēm, izpaužot domas, jūtas un emocijas. Pētījuma teorētiskā daļa sniedz ieskatu literatūrā par mutvārdu un rakstvieda saziņu, valodas funkcijām, emocijām, īpašības vārdiem, un valodu internetā, it īpaši mikrobloga vietnēs un twitter.com, turpretim empīriskajā daļā...

  19. Sociālie mēdiji un jaunvārdu rašanās angļu valodā

    OpenAIRE

    Lapsiņa, Liene

    2012-01-01

    Pēdējā laikā sociālie mēdiji ir kļuvuši par svarīgu aspektu saziņas procesā. Augošā sociālo mēdiju popularitāte ir ne tikai mainījusi daudzus cilvēku ieradumus, bet arī ikdienā pielietojamo vārdu krājumu – angļu valodā tiek ieviests daudz tehnisku terminu un vārdkopu, kas apzīmē tikai sociālo mēdiju mājaslapās pieejamus jēdzienus. Izmaiņas angļu valodas leksikā, kas radušās sociālo mēdiju ietekmē, padziļināti ir pētījis D. Kristals (Crystal, 2011). Tomēr, netiek piedāvāta detalizēta ar sociāl...

  20. Ģenētiskās inženierijas terminoloģija

    OpenAIRE

    Ālmane, Ieva

    2010-01-01

    Diplomdarba „Ģenētiskās inženierijas terminoloģija” mērķis ir izpētīt terminoloģijas teorētiskos pamatus, kā arī aprakstīt un analizēt esošo latviešu valodas ģenētiskās inženierijas terminoloģiju, balstoties uz terminiem no dažādiem tekstiem. Izmantotās metodes ir teorijas izpēte, terminu glosārija izveide un atrastā materiāla analīze. Diplomdarbs sastāv no trīs nodaļām, un tajās aplūkota terminoloģija kā nozare dažādos tās aspektos un kā nozares terminu kopums, terminoloģijas infrastruktūra ...

  1. JavaScript tīmekļa lietojumprogrammu optimizēšana augstas veiktspējas sasniegšanai

    OpenAIRE

    Jegermanis, Žanis

    2012-01-01

    Bakalaura darbs dod priekšstatu par to, kas ir JavaScript valoda, kāpēc JavaScript lietojumi ir jāoptimizē un kā tās var optimizēt augstas veiktspējas sasniegšanai. Darba teorētiskajā daļā tiek paskaidrota JavaScript lietojumu optimizācijas nozīme, kā arī galvenās optimizēšanas iespējas. Tiek izklāstīts, kā un ar kādiem paņēmieniem labāk optimizēt JavaScript lietojumus. Darba prakstiskajā daļā tiek optimizēta autora izstrādāta, izstrādes procesā esoša “Top-down shooter” spēle JavaScript...

  2. Designing living walls for greywater treatment.

    Science.gov (United States)

    Fowdar, Harsha S; Hatt, Belinda E; Breen, Peter; Cook, Perran L M; Deletic, Ana

    2017-03-01

    Greywater is being increasingly used as an alternative water source to reduce potable water demand and to alleviate pressure on sewerage systems. This paper presents the development of a low energy and low maintenance greywater treatment technology: a living wall system, employing ornamental plants (including vines) grown in a sand filter on a side of a building to treat shower, bath, and washing basin wastewaters. The system can, at the same time, provide critical amenity and micro-climate benefits to our cities. A large scale column study was conducted in Melbourne, Australia, to investigate the following design and operational factors of the proposed system: plant species, saturated zone design, rest period, hydraulic loading rate and pollutant inflow concentration. The results indicate that the use of ornamental species (e.g. Canna lilies, Lonicera japonica, ornamental grape vine) can contribute to pollutant removal. Vegetation selection was found to be particularly important for nutrient removal. While a wider range of tested plant species was effective for nitrogen removal (>80%), phosphorus removal was more variable (-13% to 99%) over the study period, with only a few tested plants being effective - Carex appressa and Canna lilies were the best performers. It was also found that phosphorus removal can be compromised over the longer term as a result of leaching. Excellent suspended solids and organics removal efficiencies can be generally achieved in these systems (>80% for TSS and >90% for BOD) with plants having a relatively small impact. Columns had an acceptable infiltration capacity after one year of operation. When planted with effective species (e.g. Carex appressa and Canna lilies), it is expected that performance will not be significantly affected by longer rest periods and higher pollutant concentrations in the early years of system operation. The results of this study, thus, demonstrate that innovative and aesthetically pleasing living walls can be

  3. Experimental forensic studies of the preservation of pollen in vehicle fires.

    Science.gov (United States)

    Morgan, R M; Flynn, J; Sena, V; Bull, P A

    2014-03-01

    The implications of the recent recommendations of the Law Commission regarding the use of admissibility tests have the potential to be far reaching for forensic disciplines that rely on the expertise of highly qualified expert witnesses. These disciplines will need a concomitant body of peer-reviewed experiments that provides a basis for the interpretations of such evidence presented in court. This paper therefore, presents such results from two experiments which were undertaken to address specific issues that were raised in cases presented in the British courtroom. These studies demonstrate that there is a variability in the persistence of Lily, Daffodil and Tulip pollen when exposed to high temperatures between 0.5min and 1440min (24h). It was possible to identify all three pollen types after 30min of exposure to 400°C, and after shorter time frames the threshold for successful identification was 700°C after 0.5min for all pollen types tested and 500°C for Daffodil and Lily after 5min of heat exposure. Over longer time periods (18h (1080min)) the different pollen types were found to persist in a viable form for identification at 300°C (Lily), 200°C (Daffodil) and 50°C (Tulip). These findings, albeit from a small sample of pollen types, provide empirical contextual information that would contribute to such evidence having sufficient scientific weight to meet admissibility criteria and be viable evidence for a court. These studies demonstrate the value in seeking pollen evidence from even such extreme crime scenes as encountered in vehicular fires. Copyright © 2013 Forensic Science Society. Published by Elsevier Ireland Ltd. All rights reserved.

  4. Decorative values and the nutritional status of some Magnolia species under the climatic conditions of Lublin (Poland. Part II. Evaluation of the nutritional status of the plants

    Directory of Open Access Journals (Sweden)

    Zenia Michałojć

    2012-10-01

    Full Text Available The present study was conducted on six Magnolia species in the period 2006-2008 in the Botanical Garden of the Maria Curie-Skłodowska University in Lublin. The soil and leaves from the locations of the following species of Magnolia were subjected to evaluation: cucumber tree (Magnolia acuminata L., Kobushi magnolia (Magnolia kobus DC, purple lily magnolia (Magnolia liliiflora L., Japanese willow-leaf magnolia (Magnolia salicifolia Siebold et Zucc. Maxim., saucer magnolia (Magnolia x soulangiana Soul.-Bod., and umbrella magnolia (Magnolia tripetala L.. The studied plants were planted during the period 1968-1989 on grey-brown podzolic soil derived from loess. The significantly lowest content of phosphorus, potassium and magnesium as well as the lowest pH were recorded in the soil from the location occupied by the purple lily magnolia (M. liliiflora. The other sites were characterized by an optimal range of pH, high soil phosphorus and magnesium availability as well as medium potassium availability. An optimal content of nitrogen and calcium was found in the leaves of the cucumber tree (M. acuminata, of phosphorus and magnesium in the leaves of the Kobushi magnolia (M. kobus, and of potassium in the leaves of the Japanese willow-leaf magnolia (M. salicifolia. A low content of nitrogen and calcium was shown in the leaves of the purple lily magnolia (M. liliiflora, of phosphorus in the leaves of the saucer magnolia (M. x soulangiana, and of potassium in the indicator parts of the cucumber tree (M. acuminata. The study found that among the studied species the cucumber tree (M. acuminata could be a good biostabilizer of nitrogen, while the Kobushi magnolia (M. kobus a good biostabilizer of phosphorus and magnesium. In spite of significant differences in soil nutrient availability and clear variations in macronutrient contents in the indicator parts of the investigated plants, no visual symptoms of nutrient deficit were found in the Magnolia species

  5. Cu2Sb thin film electrodes prepared by pulsed laser deposition f or lithium batteries

    Energy Technology Data Exchange (ETDEWEB)

    Song, Seung-Wan; Reade, Ronald P.; Cairns, Elton J.; Vaughey, Jack T.; Thackeray, Michael M.; Striebel, Kathryn A.

    2003-08-01

    Thin films of Cu2Sb, prepared on stainless steel and copper substrates with a pulsed laser deposition technique at room temperature, have been evaluated as electrodes in lithium cells. The electrodes operate by a lithium insertion/copper extrusion reaction mechanism, the reversibility of which is superior when copper substrates are used, particularly when electrochemical cycling is restricted to the voltage range 0.65-1.4 V vs. Li/Li+. The superior performance of Cu2Sb films on copper is attributed to the more active participation of the extruded copper in the functioning of the electrode. The continual and extensive extrusion of copper on cycling the cells leads to the isolation of Li3Sb particles and a consequent formation of Sb. Improved cycling stability of both types of electrodes was obtained when cells were cycled between 0.65 and 1.4 V. A low-capacity lithium-ion cell with Cu2Sb and LiNi0.8Co0.15Al0.05O2 electrodes, laminated from powders, shows excellent cycling stability over the voltage range 3.15 - 2.2 V, the potential difference corresponding to approximately 0.65-1.4 V for the Cu2Sb electrode vs. Li/Li+. Chemical self-discharge of lithiated Cu2Sb electrodes by reaction with the electrolyte was severe when cells were allowed to relax on open circuit after reaching a lower voltage limit of 0.1 V. The solid electrolyte interphase (SEI) layer formed on Cu2Sb electrodes after cells had been cycled between 1.4 and 0.65 V vs. Li/Li+ was characterized by Fourier-transform infrared spectroscopy; the SEI layer contributes to the large irreversible capacity loss on the initial cycle of these cells. The data contribute to a better understanding of the electrochemical behavior of intermetallic electrodes in rechargeable lithium batteries.

  6. Arabinogalactan proteins, pollen tube growth, and the reversible effects of Yariv phenylglycoside.

    Science.gov (United States)

    Mollet, Jean-Claude; Kim, Sunran; Jauh, Guang-Yuh; Lord, Elizabeth M

    2002-02-01

    Arabinogalactan proteins (AGPs) are abundant complex macromolecules involved in both reproductive and vegetative plant growth. They are secreted at pollen tube tips in Lilium longiflorum. Here, we report the effect of the (beta-D-glucosyl)3 Yariv phenylglycoside, known to interact with AGPs, on pollen tube extension in several plant species. In Annona cherimola the Yariv reagent clearly inhibited pollen tube extension within 1-2 h of treatment, as demonstrated previously for L. longiflorum, but had no effect on Lycopersicon pimpinellifolium, Aquilegia eximia, and Nicotiana tabacum. With the monoclonal antibody JIM13 we also examined these same species for evidence that they secreted AGPs at their pollen tube tips. Only A. cherimola showed evidence of AGPs at the pollen tube tip as does lily. The Yariv reagent causes arrest of tube growth in both A. cherimola and lily, but its removal from the medium allows regeneration of new tip growth in both species. We show that the site of the new emerging tip in lily can be predicted by localization of AGP secretion. Labeling with JIM13 appeared on the flanks of the arrested tip 1 h after removal of the Yariv reagent from the growth medium. After 4 h, many of the Yariv reagent-treated pollen tubes had regenerated new pollen tubes with the tips brightly labeled by JIM13 and with a collar of AGPs left at the emergence site. During this recovery, esterified pectins colocalized with AGPs. Secretion at the site of the new tip may be important in the initial polarization event that occurs on the flanks of the arrested tube tip and results in a new pollen tube.

  7. Celebrity witnessing

    DEFF Research Database (Denmark)

    Christiansen, Lene Bull; Frello, Birgitta

    2016-01-01

    This article deals with emotional address in the narrative modality of celebrity witnessing in the marketing of development aid. We analyse Danish celebrity narratives of global caring, drawing on Luc Boltanski’s work on a ‘politics of pity’, Lilie Chouliaraki’s notion of the ‘aspirational...... the spectator in alternative ways, thus creating space for alternative types of emotional engagement. The analysis demonstrates that the narrative modality of celebrity witnessing is more flexible than what is usually presumed, since it enables different completions and can be pried open for articulations...

  8. CHRIS. Response Methods Handbook.

    Science.gov (United States)

    1978-12-01

    kt\\ reseiL nted l tilec lOul(%II1 ilLcs. 5.10.1 Federal Sources (a) F/1t I)()(111iiw (4 IX’ t’t -lIlis a11ilo.’s canI prO\\idL’ iil itarv ay~istaiicc...f’rom this sotiree. Many states have also employecd marinec biologists and oceanograiphers whio havec become erv familiari with the marine eonldit ions...habits and care of birds and waterfowl. They may be found by contacting agencies, such as - * U.S. Sport Fisheries and Wildlife Service " State Fish

  9. Diversidad floristica de las lomas de Lachay (Lima durante el evento "El Niño 1997-98"

    Directory of Open Access Journals (Sweden)

    Asunción Cano Cano

    2014-06-01

    Full Text Available Se ha registrado un total de 146 especies de plantas vasculares, agrupadas en 124 géneros y 52 familias, entre agosto de 1997 y diciembre de 1998. Las magnoliópsidas (dicotiledóneas fueron el grupo dominante con 115 especies, 96 géneros y42 familias. Las liliópsidas (monocotiledóneas estuvieron representadas por 28 especies, 26 géneros y 8 familias. No se registró gimnospermas. Los pteridófitos estuvieron representados por tres especies. Las familias más representativas fueron Asteraceae con 19 especies, Poaceae con 16 y Solanaceae con 13.

  10. Hana-Densetsu Recognition of the Beauty of Life on Our Planet

    Science.gov (United States)

    Hasegawa, Yoichi; Tomita-Yokotani, Kaori; Yamashita, Masamichi

    HANA-densetsu is a new challenge of space utilization which creates unique values not only science but in culture and education fields. Cherry, Lily and Violet seeds, including natural treasures were carefully selected from many part of Japan. Those seeds had fulfilled eight months space journey on the ISS on behalf of children who picked them. It gave chance for many children to participate in a genuine space project by collecting flower seeds. Some parts of them are already germinated in their home town and growing vigorously. They are demonstrating the possibility of space agriculture as the ornamental plant which remind us "The Beauty of Life on Our Planet"

  11. Digoxin overdose: clinical features and managementVanessa Bara discusses the risk factors, antidotal therapy, and management of digoxin toxicity.

    Science.gov (United States)

    Bara, Vanessa

    2001-06-01

    Digoxin is a digitalis glycoside extracted front the leaves of the plant Digitalis Lanata. more commonly known as Grecian foxglove. The digitalis glycosides are present in many plants including Digitalis purpura (foxglove), Nerium oleander (oleander) and Convallaria majalis (lily-of-the-valley). They are also found in some toads, such as Bufo bufo-bufo (European toad). Digitalis glycosides are believed to have been used for therapeutic benefit in the first century AD. More recently, detailed descriptions of the therapeutic use of foxglove from 200 years ago include recognition of the toxicity associated with its use.

  12. Learning by Explaining Examples to Oneself: A Computational Model

    Science.gov (United States)

    1992-02-01

    ignored vii tireli . Flhere a IP t wo major types)) of paramnet ers. The first controls initial k 1omled PeP which refers to t he knowledge possessed b...I)~ I aili tu all Ilie solut ion lilies, then reflecting onl tilie whole solution to rpq if hli overall s ruict tire mtade sense. However. tlie...thle sub~jects’ behavior. S tichli ltliii , was ca rrie(I ont for all 9 ibjcct:;. nd thle result ig mat ch be- tweel SYvt i and qubject behavior was

  13. Singlid.File under : White American Rock : Sound / Märt Milter

    Index Scriptorium Estoniae

    Milter, Märt

    1998-01-01

    Uutest singlitest : Urban Species "Woman", Cesaria Evora "Sangue De Beirona (remix de Francois K)", Catatonia "Strange Glue", Chris Isaak "Please", Echobeatz "Mas Que Nada", Morcheeba "Blindfold", Chris Rea "Sweet Summer Day", 187 Lockdown "The Don", Bebe Winars "Stay/Thank You", Embrace "My Weakness Is None Of Your Business", Goo Goo Dolls "Iris" ja ameerika popi plaatidest Better Than Ezra "How Does Your Garden Grow?", Barenaked Ladies "Stunt", The Uninvited "The Uninvited, Lilys "Better Can't Make Your Life Better", CIV "Civ", Hootie & The Blowfish "Musical Chairs"

  14. The role of Aloe vera in various fields of medicine and dentistry

    Directory of Open Access Journals (Sweden)

    Andey Venkata Subhash

    2014-01-01

    Full Text Available Aloe vera is a cactus like plant that actually is part of the lily family. There are more than 300 varieties of the Aloe plant, but the Aloe barbadensis variety exhibits the best medicinal properties. It has strong antiseptic, antibacterial, fungicidal and virucidal properties. It promotes cell growth and is neurologically calming and acts as a detoxifying agent. Others provide nutritional support and some increase the regenerative potential of tissues while others act with anti-inflammatory responses. This article reviews the uses of the plant in different fields of medicine and dentistry.

  15. Phyllosphere mycobiota on garden ponds plants

    Directory of Open Access Journals (Sweden)

    Maria Kowalik

    2013-12-01

    Full Text Available Investigations were conducted on calamus, common cattail, soft rush, yellow iris and white water lily plants in twenty ponds in Malopolska and Podkarpacie Regions. Mycobiota existing in the phyllosphere caused discolouring and necroses of leaves and shoots. 88 species of mycobiota were identified and isolated from the diseased tissues. Dominant were Alternaria alternata, Epicoccum nigrum and Isaria farinosa. Fungi of genera: Aspergillus, Botrytis, Chaetomium, Cladosporium, Fusarium, Ilyonectria, Mortierella, Mucor, Penicillium, Phialophora, Phoma, Pleustomophora, Sordaria, Trichoderma and Umbelopsis were also numerous. The monophagous and the polyphagous were identified.

  16. Las cardiopatías congénitas

    OpenAIRE

    Gutiérrez Gil, Jaiber Alberto

    2015-01-01

    Grandes avances en el diagnóstico y tratamiento de las cardiopatías congénitas han contribuido a que la mortalidad de los niños afectados por ellas se haya reducido considerablemente. La Fundación Valle del Lili es la institución con mayor experiencia en el sur occidente colombiano en la evaluación y manejo de las cardiopatías congénitas, y desde su origen hasta hoy ha sido pionera en el diagnóstico, tratamiento y seguimiento de los pacientes con cardiopatías congénita...

  17. Histological Studies on the Formation and Thickening Growth of Bulb and Tuber in Ornamental Plants

    OpenAIRE

    安井, 公一

    1995-01-01

    The process of formation and thickenitg growth of the bulb and tuber ornamental plants was studied by histological procedure.The results may be summarized as follws.1.Easter lily has various types of leaves,such as foliage leaf,scaly leaf and foliage leaf with thickened base.Young leaf primordium of eastrelily has a differentiation potency to develop into either a foliage leaf or a scaly leaf.The first leaf primordium of a daughter bulb defferentiated in the uppermost scaly laef axil of its m...

  18. Borges caleidoscópico

    OpenAIRE

    2015-01-01

    O número 26 é un monográfico adicado a Jorge Luis Borges MONOGRÁFICO BORGES CALEIDOSCÓPICO "Adeus, Georgie" por Luz Pozo Garza "Claudio Rodríguez Fer, autor de Borges y todo" por Héctor Acebo "Julio Ortega, hispanista especialista en la obra de Borges" por Cristina Fiaño "Mi recuerdo de Borges en Austin" por Lily Litvak "Recuerdo de Borges" por Claudio Pérez Míguez "Ex-Libris" por Vero Mariaka "Sueño con Borges" por Francisco Sosa "Ficciones para ...

  19. Bulb dermatitis. Dermatological problems in the flower bulb industries.

    Science.gov (United States)

    Bruynzeel, D P

    1997-08-01

    The irritant and allergenic properties of the most important flower bulbs are described, as well as the clinical symptoms they cause. The tulip contains the allergen tulipalin A; sensitization and irritation are responsible for the development of tulip fingers. The same clinical picture can be caused by Alliums like the onion and garlic. The narcissus causes lily rash, a dermatitis rarely caused by sensitization. The hyacinth evokes itching in practically everyone: an irritant reaction caused by calcium oxalate crystals. Patch testing is complicated as the allergens are not all identified.

  20. On the functions and grammatical status of the Latvian modal particle lai

    Directory of Open Access Journals (Sweden)

    Axel Holvoet

    2011-11-01

    Full Text Available PAR MODĀLĀS PARTIKULAS lai FUNKCIJĀM UN GRAMATISKO STATUSUKopsavilkumsLatviešu valodas gramatikās partikula lai parasti tiek minēta tikai kā analītisko imperatīva formu sastāvdaļa (lai nāk, lai neaizmirstam. Šai rakstā tiek aplūkoti trīs partikulas lai lietošanas tipi: (1 teikumos ar pamudinājuma vai vēlējuma nozīmi (Lai viņi nāk, (2 deontiskajos jautājumos (Ko lai es daru! Ko lai es būtu darījis!, un (3 teikumos ar vērtējuma (neaprobēšanas vai šaubu nozīmi (Viņš lai būtu palīdzējis slepkavām?. Autors cenšas parādīt, ka pirmā (dažreiz arī otrā tipa teikumos partikulai lai piemīt teikuma partikulas īpašības, kamēr otrā un trešā tipa teikumos iezīmējas tendence šai partikulai veidot ar verbu ciešāku sakopojumu, kas gan nelīdzinās analītisko verbu formu statusam, bet zināmā mērā atgādina savienojumus ar modālajiem verbiem. ‘Formveidojošas partikulas’ statusa, ko partikulai lai piedēvē gramatikās, šim vārdam nav nekur.

  1. Improvement of Vase Life and Postharvest Factors of Lilium orientalis ‘Bouquet’ by Silver Nano Particles

    Directory of Open Access Journals (Sweden)

    Seyed Hossein NEMATI

    2013-12-01

    Full Text Available Lily is one of the prominent cut flowers on the international markets, so that its longevity is an important post-storage attribute. Blockage of xylem vessels and insufficient water uptake contributes to the short vase life of cut flowers. Bacteria block stem xylem vessels and because of that reduce rates of water supply to flowers. Nano silver has antimicrobial effects at low concentration. Prolongation of vase life cut lilies (L. orientalis ‘Bouquet’ flowers by nano-silver particles was studied. Cut flowers were kept in vase containing 5, 15, 25, 30 ppm of nano-silver solutions and deionized water as control treatment under controlled conditions. During vase period, vase life, vase solution uptake, initial fresh and bacterial numbers were measured. According to the results, all nano-silver treatments extended the longevity of cut flowers compare to control. Among these treatments the concentration of 30 ppm of silver-nano showed the highest vase solution uptake, initial fresh weight and lowest bacteria colony during the first 2 days of vase life. It was concluded that nano silver particles had a high potential for eliminating of bacterial contaminants. These for suggest that application of solutions containing superior advantageous of nano-silver particles is recommended to improve postharvest of L. orientalis ‘Bouquet’.

  2. Improvement of Vase Life and Postharvest Factors of Lilium orientalis ‘Bouquet’ by Silver Nano Particles

    Directory of Open Access Journals (Sweden)

    Seyed Hossein NEMATI

    2013-12-01

    Full Text Available Lily is one of the prominent cut flowers on the international markets, so that its longevity is an important post-storage attribute. Blockage of xylem vessels and insufficient water uptake contributes to the short vase life of cut flowers. Bacteria block stem xylem vessels and because of that reduce rates of water supply to flowers. Nano silver has antimicrobial effects at low concentration. Prolongation of vase life cut lilies (L. orientalis ‘Bouquet’ flowers by nano-silver particles was studied. Cut flowers were kept in vase containing 5, 15, 25, 30 ppm of nano-silver solutions and deionized water as control treatment under controlled conditions. During vase period, vase life, vase solution uptake, initial fresh and bacterial numbers were measured. According to the results, all nano-silver treatments extended the longevity of cut flowers compare to control. Among these treatments the concentration of 30 ppm of silver-nano showed the highest vase solution uptake, initial fresh weight and lowest bacteria colony during the first 2 days of vase life. It was concluded that nano silver particles had a high potential for eliminating of bacterial contaminants. These for suggest that application of solutions containing superior advantageous of nano-silver particles is recommended to improve postharvest of L. orientalis ‘Bouquet’.

  3. Construction of a genetic linkage map in Lilium using a RIL mapping population based on SRAP marker

    Directory of Open Access Journals (Sweden)

    Chen Li-Jing

    2015-01-01

    Full Text Available A genetic linkage map of lily was constructed using RILs (recombinant inbred lines population of 180 individuals. This mapping population was developed by crossing Raizan No.1 (Formolongo and Gelria (Longiflomm cultivars through single-seed descent (SSD. SRAPs were generated by using restriction enzymes EcoRI in combination with either MseI. The resulting products were separated by electrophoresis on 6% denaturing polyacrylamide gel and visualized by silver staining. The segregation of each marker and linkage analysis was done using the program Mapmaker3.0. With 50 primer pairs, a total of 189 parental polymorphic bands were detected and 78 were used for mapping. The total map length was 2,135.5 cM consisted of 16 linkage groups. The number of markers in the linkage groups varied from 1 to 12. The length of linkage groups was range from 11.2 cM to 425.9 cM and mean marker interval distance range from 9.4 cM to 345.4 cM individually. The mean marker interval distance between markers was 27.4 cM. The map developed in the present study was the first sequence-related amplified polymorphism markers map of lily constructed with recombinant inbred lines, it could be used for genetic mapping and molecular marker assisted breeding and quantitative trait locus mapping of Lilium.

  4. First Principles Investigation of Li/Fe-Oxide as a High Energy Material for Hybrid All-in-One Li-ion/Li-O2 Batteries

    Science.gov (United States)

    Kinaci, Alper; Trahey, Lynn; Thackeray, Michael M.; Kirklin, Scott; Wolverton, Christopher; Chan, Maria K. Y.; CenterElectrical Energy Storage Collaboration

    2014-03-01

    We recently introduced a vision for high energy all-in-one electrode/electrocatalyst materials that can be used in hybrid Li-ion/Li-O2 (Li-air) cells. Recent experiments using Li5FeO4 demonstrated substantially smaller voltage polarizations and hence higher energy efficiency compared to standard Li-O2 cells forming Li2O2. The mechanism by which the charge process activates the Li5FeO4, however, is not well understood. Here, we present first principles density functional theory (DFT) calculations to establish the thermodynamic conditions for the extraction of Li/Li +O from Li5FeO4. A step-by-step, history-dependent, removal process has been followed and the stability of the Li and Li +O deficient samples is investigated on the basis of the energies of the extraction reactions. Various stages of Li/Li +O removal are identified, and structural changes and electronic structure evolution, as well as computed XRD, XANES, and PDF characterizations are reported.

  5. Optimizing Instruction Scheduling and Register Allocation for Register-File-Connected Clustered VLIW Architectures

    Directory of Open Access Journals (Sweden)

    Haijing Tang

    2013-01-01

    Full Text Available Clustering has become a common trend in very long instruction words (VLIW architecture to solve the problem of area, energy consumption, and design complexity. Register-file-connected clustered (RFCC VLIW architecture uses the mechanism of global register file to accomplish the inter-cluster data communications, thus eliminating the performance and energy consumption penalty caused by explicit inter-cluster data move operations in traditional bus-connected clustered (BCC VLIW architecture. However, the limit number of access ports to the global register file has become an issue which must be well addressed; otherwise the performance and energy consumption would be harmed. In this paper, we presented compiler optimization techniques for an RFCC VLIW architecture called Lily, which is designed for encryption systems. These techniques aim at optimizing performance and energy consumption for Lily architecture, through appropriate manipulation of the code generation process to maintain a better management of the accesses to the global register file. All the techniques have been implemented and evaluated. The result shows that our techniques can significantly reduce the penalty of performance and energy consumption due to access port limitation of global register file.

  6. Differences in mechanical and structural properties of surface and aerial petioles of the aquatic plant Nymphaea odorata subsp. tuberosa (Nymphaeaceae).

    Science.gov (United States)

    Etnier, Shelley A; Villani, Philip J

    2007-07-01

    Lily pads (Nymphaea odorata) exhibit heterophylly where a single plant may have leaves that are submerged, floating, or above (aerial) the surface of the water. Lily pads are placed in a unique situation because each leaf form is exposed to a distinctly different set of mechanical demands. While surface petioles may be loaded in tension under conditions of wind or waves, aerial petioles are loaded in compression because they must support the weight of the lamina. Using standard techniques, we compared the mechanical and morphological properties of both surface and aerial leaf petioles. Structural stiffness (EI) and the second moment of area (I) were higher in aerial petioles, although we detected no differences in other mechanical values (elastic modulus [E], extension ratio, and breaking strength). Morphologically, aerial petioles had a thicker rind, with increased collenchyma tissue and sclereid cell frequency. Aerial petioles also had a larger cross-sectional area and were more elliptical. Thus, subtle changes in the distribution of materials, rather than differences in their makeup, differentiate petiole forms. We suggest that the growth of aerial petioles may be an adaptive response to shading, allowing aerial leaves to rise above a crowded water surface.

  7. Conservation and canalization of gene expression during angiosperm diversification accompany the origin and evolution of the flower

    Science.gov (United States)

    Chanderbali, André S.; Yoo, Mi-Jeong; Zahn, Laura M.; Brockington, Samuel F.; Wall, P. Kerr; Gitzendanner, Matthew A.; Albert, Victor A.; Leebens-Mack, James; Altman, Naomi S.; Ma, Hong; dePamphilis, Claude W.; Soltis, Douglas E.; Soltis, Pamela S.

    2010-01-01

    The origin and rapid diversification of the angiosperms (Darwin's “Abominable Mystery”) has engaged generations of researchers. Here, we examine the floral genetic programs of phylogenetically pivotal angiosperms (water lily, avocado, California poppy, and Arabidopsis) and a nonflowering seed plant (a cycad) to obtain insight into the origin and subsequent evolution of the flower. Transcriptional cascades with broadly overlapping spatial domains, resembling the hypothesized ancestral gymnosperm program, are deployed across morphologically intergrading organs in water lily and avocado flowers. In contrast, spatially discrete transcriptional programs in distinct floral organs characterize the more recently derived angiosperm lineages represented by California poppy and Arabidopsis. Deep evolutionary conservation in the genetic programs of putatively homologous floral organs traces to those operating in gymnosperm reproductive cones. Female gymnosperm cones and angiosperm carpels share conserved genetic features, which may be associated with the ovule developmental program common to both organs. However, male gymnosperm cones share genetic features with both perianth (sterile attractive and protective) organs and stamens, supporting the evolutionary origin of the floral perianth from the male genetic program of seed plants. PMID:21149731

  8. Novel synthesis process and structure refinements of Li{sub 4}Mn{sub 5}O{sub 12} for rechargeable lithium batteries

    Energy Technology Data Exchange (ETDEWEB)

    Takada, Toshimi; Hayakawa, Hiroshi; Akiba, Etsuo [National Inst. of Materials and Chemical Research, Tsukuba, Ibaraki (Japan); Izumi, Fujio [National Inst. for Research in Inorganic Materials, Tsukuba (Japan); Chakoumakos, B.C. [Oak Ridge National Lab., TN (United States)

    1996-12-31

    Well crystallized Li4Mn5O12 was prepared from LiOAc-Mn(NO3)2 under flowing oxygen. Rietveld refinement with XRD and neutron powder diffraction indicated that Li4Mn5O12 has cubic spinel structure in which the Li ions occupy both the tetrahedral sites 8a and part of the octahedral sites 16d but not the 16c sites, while all the Mn ions occupy the 16d sites of the space group Fd{bar 3}m. The lattice parameter was found to be sensitive to synthesis temperature owing to variation in Mn valence. Sample prepared at 500 C showed better electrode performance: a rechargeable capacity of 135 mAh/g for the cell Li/Li4Mn5O12 at cell voltages 2.5-3.6 V. It is found that Mn oxidation state in Li4Mn5O12 has a strong effect on electrode performance of Li/Li4Mn5O12 cell.

  9. Design and application of two novel degenerate primer pairs for the detection and complete genomic characterization of potyviruses.

    Science.gov (United States)

    Ha, C; Coombs, S; Revill, P A; Harding, R M; Vu, M; Dale, J L

    2008-01-01

    Two pairs of degenerate primers were designed from sequences within the potyviral CI (CIFor/CIRev) and HC-Pro-coding regions (HPFo/HPRev), and these were shown to be highly specific to members of the genus Potyvirus. Using the CIFor and CIRev primers, three novel potyviruses infecting crop and weed species from Vietnam were detected, namely telosma mosaic virus (TelMV) infecting telosma (Telosma cordata, Asclepiadaceae), peace lily mosaic virus (PeLMV) infecting peace lily (Spathiphyllum patinii, Araceae) and wild tomato mosaic virus (WTMV) infecting wild tomato (Solanum torvum, Solanaceae). The fragments amplified by the two sets of primers enabled additional PCR and complete genomic sequencing of these viruses and a banana bract mosaic virus (BBrMV) isolate from the Philippines. All four viruses shared genomic features typical of potyviruses. Sequence comparisons and phylogenetic analyses indicated that WTMV was most closely related to chilli veinal mottle virus (ChiVMV) and pepper veinal mottle virus (PVMV), while PeLMV, TelMV and BBrMV were related to different extents to members of the bean common mosaic virus (BCMV) subgroup.

  10. Magnesium-Doped Li1.2[Co0.13Ni0.13Mn0.54]O2 for Lithium-Ion Battery Cathode with Enhanced Cycling Stability and Rate Capability.

    Science.gov (United States)

    Wang, Yan X; Shang, Ke H; He, Wei; Ai, Xin P; Cao, Yu L; Yang, Han X

    2015-06-17

    Mg-doped Li[Li0.2-2xMgxCo0.13Ni0.13Mn0.54]O2 is synthesized by introducing Mg ions into the transition-metal (TM) layer of this layered compound for substituting Li ions through a simple polymer-pyrolysis method. The structural and morphological characterization reveals that the doped Mg ions are uniformly distributed in the bulk lattice, showing an insignificant impact on the layered structure. Electrochemical experiments reveal that, at a Mg doping of 4%, the Li[Li0.16Mg0.04Co0.13Ni0.13Mn0.54]O2 electrode can deliver a larger initial reversible capacity of 272 mAh g(-1), an improved rate capability with 114 mAh g(-1) at 8 C, and an excellent cycling stability with 93.3% capacity retention after 300 cycles. The superior electrochemical performances of the Mg-doped material are possibly due to the enhancement of the structural stability by substitution of Li by Mg in the TM layer, which effectively suppresses the cation mixing arrangement, leading to the alleviation of the phase change during lithium-ion insertion and extraction.

  11. Optimizing Instruction Scheduling and Register Allocation for Register-File-Connected Clustered VLIW Architectures

    Science.gov (United States)

    Tang, Haijing; Wang, Siye; Zhang, Yanjun

    2013-01-01

    Clustering has become a common trend in very long instruction words (VLIW) architecture to solve the problem of area, energy consumption, and design complexity. Register-file-connected clustered (RFCC) VLIW architecture uses the mechanism of global register file to accomplish the inter-cluster data communications, thus eliminating the performance and energy consumption penalty caused by explicit inter-cluster data move operations in traditional bus-connected clustered (BCC) VLIW architecture. However, the limit number of access ports to the global register file has become an issue which must be well addressed; otherwise the performance and energy consumption would be harmed. In this paper, we presented compiler optimization techniques for an RFCC VLIW architecture called Lily, which is designed for encryption systems. These techniques aim at optimizing performance and energy consumption for Lily architecture, through appropriate manipulation of the code generation process to maintain a better management of the accesses to the global register file. All the techniques have been implemented and evaluated. The result shows that our techniques can significantly reduce the penalty of performance and energy consumption due to access port limitation of global register file. PMID:23970841

  12. Potential plant poisonings in dogs and cats in southern Africa : review article

    Directory of Open Access Journals (Sweden)

    C.J. Botha

    2009-05-01

    Full Text Available Plant poisoning occurs less commonly in dogs and cats than in herbivorous livestock, but numerous cases have been documented worldwide, most of them caused by common and internationally widely cultivated ornamental garden and house plants. Few cases of poisoning of cats and dogs have been reported in southern Africa, but many of the plants that have caused poisoning in these species elsewhere are widely available in the subregion and are briefly reviewed in terms of toxic principles, toxicity, species affected, clinical signs, and prognosis. The list includes Melia azedarach (syringa, Brunfelsia spp. (yesterday, today and tomorrow, Datura stramonium (jimsonweed, stinkblaar, a wide variety of lilies and lily-like plants, cycads, plants that contain soluble oxalates, plants containing cardiac glycosides and other cardiotoxins and euphorbias (Euphorbia pulcherrima, E. tirucalli. Poisoning by plant products such as macadamia nuts, onions and garlic, grapes and raisins, cannabis (marijuana, dagga or hashish and castor oil seed or seedcake is also discussed. Many of the poisonings are not usually fatal, but others frequently result in death unless rapid action is taken by the owner and the veterinarian, underlining the importance of awareness of the poisonous potential of a number of familiar plants.

  13. Effect of Stress-free Therapy on Cerebral Blood Flow: Comparisons among patients with metabolic cardiovascular disease, healthy subjects and placebo-treated subjects

    Science.gov (United States)

    Ryotokuji, Kenji; Ishimaru, Keisou; Kihara, Kazuhiko; Namiki, Yoshihisa; Nakashima, Takuma; Otani, Satoru

    2014-01-01

    Background and aims: We have developed a Stress-free Therapy® device wherein “Pinpoint Plantar Long-wavelength Infrared Light Irradiation (PP-LILI)” increases peripheral-deep body temperature and blood flow volume and stabilizes blood pressure as well as significantly reduces stress hormones such as adrenocorticotrophic hormone and cortisol without using drugs. Moreover, we have found this therapy to significantly improve blood glucose and insulin resistance in patients with type 2 diabetes. Based on this background of clinical efficacy, we validated changes in cerebral blood flow in patients with metabolic cardiovascular disease and examined the efficacy of Stress-free Therapy® on cerebral blood flow as compared to that in healthy control subjects and placebo-treated patients. Results: The change in cerebral blood flow volume during 15-minute PP-LILI was 5.1 ± 1.8 mL/min in patients with metabolic cardiovascular disease, showing a significant increase (P<0.05) of 3.1 mL/min as compared with the mean blood flow value after resting for 15 minutes. Conclusions: Our results suggested Stress-free Therapy® to significantly increase cerebral blood flow, possibly leading to the prevention of metabolic cardiovascular disease. PMID:24771966

  14. Fast formation cycling for lithium ion batteries

    Science.gov (United States)

    An, Seong Jin; Li, Jianlin; Du, Zhijia; Daniel, Claus; Wood, David L.

    2017-02-01

    The formation process for lithium ion batteries typically takes several days or more, and it is necessary for providing a stable solid electrolyte interphase on the anode (at low potentials vs. Li/Li+) for preventing irreversible consumption of electrolyte and lithium ions. An analogous layer known as the cathode electrolyte interphase layer forms at the cathode at high potentials vs. Li/Li+. However, several days, or even up to a week, of these processes result in either lower LIB production rates or a prohibitively large size of charging-discharging equipment and space (i.e. excessive capital cost). In this study, a fast and effective electrolyte interphase formation protocol is proposed and compared with an Oak Ridge National Laboratory baseline protocol. Graphite, NMC 532, and 1.2 M LiPF6 in ethylene carbonate: diethyl carbonate were used as anodes, cathodes, and electrolytes, respectively. Results from electrochemical impedance spectroscopy show the new protocol reduced surface film (electrolyte interphase) resistances, and 1300 aging cycles show an improvement in capacity retention.

  15. Potential plant poisonings in dogs and cats in southern Africa.

    Science.gov (United States)

    Botha, C J; Penrith, M L

    2009-06-01

    Plant poisoning occurs less commonly in dogs and cats than in herbivorous livestock, but numerous cases have been documented worldwide, most of them caused by common and internationally widely cultivated ornamental garden and house plants. Few cases of poisoning of cats and dogs have been reported in southern Africa, but many of the plants that have caused poisoning in these species elsewhere are widely available in the subregion and are briefly reviewed in terms of toxic principles, toxicity, species affected, clinical signs, and prognosis. The list includes Melia azedarach (syringa), Brunfelsia spp. (yesterday, today and tomorrow), Datura stramonium (jimsonweed, stinkblaar), a wide variety of lilies and lily-like plants, cycads, plants that contain soluble oxalates, plants containing cardiac glycosides and other cardiotoxins and euphorbias (Euphorbia pulcherrima, E. tirucalli). Poisoning by plant products such as macadamia nuts, onions and garlic, grapes and raisins, cannabis (marijuana, dagga) or hashish and castor oil seed or seedcake is also discussed. Many of the poisonings are not usually fatal, but others frequently result in death unless rapid action is taken by the owner and the veterinarian, underlining the importance of awareness of the poisonous potential of a number of familiar plants.

  16. Entrepreneurial Interest in Product Innovation-based Organic Processed Food in SMEs in Malang, Indonesia

    Directory of Open Access Journals (Sweden)

    Sri Muljaningsih

    2015-12-01

    Full Text Available The underlying reason for conducting the study is need for organic processed food. Producing innovative organic processed food is not an easy task since it requires creativity. The statement of the problem is how to create entrepreneurial interest to produce organic processed food. The study is a qualitative study of which purpose is to describe organic processed food SMEs behavior. There are 7 (seven informants involved in the study. The setting of the study is SMEs in “Lily go to organic Group” community in Malang, Indonesia. Variables of entrepreneurial interest in organic processed food involve attitude, subjective norms and perceived behavioral control. The findings show that creativity influences entrepreneurial interest in organic processed food and it results in creativity. Creativity is also the result of spiritual entrepreneurship that takes understanding towards organic processed food material into consideration. In addition, Lily Group members also take time, capital, raw materials and marketing into account. Another finding reveals that sincerity and strong determination facilitates organic processed food entrepreneurs to work their best. Such determination needs reinforcement from other related party so that the product is accepted by customers.

  17. A novel Si/Sn composite with entangled ribbon structure as anode materials for lithium ion battery.

    Science.gov (United States)

    Wu, Jinbo; Zhu, Zhengwang; Zhang, Hongwei; Fu, Huameng; Li, Hong; Wang, Aimin; Zhang, Haifeng

    2016-07-08

    A novel Si/Sn composite anode material with unique ribbon structure was synthesized by Mechanical Milling (MM) and the structural transformation was studied in the present work. The microstructure characterization shows that Si/Sn composite with idealized entangled ribbon structured can be obtained by milling the mixture of the starting materials, Si and Sn for 20 h. According to the calculated results based on the XRD data, the as-milled 20 h sample has the smallest avergae crystalline size. It is supposed that the flexible ribbon structure allows for accommodation of intrinsic damage, which significantly improves the fracture toughness of the composite. The charge and discharge tests of the as-milled 20 h sample have been performed with reference to Li(+)/Li at a current density of 400 mA g(-1) in the voltage from 1.5 to 0.03 V (vs Li/Li(+)) and the result shows that the initial capacity is ∼1400 mA h g(-1), with a retention of ∼1100 mA h g(-1) reversible capacity after 50 cycles, which is possible serving as the promising anode material for the lithium ion battery application.

  18. High-resolution electron spectroscopy and structures of lithium-nucleobase (adenine, uracil, and thymine) complexes.

    Science.gov (United States)

    Krasnokutski, Serge A; Lee, Jung Sup; Yang, Dong-Sheng

    2010-01-28

    Li complexes of adenine, uracil, and thymine were produced by laser vaporization of rods made of Li and nucleobase powders in a metal-cluster beam source and studied by pulsed-field-ionization zero-electron-kinetic-energy (ZEKE) spectroscopy and density functional theory calculations. The ZEKE measurements determined the adiabatic ionization energies of the three neutral complexes and frequencies of several vibrational modes for the metal-adenine and -uracil ions. The measured spectra were compared with spectral simulations to determine the preferred metal binding sites. For adenine, the most stable structure is formed by Li/Li(+) bidentately binding to both the N7 atom of the imidazole ring and the NH(2) group of the pyrimidine ring. For uracil and thymine, the ideal site for Li/Li(+) coordination is the O4 atom. Although it has only a small effect on the geometries of uracil and thymine, lithium coordination forces the rotation of the NH(2) group out of the adenine plane. The adiabatic ionization energies of the three complexes follow the trend of uracil (33910+/-5 cm(-1))>thymine (33386+/-5 cm(-1))>adenine (32240+/-5 cm(-1)), whereas their metal-ligand bond dissociation energies are about the same, (92-97) +/-6 kJ mol(-1). For all three complexes, the neutral bond energies are smaller than those of the corresponding ions due to a weaker electrostatic interaction and stronger electron repulsion.

  19. Conservation and canalization of gene expression during angiosperm diversification accompany the origin and evolution of the flower.

    Science.gov (United States)

    Chanderbali, André S; Yoo, Mi-Jeong; Zahn, Laura M; Brockington, Samuel F; Wall, P Kerr; Gitzendanner, Matthew A; Albert, Victor A; Leebens-Mack, James; Altman, Naomi S; Ma, Hong; dePamphilis, Claude W; Soltis, Douglas E; Soltis, Pamela S

    2010-12-28

    The origin and rapid diversification of the angiosperms (Darwin's "Abominable Mystery") has engaged generations of researchers. Here, we examine the floral genetic programs of phylogenetically pivotal angiosperms (water lily, avocado, California poppy, and Arabidopsis) and a nonflowering seed plant (a cycad) to obtain insight into the origin and subsequent evolution of the flower. Transcriptional cascades with broadly overlapping spatial domains, resembling the hypothesized ancestral gymnosperm program, are deployed across morphologically intergrading organs in water lily and avocado flowers. In contrast, spatially discrete transcriptional programs in distinct floral organs characterize the more recently derived angiosperm lineages represented by California poppy and Arabidopsis. Deep evolutionary conservation in the genetic programs of putatively homologous floral organs traces to those operating in gymnosperm reproductive cones. Female gymnosperm cones and angiosperm carpels share conserved genetic features, which may be associated with the ovule developmental program common to both organs. However, male gymnosperm cones share genetic features with both perianth (sterile attractive and protective) organs and stamens, supporting the evolutionary origin of the floral perianth from the male genetic program of seed plants.

  20. Coltsfoot as a potential cause of deep vein thrombosis and pulmonary embolism in a patient also consuming kava and blue vervain.

    Science.gov (United States)

    Freshour, Jessica E; Odle, Brian; Rikhye, Somi; Stewart, David W

    2012-09-01

    To report a case of deep vein thrombosis (DVT) with symptomatic pulmonary embolism (PE) possibly associated with the use of coltsfoot, kava, or blue vervain. A 27-year-old white male presented with leg pain and swelling, tachycardia, and pleuritic chest pain. He had no significant medical history. A medication history revealed extensive herbal medication use including: coltsfoot, passionflower, red poppy flower petals, wild lettuce, blue lily flowers, wild dagga flowers, Diviners Three Burning Blend® (comprised of salvia divinorum, blue lily, and wild dagga), kava-kava, St. John's Wort, blue vervain, and Dreamer's Blend® (comprised of Calea zacatechichi, vervain, Entada rheedii, wild lettuce, and Eschscholzia californica). Lower extremity Doppler ultrasound and computed topography (CT) of the chest revealed DVT and PE. A hypercoagulable work-up was negative. The patient was treated with enoxaparin and warfarin and was discharged home. While no distinct agent can be identified as a sole cause of this venous thromboembolic event, coltsfoot could potentially affect coagulation through its effect on vascular endothelial cells as they regulate nitric oxide. Nitric oxide is a known mediator of platelet activity and coagulation, particularly in the pulmonary vasculature. Kava and vervain have estrogenic properties. Of the medications consumed by this self-proclaimed "herbalist," coltsfoot is a potential cause of venous thromboembolic disease (VTE).

  1. Plant 115-kDa actin-filament bundling protein, P-115-ABP, is a homologue of plant villin and is widely distributed in cells.

    Science.gov (United States)

    Yokota, Etsuo; Vidali, Luis; Tominaga, Motoki; Tahara, Hiroshi; Orii, Hidefumi; Morizane, Yosuke; Hepler, Peter K; Shimmen, Teruo

    2003-10-01

    In many cases, actin filaments are arranged into bundles and serve as tracks for cytoplasmic streaming in plant cells. We have isolated an actin-filament bundling protein, which is composed of 115-kDa polypeptide (P-115-ABP), from the germinating pollen of lily, Lilium longiflorum [Nakayasu et al. (1998) BIOCHEM: Biophys. Res. Commun. 249: 61]. P-115-ABP shared similar antigenicity with a plant 135-kDa actin-filament bundling protein (P-135-ABP), a plant homologue of villin. A full-length cDNA clone (ABP115; accession no. AB097407) was isolated from an expression cDNA library of lily pollen by immuno-screening using antisera against P-115-ABP and P-135-ABP. The amino acid sequence of P-115-ABP deduced from this clone showed high homology with those of P-135-ABP and four villin isoforms of Arabidopsis thaliana (AtVLN1, AtVLN2, AtVLN3 and AtVLN4), especially AtVLN4, indicating that P-115-ABP can also be classified as a plant villin. The P-115-ABP isolated biochemically from the germinating lily pollen was able to arrange F-actin filaments with uniform polarity into bundles and this bundling activity was suppressed by Ca2+-calmodulin (CaM), similar to the actin-filament bundling properties of P-135-ABP. The P-115-ABP type of plant villin was widely distributed in plant cells, from algae to land plants. In root hair cells of Hydrocharis dubia, this type of plant villin was co-localized with actin-filament bundles in the transvacuolar strands and the sub-cortical regions. Microinjection of the antiserum against P-115-ABP into living root hair cells caused the disappearance of transvaculor strands and alteration of the route of cytoplasmic streaming. In internodal cells of Chara corallina in which the P-135-ABP type of plant villin is lacking, the P-115-ABP type showed co-localization with actin-filament cables anchored on the intracellular surface of chloroplasts. These results indicated that plant villins are widely distributed and involved in the organization of actin

  2. 11 month-old twins with food avoidance.

    Science.gov (United States)

    Kessler, Daniel B; Fortune, Erin L; Werner, Ellen G; Stein, Martin T

    2010-04-01

    Maggie and Lily are 11 month-old twins who are brought by their parents to the Developmental-Behavioral Pediatric Clinic for a life-long history of feeding difficulties. The twins are this couple's first children. Their mother is tearful as she recounts a stressful pregnancy complicated by pre-term labor beginning at 24 weeks gestation with strict bed rest for the remainder of the pregnancy. The twins were delivered at 35 weeks gestation by Caesarian Section. Lily weighed 5 lbs 11 oz; Maggie was small-for-gestational age with a birth weight of 3 lbs 13 oz. Maggie required oxygen with nasal prongs for only a few hours after birth. She remained in the Neonatal Intensive Care Unit (NICU) with initial nasogastric tube feeding; she was advanced to bottle feeding prior to discharge. Both Maggie and Lily were slow to initiate and sustain formula feeding. They required over 1 hour to consume 2 ounces of formula and "tire easily". At 1 month of age, Maggie resisted feedings by crying and arching her back. By 5 months of age, both children cried at the sight of the bottle and tried to push it away. However, they never lost weight. Maggie was treated with intermittent naso-gastric tube feeding at 5-6 months of age in order to gain adequate weight. At 11 months of age, both girls continued to resist feeding, but their mother was able to "get in" 24 ounces each day of a 31-calorie/ounce formula "with a lot of work". Dad observed that his wife's entire day revolved around getting the twins to eat and that became a significant stress for her as well as on their relationship. The children had a gastroenterology evaluation including an upper gastrointestinal series, pH probe and gastro-duodenal endoscopy with biopsies. All studies were normal. Trials of omeprazole, metoclopramide and thickened feeds did not improve their feeding problem. They are currently not on any medications. They have not had a history of vomiting, diarrhea, or diaphoresis with feeds, and they have experienced

  3. Appelativization and separation as method of word-formation

    Directory of Open Access Journals (Sweden)

    Valentīna Skujiņa

    2011-12-01

    Full Text Available APELATIVĀCIJA UN SEPARĀCIJA KĀ VĀRDDARINĀŠANAS PAŅĒMIENIRezumēLatviešu valodas vārddarināšanas sistēmā sava patstāvīga vieta būtu ierādāma tādiem jauniem vārddarināšanas paņēmieniem kā apelativācija un separācija.Apelativācija ir ar vārda nozīmes maiņu cieši saistīts vārddarināšanas paņēmiens, kurā jauns sugasvārds (apelatīvs tiek darināts uz īpašvārda bāzes. Izšķir pilno un nepilno apelativāciju. Pil­najai apelativācijai ir trīs paveidi: tiešā, afiksālā un kompozitīvā. Tiešajā apelativācija īpašvārds kļūst par sugasvārdu bez jebkādiem papildu vārddarināšanas līdzekļiem (ampērs, džouls, volts, afiksālajā — reizē ar īpašvārda pāreju sugasvārda kategorijā notiek art afiksācija (gagarinits, listerioze, kompozitīvajā — veidojas saliktenis (glaubersāls, vatmaņpapīrs. Nepilnajā apelativācija latviešu valodā saglabājas lielā sākumburta rakstība (Alpu vijolītes, Bikforda auklā.Separācija ir salikteņdarināšanai pretējs vārddarināšanas process, kurā patstāvīga vārda funk­ciju iegūst salikteņa vai prefiksāla atvasinājuma pamatkomponents (gaisdzese, šķidrumdzese → dzesē; absorbcija, adsorbcija → sorbcija.Apelativācijai un separācijai īpaša vieta ir terminu darināšanā, turklāt ne tikai latviešu, bet arī citās valodās.

  4. Dynamic changes in charge-transfer resistance at Li metal/Li7La3Zr2O12 interfaces during electrochemical Li dissolution/deposition cycles

    Science.gov (United States)

    Koshikawa, Hiroyuki; Matsuda, Shoichi; Kamiya, Kazuhide; Miyayama, Masaru; Kubo, Yoshimi; Uosaki, Kohei; Hashimoto, Kazuhito; Nakanishi, Shuji

    2018-02-01

    Dynamic changes in the charge-transfer resistance at a Li/Li7La3Zr2O12 (LLZ) interface during lithium (Li) dissolution/deposition cycles are investigated with an alternative current (AC) impedance technique in a three-electrode system. The resistance respectively increases and decreases during electrodissolution and electrodeposition of Li. The resistance does not return to the initial value after one cycle of Li dissolution and deposition, which indicates that the change in resistance during dissolution is larger than that during deposition. Furthermore, the resistance is almost constant when Li deposition proceeds without prior Li dissolution. The respective increase and decrease in the interfacial resistance during Li dissolution and deposition is most likely due to the formation and disappearance of voids at the Li/LLZ interface, and the voids formation during Li dissolution is suggested to be a critical factor that influences the interfacial resistance.

  5. Facile synthesis of nanostructured transition metal oxides as electrodes for Li-ion batteries

    Science.gov (United States)

    Opra, Denis P.; Gnedenkov, Sergey V.; Sokolov, Alexander A.; Minaev, Alexander N.; Kuryavyi, Valery G.; Sinebryukhov, Sergey L.

    2017-09-01

    At all times, energy storage is one of the greatest scientific challenge. Recently, Li-ion batteries are under special attention due to high working voltage, long cycle life, low self-discharge, reliability, no-memory effect. However, commercial LIBs usage in medium- and large-scale energy storage are limited by the capacity of lithiated metal oxide cathode and unsafety of graphite anode at high-rate charge. In this way, new electrode materials with higher electrochemical performance should be designed to satisfy a requirement in both energy and power. As it known, nanostructured transition metal oxides are promising electrode materials because of their elevated specific capacity and high potential vs. Li/Li+. In this work, the perspective of an original facile technique of pulsed high-voltage plasma discharge in synthesis of nanostructured transition metal oxides as electrodes for lithium-ion batteries has been demonstrated.

  6. Amphibious Operations: Ensuring Capabilities to Assure Access

    Science.gov (United States)

    2011-04-05

    50140111111 204 144 2 102 0 AAV7A2(S) 󈧖 28 2 30111m 204 144 2 102 0 AAAV (S) 18 26 7 30mm 204 144 2 102 0 Submers. Ruled out High Speed Amphibi~ns...AAV7A2(F) 9 32.:~ 30mm 388 238 NA 0 552 AAAV (F) 18 31.3 30mm 204 144 "’A 0 0 ------·---· _, ____ - -------- Non-amphibious Vehicles A PC( X) 18...200 7A1 1 ~ Remainder (of MEF assets by LCAC) It Alternative (12 Rifle Companies) LAV-25 7A2(F) AAAV (F) 1 S,1111e !lilies for 7A2(SI. AMV(S

  7. Filmikooli tudengid tegid Wiesbadenis ilma / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2007-01-01

    Noore filmirežissööri Rasmus Merivoo bakalaureusetöö - lühimängufilm "Tulnukas ehk Valdise pääsemine 11 osas", võitis Saksamaal Kesk- ja Ida-Euroopa filmifestivalil "goEast" festivali tudengifilmide võistlusprogrammis (hääletas publik) esimese preemia, kolmanda sai Kaupo Kruusiaugu "Meister". Noortele jagus ka teisi auhindu (dokumentaal- ja eksperimentaalfilmide tene preemia Birgit Demidova "Ninanokkija apelsinile", 1500 eurot Joosep Matjuse "Suvisele dokumentaalile") ning koostööfilmi auhinna said Heilika Võsu ja Ülo Pikkov, kes teevad koos sakslastega filmi "Normaalne". Mängufilmide peapreemia Kuldse Lily sai venelase Ivan Võrõpajevi "Eufooria". Eestist osales "Jan Uuspõld läheb Tartusse" ja dokfilmide võistlusprogrammis "Müümise kunst"

  8. Notes on new and misunderstood taxa of Cyrtanthus (Amaryllidaceae: Cyrtantheae from the Western Cape, Eastern Cape and KwaZulu- Natal, South Africa

    Directory of Open Access Journals (Sweden)

    D. A. Snijman

    2007-12-01

    Full Text Available Cyrtanthus aureolinus Snijman is a new, rare species of fire lily, which is localized in a vlei on the northern slopes of the Groot Swartberg, Western Cape. The upright or slightly spreading, yellow to cream-coloured flowers and the perigone tube which gradually widens to the throat suggest that it is closely related to the Western Cape endemic, C.  ochroleucus (Herb. Burch, ex Steud., and C. mackenii Hook.f., a variable species from southern KwaZulu-Natal and Eastern Cape. The species differs mainly by the shape, size and position of the tepals and the length of the filaments. Cyrtanthus mackenii var. cooperi (Baker R.A.Dyer is raised to subspecies rank as C.  mackenii subsp. cooperi (Baker Snijman. Its hysteranthous leaf habit and grassland habitat differ from the riverine habitat of the evergreen C. mackenii subsp. mackenii. Described in detail are C. aureolinus, C. ochroleucus, and C. mackenii.

  9. KARAKTERISTIK FASAD BANGUNAN RUMAH KOMPAK

    Directory of Open Access Journals (Sweden)

    Rahmatika Apriyanti

    2016-09-01

    Fauzy, Bachtiar., Purnama Salura., Agnes Kurnia (2013.  Sintesis Langgam Arsitektur Kolonial  Pada  Gedung  Restauran ‘Hallo Surabaya’ Di Surabaya . Lembaga Penelitian dan Pengabdian kepada Masyarakat, Universitas Katolik Parahyangan Fitriyanin (….. Metode Penelitian. Universitas Komunikasi Indonesia. Bandung Krier, Rob (2001. Komposisi Arsitektur. Erlangga. Jakarta Pujantara, Ruly (2010. Karakteristik  Fasade  Bangunan Peninggalan  Kolonialisme  Dan Sebaran Spasialnya Di Kota Makassar Saraswati, A.A.Ayu Oka. (2006. Bale Kulkur Sebagai Bangunan Penanda Pendukung Karakter Kota Budaya. Dosen Sejarah Arsitektur, Universitas Udayana Bali Utami., Mario Wibowo., Abdul Jabbar Faruk (2014. Kajian Bentuk dan Fasad Hotel Gino Feruci Bandung. Jurusan Teknik Aristektur, Fakultas Teknik Sipil & Perencanaan, Institut Teknologi Nasional Bandung Widaningsih, Lilis (2004. Karakteristik Fasade Bangunan Factory  Outlet Di  Jalan Ir. H. Djuanda Bandung. Jurusan Teknik Arsitektur. Fakultas Teknik. Universitas Pendidikan Indonesia. Bandung

  10. Behind Japanese Lines in Burma

    Science.gov (United States)

    2001-01-01

    icular 1/ic� ii ç�or� 0/15/) a/lti-/apa/lese Kachi 1 peple u�c�re i/ic!! to the li/li! .c success B~ the ti/ic� ~?f its (lecicti �cit/Oil oil 12. / 94... killed 5. 42/,�/cif)anc�se and res cued 574 A /lk�cl percoil miel. The li/lit 5 ciccomplishiiie)it.c garmiemecl a I�reside;zt Ici! I iii! (,itatioi...yea i�s before the Japanese invasion, a native policeman in the execution of� his duties shot and killed a Kaclun of another family. Families in the

  11. Flora vascular de los Humedales de Chimbote, Perú

    Directory of Open Access Journals (Sweden)

    César Arana

    2013-06-01

    Full Text Available Los humedales de Chimbote (09°05’51"S; 78°32’52"O presentan una flora vascular compuesta por 41 especies en 18 familias. El 61% magnoliópsidas y el 39% liliópsidas. Las familias con mayor número de especies fueron Poaceae, Cyperaceae y Asteraceae. Las formas de crecimiento dominantes fueron las hierbas (85% seguidas de arbustos (10%. En comparación con los humedales costeros de Lima, en Chimbote se presenta mayor riqueza de especies que en Medio Mundo (16 especies y El Paraíso (25, aunque menos que en Los Pantanos de Villa (66. Un análisis de agrupamiento indica una mayor similitud con el humedal de Los Pantanos de Villa. En estos humedales se presentan cuatro tipos de comunidades vegetales. La mayor diversidad de especies es encontrada en la desembocadura del río Lacramarca.

  12. A sulfur–microporous carbon composite positive electrode for lithium/sulfur and silicon/sulfur rechargeble batteries

    Directory of Open Access Journals (Sweden)

    Takuya Takahashi

    2015-12-01

    Full Text Available Sulfur is an advantageous material as a promising next-generation positive electrode material for high-energy lithium batteries due to a high theoretical capacity of 1672 mA h g−1 although its discharge potential is somewhat modest: ca. 2 V vs Li/Li+. However, a sulfur positive electrode has some crucial problems for practical use, which are mainly attributed to the dissolution of its intermediate products in charge–discharge processes. In order to resolve the dissolution problem of lithium polysulfide, we attempted to synthesize a sulfur–microporous activated carbon (AC composite positive electrode. Moreover, we have systematically researched the battery performance of sulfur–microporous AC positive electrode with variations of electrolytes as well as negative electrodes, and found its promising positive electrode performance for a next-generation rechargeable battery.

  13. Immunolocalization of arabinogalactan proteins (AGPs) in reproductive structures of an early-divergent angiosperm, Trithuria (Hydatellaceae).

    Science.gov (United States)

    Costa, Mário; Pereira, Ana Marta; Rudall, Paula J; Coimbra, Sílvia

    2013-02-01

    Trithuria is the sole genus of Hydatellaceae, a family of the early-divergent angiosperm lineage Nymphaeales (water-lilies). In this study different arabinogalactan protein (AGP) epitopes in T. submersa were evaluated in order to understand the diversity of these proteins and their functions in flowering plants. Immunolabelling of different AGPs and pectin epitopes in reproductive structures of T. submersa at the stage of early seed development was achieved by immunofluorescence of specific antibodies. AGPs in Trithuria pistil tissues could be important as structural proteins and also as possible signalling molecules. Intense labelling was obtained with anti-AGP antibodies both in the anthers and in the intine wall, the latter associated with pollen tube emergence. AGPs could play a significant role in Trithuria reproduction, due to their specific presence in the pollen tube pathway. The results agree with labellings obtained for Arabidopsis and confirms the importance of AGPs in angiosperm reproductive structures as essential structural components and probably important signalling molecules.

  14. The effect of length and cis/trans relationship of conjugated pathway on secondary battery performance in organolithium electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Walker, W.; Tarascon, J.M. [LRCS -UMR 6007- Universite de Picardie Jules Verne, Amiens (France); Materials Department, University of California Santa Barbara, CA (United States); Grugeon, S.; Laruelle, S.; Armand, M. [LRCS -UMR 6007- Universite de Picardie Jules Verne, Amiens (France); Vezin, H. [LCOM, CNRS, UMR-8516, Villeneuve d' Ascq (France); Wudl, F. [Materials Department, University of California Santa Barbara, CA (United States)

    2010-10-15

    As our society moves toward large volume applications for Li-ion batteries the inorganic materials traditionally associated with this technology will become scarce and expensive, therefore it is important to develop electrodes that can be manufactured from renewable sources. To this end a series of straight chain derivatives of lithium fumarate having conjugation pathways from one to four units and varying isomeric forms (i.e. cis-trans relationships) have been synthesized and studied in batteries utilizing Li as the counter electrode. These experiments have shown that trans versions of molecules with conjugation pathways of 2, 3, and 4 units reversibly intercalate {proportional_to} 1 Li per unit formula at a potential of {proportional_to} 1.4 V (vs. Li/Li+) while the corresponding cis derivatives show very limited reversible reactivity towards Li. Finally, the trans lithium fumarate shows no reversibility. (author)

  15. ‘Keeping head above water’: A case study in religious leadership in a polluted context

    Directory of Open Access Journals (Sweden)

    Ian A. Nell

    2014-10-01

    Toilets in the modern water closets rise up from the floor like water lilies. The architect does all he can to make the body forget how paltry it is and to make man ignore what happens to his intestinal wastes after the water from the tank flushes them down the drain … Spontaneously, without any theological training, I, as a child, grasped the incompatibility of God and shit and thus came to question the basic thesis of Christian anthropology, namely that man was created in God’s image. Either/or: either man was created in God’s image – and has intestines! – or God lacks intestines and man is not like him. (Milan Kundera, The unbearable lightness of being 1984:132 Water is life, sanitation is dignity. (City of Cape Town, n.d., ‘Water and sanitation services standard’, Preliminary draft 2, March 2008

  16. ATLAS Virtual Visit London-20-08-2014

    CERN Multimedia

    2014-01-01

    Working at the highest energy particle accelerator in the world, a group of scientists gathers each year to discuss the science and discovery potential of extremely energetic and complex phenomena that might emerge from the proton collisions at the LHC. The BOOST Conference of 2014 is hosted by the UCL HEP Group at the heart of London, and features an evening of particle physics, including an introduction to the Higgs and the Large Hadron Collider, a virtual visit to CERN hosted by David Miller of Chicago University, a talk by TEDx speaker Lily Asquith (Argonne National Lab/Sussex Uni) on sonification of LHC data, and a question and answer session! More information can be found on the conference website at: http://www.hep.ucl.ac.uk/boost2014/.

  17. A new, high energy Sn-C/Li[Li(0.2)Ni(0.4)/3Co(0.4)/3Mn(1.6/3)]O2 lithium-ion battery.

    Science.gov (United States)

    Elia, Giuseppe Antonio; Wang, Jun; Bresser, Dominic; Li, Jie; Scrosati, Bruno; Passerini, Stefano; Hassoun, Jusef

    2014-08-13

    In this paper we report a new, high performance lithium-ion battery comprising a nanostructured Sn-C anode and Li[Li0.2Ni0.4/3Co0.4/3Mn1.6/3]O2 (lithium-rich) cathode. This battery shows highly promising long-term cycling stability for up to 500 cycles, excellent rate capability, and a practical energy density, which is expected to be as high as 220 Wh kg(-1) at the packaged cell level. Considering the overall performance of this new chemistry basically related to the optimized structure, morphology, and composition of the utilized active materials as demonstrated by XRD, TEM, and SEM, respectively, the system studied herein is proposed as a suitable candidate for application in the lithium-ion battery field.

  18. Diuretics and Hypokalemia

    Directory of Open Access Journals (Sweden)

    Ali A. Handjani

    1970-01-01

    Full Text Available We have studied hypokalemic action of different diuretics in a cooperative study on 28 patients and our results are as follows: I. 28 patients (18 male and 10 female were the subject of our present study. 2. E. C. G. was taken systematically on all individuals. 3. Clinical signs and symptoms of hypokalemia was looked for in d lily examination of the patients. 4. Dietary K, Na, and CI could not be determined because of lack facilities. 5. Determination ed out in all patients. We strongly believe that small amount of potassium added to diuretics has no beneficial effect on delaying hypokalemia caused by these diuretics. 7. A rich diet containing adequate amount of potassium can sat, isfactorily prevent hypokalemia. 8. Furosemide and mercurial diuretics similarly cause hyponatremia rather than hypokalemia. 9. Thiazides cause hypokalemia rather than hyponatremia. 10. Addition of triamterene can delay the occurance of hypokale; mia in those patients taking thiazides,

  19. A New Look for the Globe Gardens

    CERN Multimedia

    Katarina Anthony

    2010-01-01

    Designs to develop the grounds of the Globe of Science and Innovation have recently been unveiled. The plan is to extend the visitor activities on offer, transforming the area into a public arena for scientific exploration.   Design for the new Globe Gardens. © Jencks Squared and Groupe H. After months of conceptual development, plans to develop the site around the Globe are taking shape. The innovative designs were drawn up for CERN by a unique collaboration consisting of landscape architects Charles and Lily Jencks, and "Groupe H", a group of architects headed by Globe designer Hervé Dessimoz. They comprise new venues, covered walkways, a café and gift shop, a separate VIP entrance and a physics-inspired garden for visitors. The landscape itself becomes a feature – dramatically altered to create a cosmic garden formed by shaped mounds, ponds, and a natural amphitheatre for public events. “The new exhibition in the G...

  20. KWIK Smoke Obscuration Model: User’s Guide.

    Science.gov (United States)

    1982-09-01

    t ’ustr ( td I IK,j) 384: prt 3o :: pr t 6 k AC 1-4G" 36~b : pr t " ~ L 3b7: if j~i;prt &t(t1,] 3 8 8: it J=2;pr. "&str(Zjl,1,KI) 3 0 9: j~r t "I 39u...t.2~t71. * j3 3 2u: w r t 7uX ,"i(Lz~j i21iJ "c3wt70, )i: lnt 4 5X, "irI I U uIL - = 01 17.2;wrt 701,kq3 j~b: Lirt. 45x,"a..~c4 uAT - LiLY = g,t4.2

  1. Compliant glass-polymer hybrid single ion-conducting electrolytes for lithium batteries.

    Science.gov (United States)

    Villaluenga, Irune; Wujcik, Kevin H; Tong, Wei; Devaux, Didier; Wong, Dominica H C; DeSimone, Joseph M; Balsara, Nitash P

    2016-01-05

    Despite high ionic conductivities, current inorganic solid electrolytes cannot be used in lithium batteries because of a lack of compliance and adhesion to active particles in battery electrodes as they are discharged and charged. We have successfully developed a compliant, nonflammable, hybrid single ion-conducting electrolyte comprising inorganic sulfide glass particles covalently bonded to a perfluoropolyether polymer. The hybrid with 23 wt% perfluoropolyether exhibits low shear modulus relative to neat glass electrolytes, ionic conductivity of 10(-4) S/cm at room temperature, a cation transference number close to unity, and an electrochemical stability window up to 5 V relative to Li(+)/Li. X-ray absorption spectroscopy indicates that the hybrid electrolyte limits lithium polysulfide dissolution and is, thus, ideally suited for Li-S cells. Our work opens a previously unidentified route for developing compliant solid electrolytes that will address the challenges of lithium batteries.

  2. Natural-Series Radionuclides in Traditional Aboriginal Foods in Tropical Northern Australia: A Review

    Directory of Open Access Journals (Sweden)

    Paul Martin

    2004-01-01

    Full Text Available This paper gives a review of available information on natural-series radionuclides in traditional Aboriginal foods of northern Australia. Research on this topic has been carried out primarily for radiological impact assessment purposes in relation to uranium mining activities in the region. Many of the studies have concentrated on providing purely concentration data or concentration ratios, although more detailed uptake studies have been undertaken for freshwater mussels, turtles, and water lilies. The most-studied radionuclides are 238U and 226Ra. However, dose estimates based on current data highlight the importance of 210Po, particularly for the natural (nonmining-related dose. Data on uptake by terrestrial flora and fauna are scarce in comparison with aquatic organisms, and this knowledge gap will need to be addressed in relation to planning for uranium minesite rehabilitation.

  3. Lithium salts based on a series of new anilinyl-perfluorosulfonamide salts and their polymer electrolytes

    Science.gov (United States)

    Thiam, A.; Iojoiu, C.; Leprêtre, J.-C.; Sanchez, J.-Y.

    2017-10-01

    Polymer electrolytes based on a series of new lithium anilinyl-perfluorosulfonamide exhibit conductivities close to LiTFSI ones and higher cationic transference numbers. Taking advantage of an extended delocalization on the negative charge, the anodic stability of the salts was found to range between 4.2 and 4.9 V vs Li/Li+, according to the electron-withdrawing group EWG located in para/ortho position. The simplicity of the synthesis process of the new salts, with lower fluorine content than LiPF6 and LiTFSI, paves the way for a further semi-pilot scale-up. Moreover, Linear Free Energy Relationships, LFER, were established for the first time, for both ionic conductivity and anodic stability. These LFER demonstrate unambiguously and quantitatively the conductivity dependence on anion basicity. Polymer electrolytes were soundly investigated through a variety of physicochemical and electrochemical characterizations.

  4. A fotorreportagem sobre o sequestro dos uruguaios na revista Veja, de 1978 a 1980: a atuação dos fotógrafos e o papel da fotografia = The photographs about the uruguayans kidnapping in Veja magazine, from 1978 to 1980: the photographer`s job and the role of the photography

    Directory of Open Access Journals (Sweden)

    Proença, Caio de Carvalho

    2014-01-01

    Full Text Available O presente artigo procura compreender o papel que as fotografias assumiram no decorrer de diversas reportagens sobre o caso do sequestro clandestino de dois uruguaios, Lilián Celiberti e Universindo Díaz, em Porto Alegre, publicadas na revista semanal Veja de 1978 a 1980 durante atuação da Operação Condor. Com base nas obras de Lorenzo Vilches e Jorge Pedro Sousa, tentaremos desenvolver algumas questões como: Qual o papel da fotografia, perante textos e legendas, nas páginas da revista? Perante um contexto específico do fotojornalismo nos principais meios de comunicação ocidentais, qual a importância da produção dos fotógrafos Ricardo Chaves e Olívio Lamas no caso do sequestro? Estes e outros assuntos serão brevemente apresentados

  5. Fossil Crinoids

    Science.gov (United States)

    Hess, Hans; Ausich, William I.; Brett, Carlton E.; Simms, Michael J.

    2003-01-01

    Crinoids have graced the oceans for more than 500 million years. Among the most attractive fossils, crinoids had a key role in the ecology of marine communities through much of the fossil record, and their remains are prominent rock forming constituents of many limestones. This is the first comprehensive volume to bring together their form and function, classification, evolutionary history, occurrence, preservation and ecology. The main part of the book is devoted to assemblages of intact fossil crinoids, which are described in their geological setting in twenty-three chapters ranging from the Ordovician to the Tertiary. The final chapter deals with living sea lilies and feather stars. The volume is exquisitely illustrated with abundant photographs and line drawings of crinoids from sites around the world. This authoritative account recreates a fascinating picture of fossil crinoids for paleontologists, geologists, evolutionary and marine biologists, ecologists and amateur fossil collectors.

  6. Three-dimensional incompressible flow in a two-sided non-facing lid-driven cubical cavity

    Science.gov (United States)

    Ben Beya, Brahim; Lili, Taieb

    2008-11-01

    Numerical simulations of the three-dimensional fluid flow in a two-sided non-facing lid-driven cubical cavity are presented. Computations have been carried out for several Reynolds numbers from a low value to 700. At low Reynolds numbers the flow is steady. The three dimensional flow characteristics are analyzed at Re=500. An analysis of the flow evolution shows that, when increasing Re beyond a certain critical value the flow becomes unstable and bifurcates. It is observed that the transition to unsteadiness follows the classical scheme of a Hopf bifurcation. The time dependent solution is studied and the critical Reynolds number is localized. To cite this article: B. Ben Beya, T. Lili, C. R. Mecanique 336 (2008).

  7. It sounds good!

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    Both the atmosphere and we ourselves are hit by hundreds of particles every second and yet nobody has ever heard a sound coming from these processes. Like cosmic rays, particles interacting inside the detectors at the LHC do not make any noise…unless you've decided to use the ‘sonification’ technique, in which case you might even hear the Higgs boson sound like music. Screenshot of the first page of the "LHC sound" site. A group of particle physicists, composers, software developers and artists recently got involved in the ‘LHC sound’ project to make the particles at the LHC produce music. Yes…music! The ‘sonification’ technique converts data into sound. “In this way, if you implement the right software you can get really nice music out of the particle tracks”, says Lily Asquith, a member of the ATLAS collaboration and one of the initiators of the project. The ‘LHC...

  8. Flora of the Mayacmas Mountains. [Listing of 679 species in the Geysers Geothermal Resource area

    Energy Technology Data Exchange (ETDEWEB)

    Neilson, J.A.

    1981-09-01

    This flora describes the plants that occur within the Mayacmas Mountain Range of northern California. It is the result of ten years of environmental assessment by the author in the Geysers Geothermal Resource area, located in the center of the Mayacmas Range. The flora includes notes on plant communities and ecology of the area, as well as habitat and collection data for most of the 679 species covered. Altogether 74 families, 299 genera and 679 species are included in the flora. The work is divided into eight subdivisions: trees; shrubs; ferns and fern allies; aquatic plants; tules, sedges, and rushes; lilies and related plants; dicot herbs; and grasses. Within each subdivision, family, genera and species are listed alphabetically. Keys are provided at the beginning of each subdivision. A unique combination of physical, environmental and geologic factors have resulted in a rich and diverse flora in the Mayacmas. Maps have been provided indicating known locations for species of rare or limited occurrence.

  9. Stitching Codeable Circuits: High School Students' Learning About Circuitry and Coding with Electronic Textiles

    Science.gov (United States)

    Litts, Breanne K.; Kafai, Yasmin B.; Lui, Debora A.; Walker, Justice T.; Widman, Sari A.

    2017-10-01

    Learning about circuitry by connecting a battery, light bulb, and wires is a common activity in many science classrooms. In this paper, we expand students' learning about circuitry with electronic textiles, which use conductive thread instead of wires and sewable LEDs instead of lightbulbs, by integrating programming sensor inputs and light outputs and examining how the two domains interact. We implemented an electronic textiles unit with 23 high school students ages 16-17 years who learned how to craft and code circuits with the LilyPad Arduino, an electronic textile construction kit. Our analyses not only confirm significant increases in students' understanding of functional circuits but also showcase students' ability in designing and remixing program code for controlling circuits. In our discussion, we address opportunities and challenges of introducing codeable circuit design for integrating maker activities that include engineering and computing into classrooms.

  10. Common questions in veterinary toxicology.

    Science.gov (United States)

    Bates, N; Rawson-Harris, P; Edwards, N

    2015-05-01

    Toxicology is a vast subject. Animals are exposed to numerous drugs, household products, plants, chemicals, pesticides and venomous animals. In addition to the individual toxicity of the various potential poisons, there is also the question of individual response and, more importantly, of species differences in toxicity. This review serves to address some of the common questions asked when dealing with animals with possible poisoning, providing evidence where available. The role of emetics, activated charcoal and lipid infusion in the management of poisoning in animals, the toxic dose of chocolate, grapes and dried fruit in dogs, the use of antidotes in paracetamol poisoning, timing of antidotal therapy in ethylene glycol toxicosis and whether lilies are toxic to dogs are discussed. © 2015 British Small Animal Veterinary Association.

  11. Treatment of adults with attention-deficit/hyperactivity disorder

    Directory of Open Access Journals (Sweden)

    Dusan Kolar

    2008-04-01

    Full Text Available Dusan Kolar, Amanda Keller, Maria Golfinopoulos, Lucy Cumyn, Cassidy Syer, Lily HechtmanDepartment of Psychiatry, Montreal Children’s Hospital, McGill University, Montreal, CanadaAbstract: This review focuses on the treatment of attention deficit hyperactivity disorder (ADHD in adults. It briefly addresses prevalence, diagnostic and differential diagnostic issues specific to adults. Stimulant medication, non-stimulant medication, and psychosocial treatments are thoroughly reviewed. For each class of medication possible mechanism of action, efficacy and side effects are summarized. Special attention is given to the pharmacological treatment for patients with adult ADHD and various comorbidities. In summary, stimulant medications are most effective and combined medication and psychosocial treatment is the most beneficial treatment option for most adult patients with ADHD.Keywords: adult ADHD, medication, stimulants, cognitive-behavioral therapy

  12. Treatment of adults with attention-deficit/hyperactivity disorder

    Directory of Open Access Journals (Sweden)

    Dusan Kolar

    2008-03-01

    Full Text Available Dusan Kolar, Amanda Keller, Maria Golfinopoulos, Lucy Cumyn, Cassidy Syer, Lily HechtmanDepartment of Psychiatry, Montreal Children’s Hospital, McGill University, Montreal, CanadaAbstract: This review focuses on the treatment of attention deficit hyperactivity disorder (ADHD in adults. It briefly addresses prevalence, diagnostic and differential diagnostic issues specific to adults. Stimulant medication, non-stimulant medication, and psychosocial treatments are thoroughly reviewed. For each class of medication possible mechanism of action, efficacy and side effects are summarized. Special attention is given to the pharmacological treatment for patients with adult ADHD and various comorbidities. In summary, stimulant medications are most effective and combined medication and psychosocial treatment is the most beneficial treatment option for most adult patients with ADHD.Keywords: adult ADHD, medication, stimulants, cognitive-behavioral therapy

  13. An oxysulfate Fe₂O(SO₄)₂ electrode for sustainable Li-based batteries.

    Science.gov (United States)

    Sun, Meiling; Rousse, Gwenaëlle; Abakumov, Artem M; Van Tendeloo, Gustaaf; Sougrati, Moulay-Tahar; Courty, Matthieu; Doublet, Marie-Liesse; Tarascon, Jean-Marie

    2014-09-10

    High-performing Fe-based electrodes for Li-based batteries are eagerly pursued because of the abundance and environmental benignity of iron, with especially great interest in polyanionic compounds because of their flexibility in tuning the Fe(3+)/Fe(2+) redox potential. We report herein the synthesis and structure of a new Fe-based oxysulfate phase, Fe2O(SO4)2, made at low temperature from abundant elements, which electrochemically reacts with nearly 1.6 Li atoms at an average voltage of 3.0 V versus Li(+)/Li, leading to a sustained reversible capacity of ≈125 mAh/g. The Li insertion-deinsertion process, the first ever reported in any oxysulfate, entails complex phase transformations associated with the position of iron within the FeO6 octahedra. This finding opens a new path worth exploring in the quest for new positive electrode materials.

  14. Circadian rhythms in biologically closed electrical circuits of plants.

    Science.gov (United States)

    Volkov, Alexander; Waite, Astian J; Wooten, Joseph D; Markin, Vladislav S

    2012-02-01

    The circadian clock regulates a wide range of electrophysiological and developmental processes in plants. Here, we discuss the direct influence of a circadian clock on biologically closed electrochemical circuits in vivo. The biologically closed electrochemical circuits in the leaves of C. miniata (Kaffir lily), Aloe vera and Mimosa pudica, which regulate their physiology, were analyzed using the charge stimulation method. Plants are able to memorize daytime and nighttime. Even at continuous light or darkness, plants recognize nighttime or daytime and change the input resistance. The circadian clock can be maintained endogenously and has electrochemical oscillators, which can activate ion channels in biologically closed electrochemical circuits. The activation of voltage gated channels depends on the applied voltage, electrical charge, and the speed of transmission of electrical energy from the electrostimulator to plants.

  15. Insight into poor cycling stability of MgH2anodes

    DEFF Research Database (Denmark)

    Huen, Priscilla; Ravnsbæk, Dorthe B.

    2017-01-01

    During recent years, MgH2 has received significant interest as conversion-type anode for Li-ion batteries due to the high theoretical capacity of 2038 mAh/g at ~0.5 V vs. Li+/Li. However, the practical reversible capacity and the cycle stability are generally poor and vary significantly among...... literature reports. The latter may be due to differences in preparation procedures for electrodes as well as the precise cycling conditions. In this study, a series of MgH2 samples was systematically prepared by ball milling with different conductive carbon sources and use of hydrogenation treatments....... The effects of different preparation methods on cell efficiency and cycle stability are examined, showing that crystallite size reduction and ball milling together with the selected carbon source is important both for increasing capacity and limiting polarization. Furthermore, the conversion mechanism...

  16. THE CHRISTIAN SYMBOLISM OF FLOWERS IN V.V. GOFMAN`S LYRICS

    Directory of Open Access Journals (Sweden)

    Nina Borisovna Cherepanova

    2012-11-01

    Full Text Available The article examines the poetry of a relatively unknown poet of the Russian Silver Age, V.V. Gofman (The Book of Introductions, 1904; Iskus (Temptation, 1910 in the light of its links with the Gospel. As early as in Gofman's first collection of poems motifs from the Gospel come together with flower imagery. Flowers in Gofman's poems act as markers of the Paradise, the locus of eternity, truth and harmony. Flower imagery is also an important element of the image of the Faraway Lady – one of the centerpieces of Gofman's poems. Gofman's second collection, Iskus (Temptation (1910 reveals more conscious and clear allusions to the Gospel: the title refers to the Christian tradition, and the most important flower in the poetic 'flowerbed' is the lily with its clear biblical symbolism. We conclude by reaffirming the conceptual importance of the biblical plane in the poetry of V.V. Gofman.

  17. Child sexual abuse in Madurai, India: a literary review and empirical study.

    Science.gov (United States)

    Karthiga, R K Jaishree; Ravikumar, Roopa

    2014-01-01

    This article attempts to explore the cultural and patriarchal relevance of child sexual abuse in a conservative town in India, with a special interest in understanding the current problems experienced by teenage girls in India. A questionnaire was distributed to 100 respondents who belonged to Thiagarajar College of Engineering, Thiruparangundram, Madurai. The questionnaire was developed with special reference to the female protagonist, Lily in Jaishree Misra's Secrets and Lies. The resulting article also includes an e-interview with Jaishree Misra. The researchers hypothesize that change can be envisioned when the social conscience is awakened to cruel events that happen in the Indian population. Change regarding social events must go even further to allow children to blossom and experience the joys of childhood.

  18. Massively Parallelized Pollen Tube Guidance and Mechanical Measurements on a Lab-on-a-Chip Platform.

    Science.gov (United States)

    Shamsudhin, Naveen; Laeubli, Nino; Atakan, Huseyin Baris; Vogler, Hannes; Hu, Chengzhi; Haeberle, Walter; Sebastian, Abu; Grossniklaus, Ueli; Nelson, Bradley J

    2016-01-01

    Pollen tubes are used as a model in the study of plant morphogenesis, cellular differentiation, cell wall biochemistry, biomechanics, and intra- and intercellular signaling. For a "systems-understanding" of the bio-chemo-mechanics of tip-polarized growth in pollen tubes, the need for a versatile, experimental assay platform for quantitative data collection and analysis is critical. We introduce a Lab-on-a-Chip (LoC) concept for high-throughput pollen germination and pollen tube guidance for parallelized optical and mechanical measurements. The LoC localizes a large number of growing pollen tubes on a single plane of focus with unidirectional tip-growth, enabling high-resolution quantitative microscopy. This species-independent LoC platform can be integrated with micro-/nano-indentation systems, such as the cellular force microscope (CFM) or the atomic force microscope (AFM), allowing for rapid measurements of cell wall stiffness of growing tubes. As a demonstrative example, we show the growth and directional guidance of hundreds of lily (Lilium longiflorum) and Arabidopsis (Arabidopsis thaliana) pollen tubes on a single LoC microscopy slide. Combining the LoC with the CFM, we characterized the cell wall stiffness of lily pollen tubes. Using the stiffness statistics and finite-element-method (FEM)-based approaches, we computed an effective range of the linear elastic moduli of the cell wall spanning the variability space of physiological parameters including internal turgor, cell wall thickness, and tube diameter. We propose the LoC device as a versatile and high-throughput phenomics platform for plant reproductive and development biology using the pollen tube as a model.

  19. Shutdown potential adjustment of modified carbene adducts as additives for lithium ion battery electrolytes

    Science.gov (United States)

    Janssen, Pia; Streipert, Benjamin; Krafft, Roman; Murmann, Patrick; Wagner, Ralf; Lewis-Alleyne, Lesley; Röschenthaler, Gerd-Volker; Winter, Martin; Cekic-Laskovic, Isidora

    2017-11-01

    To improve the intrinsic safety of lithium ion batteries (LIBs) by preventing cells from a thermal runaway, we studied two carbene adduct electrolyte additives. The recently synthesized compounds (1,3-dimethylimidazolidin-2-μm-trifluoroborate (NHC-BF3) and 1,3-dimethylimidazolidin-2-μm-tetrafluorotrifluoromethylphosphate (NHC-PF4CF3)) were investigated on LiNi1/3Co1/3Mn1/3O2 (NMC111) electrodes in Li metal and Li-ion cell setups as overcharge protection shutdown additives in 1M LiPF6 in EC:DEC (3:7, by wt.) electrolyte. By varying the NHC-ligand (-BF3, -PF5, -PF4CF3) in the molecule, the shutdown potential of the investigated carbene adduct electrolyte additives can be tailored for specific applications with different cut-off potentials. NHC-BF3 was identified as a promising candidate for the application with NMC111 electrodes up to 4.4 V vs. Li/Li+, whereas the carbene adduct NHC-PF4CF3 is ideal for the high-voltage application with the NMC-based electrode up to 4.6 V vs. Li/Li+. Next to electrochemical investigations in NMC111/Li and NMC111/graphite cells, Atomic Force Microscopy (AFM) and X-Ray Photoelectron Spectroscopy (XPS) were performed to verify the presence of a decomposition layer on the cathode, responsible for the shutdown effect. Furthermore, it has been proven that the investigated electrolyte additives have no influence on the cell performance under normal conditions in both, Li metal and Li-ion cell setups.

  20. Tulipa gesneriana and Lilium longiflorum PEBP Genes and Their Putative Roles in Flowering Time Control.

    Science.gov (United States)

    Leeggangers, Hendrika A C F; Rosilio-Brami, Tamar; Bigas-Nadal, Judit; Rubin, Noam; van Dijk, Aalt D J; Nunez de Caceres Gonzalez, Francisco F; Saadon-Shitrit, Shani; Nijveen, Harm; Hilhorst, Henk W M; Immink, Richard G H; Zaccai, Michele

    2018-01-01

    Floral induction in Tulipa gesneriana and Lilium longiflorum is triggered by contrasting temperature conditions, high and low temperature, respectively. In Arabidopsis, the floral integrator FLOWERING LOCUS T (FT), a member of the PEBP (phosphatidyl ethanolamine-binding protein) gene family, is a key player in flowering time control. In this study, one PEBP gene was identified and characterized in lily (LlFT) and three PEBP genes were isolated from tulip (TgFT1, TgFT2 and TgFT3). Overexpression of these genes in Arabidopsis thaliana resulted in an early flowering phenotype for LlFT and TgFT2, but a late flowering phenotype for TgFT1 and TgFT3. Overexpression of LlFT in L. longiflorum also resulted in an early flowering phenotype, confirming its proposed role as a flowering time-controlling gene. The tulip PEBP genes TgFT2 and TgFT3 have a similar expression pattern in tulip, but show opposite effects on the timing of flowering in Arabidopsis. Therefore, the difference between these two proteins was further investigated by interchanging amino acids thought to be important for the FT function. This resulted in the conversion of phenotypes in Arabidopsis upon overexpressing the substituted TgFT2 and TgFT3 genes, revealing the importance of these interchanged amino acid residues. Based on all obtained results, we hypothesize that LlFT is involved in creating meristem competence to flowering-related cues in lily, and TgFT2 is considered to act as a florigen involved in the floral induction in tulip. The function of TgFT3 remains unclear, but, based on our observations and phylogenetic analysis, we propose a bulb-specific function for this gene. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  1. Phenolic Compounds and Antioxidant Activity of Bulb Extracts of Six Lilium Species Native to China

    Directory of Open Access Journals (Sweden)

    Lixin Niu

    2012-08-01

    Full Text Available Lily (Lilium is used as an important edible and medical plant species with a vague taxonomic classification and a long history in China. Bulbs of six Lilium species (L. regale, L. concolor, L. pumilum, L. leucanthum, L. davidii var. unicolor and L. lancifolium native to China were investigated with a view to their exploitation as a potential source of natural antioxidants due to their phenolic composition and dietary antioxidant potential. The results showed that all bulb extracts exhibited strong antioxidant activities, which generally correlated positively with the total phenolic contents (r = 0.68 to 0.94, total flavonoid contents (r = 0.51 to 0.89 and total flavanol contents (r = 0.54 to 0.95. High-performance liquid chromatography (HPLC analysis revealed that rutin and kaempferol were the major phenolic components in the extracts. Hierarchical cluster analysis showed that L. regale belonged to the group with high phenolic content and strong antioxidant power. L. concolor and L. pumilum were arranged in one group characterized by moderate phenolic content and antioxidant capacity, while L. leucanthum, L. davidii var. unicolor and L. lancifolium were clustered in the third group with low phenolic content and weak antioxidant activity. These strongly suggest that lily bulbs may serve as a potential source of natural antioxidant for food and pharmaceutical applications.

  2. Second Language Perception of Mandarin Vowels and Tones.

    Science.gov (United States)

    Hao, Yen-Chen

    2017-07-01

    This study examines the discrimination of Mandarin vowels and tones by native English speakers with varying amounts of Mandarin experience, aiming to investigate the relative difficulty of these two types of sounds for English speakers at different learning stages, and the source of their difficulty. Seventeen advanced learners of Mandarin (Ex group), eighteen beginning learners (InEx group), and eighteen English speakers naïve to Mandarin (Naïve group) participated in an AXB discrimination task. The stimuli were two Mandarin vowel contrasts, /li-ly/ and /lu-ly/, and two tonal contrasts, T1-T4 and T2-T3. The predicted difficulty for each contrast was hypothesized based on the assimilation of these sounds to English reported in previous work. The results showed that the Naïve group was more accurate with vowel contrasts than with tones, suggesting that non-tonal language speakers without any Mandarin training are less sensitive to tonal distinction than to vowels. The two learner groups, on the other hand, were highly accurate with all contrasts except for the T2-T3 pair, and achieved significantly higher accuracy than the Naïve group on /li-ly/ and T1-T4. This lends support to the view that experience in Mandarin improves English speakers' sensitivity to tonal distinction, helping them discriminate some tones as accurately as vowels. However, all three groups achieved low accuracy in discriminating T2 and T3, suggesting that this contrast may be inherently difficult and resistant to improvement. This study shows that various factors in addition to the native language experience may affect the perception of non-native vowels and tones.

  3. La construcción sociocultural del miedo y el coraje en un internado de religiosas. una narración personal contada con necesidad

    Directory of Open Access Journals (Sweden)

    Josefina Ramírez Velázquez

    2014-04-01

    Full Text Available Desde el 2007 inicié un desafío teórico-metodológico al proponer estudiar el trastorno psicogénico o histeria colectiva que aquejó a más de 500 alumnas de un internado de religiosas en México. Dicho desafío se orientó desde la Antropología Física Crítica que destaca al cuerpo más allá de la biología, es decir como espacio de producción de sentido que refiere un circuito entre pensamiento- discurso-sentimiento-praxis. Desde esta noción pude vislumbrar la importancia de respuestas corporales pautadas por numerosas emociones, las cuales siempre hicieron referencia a un contexto y a una situacionalidad, en ambos casos, tensados por relaciones de poder y dominación en las que se encuentran inmersas las internas. En esta participación expondré la narrativa vigorosa y profundamente emocional de Lili, una ex interna, quien estudiaba el 3º de secundaria en el internado,  cuando en éste se desató la epidemia de histeria, mostrando elementos claves para la comprensión de la misma.  El presente trabajo se orienta a través de mi voz narrativa, a fin de ordenar y exponer en un marco de referencias teórico y conceptual la propia voz narrativa de Lili. Pero ésta última, sin duda, cobra la centralidad debido a la amplia mirada para explicar el fenómeno.  

  4. La construcción sociocultural del miedo y el coraje en un internado de religiosas. Una narración personal contada con necesidad

    Directory of Open Access Journals (Sweden)

    Josefina Ramírez Velázquez

    2014-04-01

    Full Text Available Desde el 2007 inicié un desafío teórico-metodológico al proponer estudiar el trastorno psicogénico o histeria colectiva que aquejó a más de 500 alumnas de un internado de religiosas en México. Dicho desafío se orientó desde la Antropología Física Crítica que destaca al cuerpo más allá de la biología, es decir, como espacio de producción de sentido que refiere un circuito entre pensamiento- discurso-sentimiento-praxis. Desde esta noción pude vislumbrar la importancia de respuestas corporales pautadas por numerosas emociones, las cuales siempre hicieron referencia a un contexto y a una situacionalidad, en ambos casos, tensados por relaciones de poder y dominación en las que se encuentran inmersas las internas. En esta participación expondré la narrativa vigorosa y profundamente emocional de Lili, una ex interna, quien estudiaba el 3º de secundaria en el internado, cuando en éste se desató la epidemia de histeria, mostrando elementos claves para la comprensión de la misma. El presente trabajo se orienta a través de mi voz narrativa, a fin de ordenar y exponer, en un marco de referencias teórico y conceptual, la propia voz narrativa de Lili. Pero ésta última, sin duda, cobra centralidad debido a la amplia mirada para explicar el fenómeno

  5. Identifying the Basal Angiosperm Node in Chloroplast GenomePhylogenies: Sampling One's Way Out of the Felsenstein Zone

    Energy Technology Data Exchange (ETDEWEB)

    Leebens-Mack, Jim; Raubeson, Linda A.; Cui, Liying; Kuehl,Jennifer V.; Fourcade, Matthew H.; Chumley, Timothy W.; Boore, JeffreyL.; Jansen, Robert K.; dePamphilis, Claude W.

    2005-05-27

    While there has been strong support for Amborella and Nymphaeales (water lilies) as branching from basal-most nodes in the angiosperm phylogeny, this hypothesis has recently been challenged by phylogenetic analyses of 61 protein-coding genes extracted from the chloroplast genome sequences of Amborella, Nymphaea and 12 other available land plant chloroplast genomes. These character-rich analyses placed the monocots, represented by three grasses (Poaceae), as sister to all other extant angiosperm lineages. We have extracted protein-coding regions from draft sequences for six additional chloroplast genomes to test whether this surprising result could be an artifact of long-branch attraction due to limited taxon sampling. The added taxa include three monocots (Acorus, Yucca and Typha), a water lily (Nuphar), a ranunculid(Ranunculus), and a gymnosperm (Ginkgo). Phylogenetic analyses of the expanded DNA and protein datasets together with microstructural characters (indels) provided unambiguous support for Amborella and the Nymphaeales as branching from the basal-most nodes in the angiospermphylogeny. However, their relative positions proved to be dependent on method of analysis, with parsimony favoring Amborella as sister to all other angiosperms, and maximum likelihood and neighbor-joining methods favoring an Amborella + Nympheales clade as sister. The maximum likelihood phylogeny supported the later hypothesis, but the likelihood for the former hypothesis was not significantly different. Parametric bootstrap analysis, single gene phylogenies, estimated divergence dates and conflicting in del characters all help to illuminate the nature of the conflict in resolution of the most basal nodes in the angiospermphylogeny. Molecular dating analyses provided median age estimates of 161 mya for the most recent common ancestor of all extant angiosperms and 145 mya for the most recent common ancestor of monocots, magnoliids andeudicots. Whereas long sequences reduce variance in

  6. Case report: a rare case of attempted homicide with Gloriosa superba seeds.

    Science.gov (United States)

    Kande Vidanalage, Chaminda J; Ekanayeka, Rohan; Wijewardane, Deepthi K

    2016-06-21

    Gloriosa superba, well known as the glory lily or superb lily, is a tropical climbing plant that features an exotic red flower. The plant is poisonous because of high concentrations of colchicine in all parts of the plant. It is commercially grown for use in Ayurveda medicine and as a cash crop for extracting colchicine in India and Africa. It is a wild plant in Sri Lanka and commercial cultivation is rare. Accidental and suicidal poisonings with Gloriosa tubers are well known and reported. There are no case reports of poisoning by Gloriosa seeds in Sri Lanka. Google and PubMed searches showed no reported cases of poisoning with seeds or their use with homicidal intent in other parts of the world. A 27-year-old man was brought to hospital with profuse vomiting and diarrhea after drinking coriander tea, which is a common traditional treatment for common cold. The family members suspected poisoning by Gloriosa because they had seeds at home and the victim's sister-in-law who had made the herbal tea went missing from home. They were able to identify Gloriosa seeds, which looked similar to coriander, in the pot. The patient developed shock and respiratory distress and needed ventilation and intensive care. He also developed mild renal impairment, and thrombocytopenia. He developed massive generalized alopecia while recovering from acute illness. Full recovery was achieved after 15 days of hospital care. There are many poisonous plants in Asian countries. This case highlights the possibility of accidental or intentional use of Gloriosa seeds or its extracts to cause potentially fatal poisoning. It would be difficult to identify Gloriosa as the cause of poisoning without any background information because of multiple complications that can mimic a systemic infection. This case is a good example of the use of plants as biological weapons.

  7. Assessment of the accuracy of preoperative imaging methods in the diagnosis of hepatic single-chamber echinococcosis.

    Science.gov (United States)

    Hołody-Zaręba, Joanna; Zaręba, Konrad Piotr; Kędra, Bogusław

    2013-12-01

    Echinococcosis is an infectious disease, caused by larval stages of cestode species of the genus Echinococcus. The course of the disease is determined on the basis of the location and larval size. In 80-95% of cases echinococcosis is located in the liver and lungs, rarely in the brain. Symptoms are usually uncharacteristic for an uncomplicated disease. The diagnosis of echinococcosis is based on imaging and immunodiagnostic tests. The aim of the study was to assess the accuracy of preoperative imaging methods in the diagnosis of hepatic single- chamber echinococcosis. Amongst the 110 patients with hepatic cysts diagnosed during the period between 2000 and 2009, a group of 30 subjects with suspicion of single-chamber echinococcosis (ultrasound and CT) was isolated. The imaging methods visualized structures typical for hydatid cysts: the mother cyst with satellite cysts called " honeycomb appearance", cysts with calcified walls and compartments, and endocyst separation called "water lily-sign". The study group comprised 22 female and 8 male patients with an average age of 52±16.2 years. The histopathological examination of the excised cyst verified the diagnosis. Single-chamber echinococcosis was finally recognized in 19 cases, while in the 11 remaining cases the parasitic disease was excluded. The sensitivity of imaging methods was estimated at 73.7%, specificity - 88.9%, negative predictive value - 61.5%, positive predictive value - 93.3%, Youden`s factor - 0.626, and Φ index - 0.586. In conclusion, the presence of an unilocular cyst with an uniform anechoic content can be a simple cyst or single-chamber echinococcus cyst. The typical, characteristic image of a hydatid cyst, such as the "water lily-sign" is rarely observed during imaging examinations. It has also been shown that cystic calcification, observed during ultrasonography and computed tomography was evidence of the parasitic character of the lesion.

  8. Izplatītākie zemnieku vārdi Vidzemē 17. gadsimta pirmajā pusē

    Directory of Open Access Journals (Sweden)

    Renāte Siliņa-Piņķe

    2014-11-01

    Full Text Available Rakstā tiek analizēti 1638. gada zviedru arklu revīzijā fiksētie latviešu zemnieku personvārdi. Raksta mērķis ir noskaidrot izplatītākos vārdus un veikt to analīzi; kā arī balstoties analīzē izdarīt secinājumus par personvārdu pieraksta specifiku avotā un tā iespējamo lomu turpmākā latviešu personvārdu vēstures izpētē. Analīzes procesā vārdi ir salīdzināti ar atbilstošā laika vācu personvārdiem, ņemot vērā gan to pierakstu vācu avotos, gan iespējamās adaptācijas pazīmes revīzijas dokumentos. Pavisam ir saskaitīti 11 995 latviešu zemnieki, minot 829 vārdu variantus. Revīzijas protokolsir rakstīts agrīnajā jaunaugšvācu valodā, un tajā parādās iespējamās latviešu izrunas un vāciskā pieraksta atšķirības dažādos līmeņos: no vācu pilnajām un saīsinātajām formām – kā Heinrich, Wilhelm, Tieß u. c. – līdz pat skaidri saskatāmiem latviskojumiem kā Andrens, Brentzitis, Erman u. c. Tāpat ir fiksētas, iespējams, kļūdaini pierakstītas un nesaprotamas formas, piemēram, Dohße, Lagingz, Peyte u. c. Šo apstākļu dēļ vārdi analīzei tika grupēti, vienā grupā iekļaujot:1 vācu personvārdu vārdnīcās minētos vārda rakstības variantus,2 adaptētās formas ar dažādām latviešu valodas izskaņām,3 avotā fiksētos alonomus,4 rakstvežu nekonsekventās rakstības vai iespējamās pārrakstīšanās un neuzmanības kļūdas.Padziļināti ir analizētas desmit izplatītāko priekšvārdu grupas – Hans (1377 personas jeb 11,5% no visiem minētajiem zemniekiem, Jahn (1194, 10%, Peter (985, 8,2%, Jacob (780, 6,5%, Andres (631, 5,3%, Jurgen (564, 4,7%, Matz (548, 4,6%, Thomas (497, 4,1%, Hinrich (489, 4%, Michell (442, 3,7%. Katra grupa ir nosaukta pēc visizplatītākās vārda formas. Šajās desmit grupās ietvertie 7507 priekšvārdi veido gandrīz divas trešdaļas (62,6 % no visiem revīzijas protokolā minētajiem zemnieku vārdiem. Vārdu pieraksta zi

  9. Development and dry mass accumulation in callalily at the initial cultivation stage Desenvolvimento e acúmulo de massa seca em copo-de-leite em fase inicial de cultivo

    Directory of Open Access Journals (Sweden)

    Daniella Nogueira Moraes Carneiro

    2011-12-01

    Full Text Available The cultivation of the calla lily, despite its importance in the floriculture sector, is still limited due to the lack of knowledge of basic production techniques such as development and dry mass accumulation. These techniques facilitate more appropriate management, especially regarding the application of fertilizers, providing better nutrients utilization and greater yields. Thus, this study was aimed at evaluating the growth and development of calla lily plants, establishing growth curves according to dry mass accumulation. Acclimatized and micropropagated calla lily plantlets were grown in plastic pots containing coconut fiber as a substrate and fertilized with a modified formula of Malavolta. Treatments consisted of assessments at intervals of 30 days for 7 months. The design was in randomized blocks with four replications, in a total of 28 plots. Plants were evaluated by observing their growth characteristics and development of shoots, rhizome, roots, as well as production and flower quality. Development of the plants increased throughout the experimental period, with the maximum dry mass accumulation occurring at the end of the experimental period. Blooming was constant with the length of flower stalks increasing with along with the age of the plant.O cultivo de Zantedeschia aethiopica, apesar de sua importância no segmento da floricultura, ainda é limitado pelo reduzido conhecimento em técnicas básicas de produção, como o desenvolvimento e acúmulo de massa seca. Essas informações permitem um manejo mais adequado, sobretudo referente à aplicação de fertilizantes, proporcionando melhor aproveitamento de nutrientes e maiores produções. Dessa forma, neste estudo, objetivou-se avaliar o crescimento e desenvolvimento de plantas de copo-de-leite, estabelecendo curvas de crescimento, considerando o acúmulo de massa seca. Para tanto, mudas micropropagadas e aclimatizadas de copo-de-leite foram cultivadas em vasos plásticos contendo

  10. Lesbian Continuum As An Alternative Strategy In Negotiating Heteronormativity In Sarah Water’s Fingersmith

    Directory of Open Access Journals (Sweden)

    Mega Hayuningtyas Erwanti

    2015-12-01

    Full Text Available This study is conducted to examine the portrayal of a lesbian continuum in Sarah Waters’ Fingersmith. To conduct the analysis, there are two research questions: first, how is the construction of lesbian continuum portrayed in the relationship between Susan Trinder and Maud Lilly and how does lesbian continuum become a strategy to negotiate compulsory heterosexuality. In doing the analysis, the theory of lesbian continuum which is proposed by Adrienne Rich will be used to elaborate the novel. This study is a qualitative research where the data are taken from the novel Fingersmith, library research, journals, and other relevant sources. To gain the comprehensive analysis, this study uses some methods which are: close reading, postulation the statements of the problems, data classification, and analysis using the lesbian continuum theory, supporting analysis through library research, books, and academic journals. This study finds that the characters of Susan Trinder and Maud Lilly can be identified as having a double life which constructs the lesbian continuum. Moreover, the lesbian continuum becomes a strategy to negotiate compulsory heterosexuality with denial and negotiation of women’s oppression. Abstrak: Artikel ini mengkaji representasi lesbian continuum dalam novel Sarah Waters yang berjudul Fingersmith. Dua pertanyaan utama penelitian ini adalah (1 bagaimana konstruksi lesbian continuum direpresentasikan dalam hubungan antara tokoh Susan Trinder dan Maud Lily dalam novel Fingersmith dan (2 bagaimana lesbian continuum menjadi strategi untuk menghadapi compulsory heterosexuality dalam novel Fingersmith. Teori lesbian continuum oleh Adrienne Rich akan menjadi teori utama untuk menjawab pertanyaan penelitian. Menggunakan teknik pembacaan novel dan analisis pustaka yang bersumber dari jurnal dan sumber lain yang mendukung. Untuk mendapatkan data yang komprehensip, metode yang dipakai adalah close reading, menjabarkan pertanyaan, klasifikasi

  11. Lithium salt with a super-delocalized perfluorinated sulfonimide anion as conducting salt for lithium-ion cells: Physicochemical and electrochemical properties

    Science.gov (United States)

    Zhang, Heng; Han, Hongbo; Cheng, Xiaorong; Zheng, Liping; Cheng, Pengfei; Feng, Wenfang; Nie, Jin; Armand, Michel; Huang, Xuejie; Zhou, Zhibin

    2015-11-01

    Lithium salt with a super-delocalized imide anion, namely (trifluoromethane(S-trifluoromethanesulfonylimino)sulfonyl) (trifluoromethanesulfonyl)imide ([CF3SO(=NSO2CF3)2]-), [sTFSI]-), has been prepared and studied as conducting salt for Li-ion cells. The fundamental physicochemical and electrochemical properties of neat Li[sTFSI] and its carbonate-based liquid electrolyte have been characterized with various chemical and electrochemical tools. Li[sTFSI] shows a low melting point at 118 °C, and is thermally stable up to 300 °C without decomposition on the spectra of differential scanning calorimetry-thermogravimetry-mass spectrometry (DSC-TG-MS). The electrolyte of 1.0 M (mol dm-3) Li[sTFSI] in ethylene carbonate (EC)/ethyl-methyl-carbonate (EMC) (3:7, v/v) containing 0.3% water does not show any hydrolytic decomposition on the spectra of 1H and 19F NMR, after storage at 85 °C for 10 days. The conductivities of 1.0 M Li[sTFSI]-EC/EMC (3:7, v/v) are slightly lower than those of Li[(CF3SO2)2N] (LiTFSI), but higher than those of Li[(C2F5SO2)2N] (LiBETI). The electrochemical behavior of Al foil in the Li[sTFSI]-based electrolyte has been investigated by using cyclic voltammetry and chronoamperometry, and scanning electron microscope (SEM). It is illustrated that Al metal does not corrode in the high potential region (3-5 V vs. Li/Li+) in the Li[sTFSI]-based electrolyte. On Pt electrode, the Li[sTFSI]-based electrolyte is highly resistant to oxidation (ca. 5 V vs. Li/Li+), and is also resistant to reduction to allow Li deposition and stripping. The applicability of Li[sTFSI] as conducting salt for Li-ion cells has been tested using graphite/LiCoO2 cells. It shows that the cell with Li[sTFSI] displays better cycling performance than that with LiPF6.

  12. USO DE NUEVAS METODOLOGÍAS EN LA PRÁCTICA CLÍNICA: ESTUDIO DE LA AMPLIFICACIÓN DEL ONCOGÉN HER2 CON HIBRIDACIÓN IN SITU CROMOGÉNICA Y CON PLATA (DUAL ISH EN EL CÁNCER DE MAMA

    Directory of Open Access Journals (Sweden)

    Luz Fernanda Sua

    2014-10-01

    Full Text Available Introducción: La determinación del oncogén HER2 es crítica en las pacientes que responderán al anticuerpo monoclonal humanizado Trastuzumab. La técnica de hibridación in situ cromogénica y con plata (Dual ISH ha sido exitosamente probada en la detección de la amplificación del gen HER2, un importante biomarcador del cáncer de mama que combina las ventajas de la automatización y la microscopía de luz, mejorando el flujo de trabajo en el laboratorio. Objetivos: verificar si la metodología automatizada de hibridización in situ cromogénica y con plata (Dual ISH realizada en el equipo Benchmark XT de Ventana Medical Systems® puede ser comparable con la hibridización in situ fluorescente (FISH en casos de la Fundación Valle del Lili. Metodología: Previa aprobación del Comité de Ética de la Fundación Valle del Lili, evaluamos un total de 42 casos, encontrando 98.1% con un nivel de concordancia total, tanto de la hibridización in situ fluorescente (FISH y de la inmunohistoquímica (IHQ con el ISH Dual. Determinamos un nivel de concordancia del 94.4% en el estudio del nivel de amplificación del gen HER2 por FISH y por ISH Dual. La concordancia entre la determinación de la expresión de la proteína HER2 por IHQ y por ISH Dual fue del 100%. Al evaluar nuestro coeficiente Kappa este fue de 0.97 y nuestro coeficiente de correlación intraclases en referencia con el FISH fue casi perfecto 0.85. Conclusión: nosotros observamos una reducción del tiempo de procesamiento con la técnica Dual ISH al ser una metodología automatizada (Equipo BenchMark XT de Ventana® cuando la comparamos con el protocolo FISH. La técnica Dual ISH permite la evaluación morfológica y estudia simultáneamente el centrómero del cromosoma 17 y el oncogén HER2. Esta metodología se estudia en el microscopio de luz (60x, es cuantitativa, se puede archivar y se encuentra aprobada por la Administración de Drogas y Alimentos de los Estados Unidos (FDA.

  13. Hastane Kanalizasyonlarından İzole Edilen Gram-negatif Bakterilerin Tiplendirilmesi ve Çoklu Antibiyotik Dirençliliklerinin Saptanması

    Directory of Open Access Journals (Sweden)

    Fatih Matyar

    2016-10-01

    Full Text Available Bu çalışmada, hastane kanalizasyonlarından elde edilen Gram-negatif bakteriyel izolatların mikrobiyal çeşitliliği ve antibiyotik dirençlilik düzeylerinin tespiti amaçlanmıştır. 219 Gram-negatif bakteriyel izolatın 16 farklı antibiyotiğe (10 sınıfa ait karşı dirençliliği agar difüzyon metodu kullanılarak araştırılmıştır. Çalışmada 18 farklı türe ait bakteri izole edilmiştir: tüm örneklerden en çok izolasyonu yapılan suşlar Klebsiella oxytoca (%27,4, Klebsiella pneumoniae (%20,5 ve Escherichia coli (%20,1’dir. Amfisiline (%98,6, streptomisine (%95,9 ve eritromisine (%90,0 karşı yüksek oranda dirençlilik bulunurken, sefepime (%13,2, imipeneme (%5,0 ve meropeneme (%3,2 karşı nispeten düşük oranda dirençlilik bulunmuştur. Hastane kanalizasyonlarından izole edilen tüm bakterilerin %35,6’ü, 9 farklı antibiyotiğe karşı dirençlilik göstermiştir. Çoklu antibiyotik dirençliliği (ÇAD indeksi 0,25-0,94 aralığındadır. Sonuçlar çalışılan hastane kanalizasyonlarının kayda değer miktarda antibiyotiğe dirençli Gram-negatif bakteri barındırdığını ve bu bakterilerin halk sağlığı açısından potansiyel risk oluşturduğunu göstermektedir.

  14. Extracellular expression of alkaline phytase in Pichia pastoris: Influence of signal peptides, promoters and growth medium

    Directory of Open Access Journals (Sweden)

    Mimi Yang

    2015-06-01

    Full Text Available Alkaline phytase isolated from pollen grains of Lilium longiflorum (LlALP possesses unique catalytic and thermal stability properties that suggest it has the potential to be used as a feed supplement. However, substantial amounts of active enzymes are needed for animal feed studies and endogenous levels of LlALP in lily pollen are too low to provide the required amounts. Active rLlALP2 (coded by LlAlp2, one of two isoforms of alkaline phytase cDNA identified in lily pollen has been successfully expressed in intracellular compartments of Pichia pastoris, however enzyme yields have been modest (25–30 mg/L and purification of the enzyme has been challenging. Expression of foreign proteins to the extracellular medium of P. pastoris greatly simplifies protein purification because low levels of endogenous proteins are secreted by the yeast. In this paper, we first describe the generation of P. pastoris strains that will secrete rLlALP2 to the extracellular medium. Data presented here indicates that deletion of native signal peptides at the N- and C-termini of rLlALP2 enhanced α-mating factor (α-MF-driven secretion by four-fold; chicken egg white lysozyme signal peptide was ineffective in the extracellular secretion of rLlALP2. Second, we describe our efforts to increase expression levels by employing a constitutive promoter from the glyceraldehyde-3-phosphate dehydrogenase gene (PGAP in place of the strong, tightly controlled promoter of alcohol oxidase 1 gene (PAOX1. PGAP enhanced the extracellular expression levels of rLlALP2 compared to PAOX1. Finally, we report on the optimization of the culture medium to enhance yields of rLlALP2. The strength of PGAP varies depending on the carbon source available for cell growth; secreted expression of rLlALP2 was highest when glycerol was the carbon source. The addition of histidine and Triton X-100 also enhanced extracellular expression. Taken together, the employment of PGAP under optimized culture

  15. Composite Cathodes for Dual-Rate Li-Ion Batteries

    Science.gov (United States)

    Whitacre, Jay; West, William; Bugga, Ratnakumar

    2008-01-01

    Composite-material cathodes that enable Li-ion electrochemical cells and batteries to function at both high energy densities and high discharge rates are undergoing development. Until now, using commercially available cathode materials, it has been possible to construct cells that have either capability for high-rate discharge or capability to store energy at average or high density, but not both capabilities. However, both capabilities are needed in robotic, standby-power, and other applications that involve duty cycles that include long-duration, low-power portions and short-duration, high-power portions. The electrochemically active ingredients of the present developmental composite cathode materials are: carbon-coated LiFePO4, which has a specific charge capacity of about 160 mA h/g and has been used as a high-discharge-rate cathode material and Li[Li(0.17)Mn(0.58)Ni(0.25)]O2, which has a specific charge capacity of about 240 mA h/g and has been used as a high-energy-density cathode material. In preparation for fabricating the composite material cathode described, these electrochemically active ingredients are incorporated into two sub-composites: a mixture comprising 10 weight percent of poly(vinylidine fluoride); 10 weight percent of carbon and 80 weight percent of carbon coated LiFePO4; and, a mixture comprising 10 weight percent of PVDF, and 80 weight percent of Li[Li(0.17)Mn(0.58)Ni(0.25)]O2. In the fabrication process, these mixtures are spray-deposited onto an aluminum current collector. Electrochemical tests performed thus far have shown that better charge/discharge performance is obtained when either 1) each mixture is sprayed on a separate area of the current collector or (2) the mixtures are deposited sequentially (in contradistinction to simultaneously) on the same current-collector area so that the resulting composite cathode material consists of two different sub-composite layers.

  16. Cs-137 in aquatic organisms in the southern Lake Keurusselkae (Finland)[Radioecology

    Energy Technology Data Exchange (ETDEWEB)

    Ilus, E.; Klemola, S.; Vartti, V.P.; Mattila, J.; Ikaeheimonen, T.K. [STUK - Radiation and Nuclear Safety Authority, Helsinki (Finland)

    2006-04-15

    The results of a study carried out in Lake Keurusselkae, in the Finnish Lake District, are reported. The aim of the study was to collect biota samples for the INDOFERN Project from an area that was rather highly contaminated (70 kBq m{sup -2} of {sup 137}Cs in 1986) with the Chernobyl fallout in Finland. The samples were taken from a relatively small area surrounding the island of Iso Riihisaari in the southern part of the Keurusselkae water course. In total 15 samples of aquatic plants, 6 samples of aquatic animals, 1 water sample and 2 sediment cores were taken. In August 2003, the activity concentration of {sup 137}Cs in the surface water of the southern Lake Keurusselkae was 49 Bq m{sup -3}, whereas it was 310 Bq m{sup -3} in 1988, two year after the Chernobyl accident. In the relatively shallow area surrounding the island of Iso Riihisaari, the total amount of {sup 137}Cs in sediments was 32-37 kBq m{sup -2} in 2003, but in a deeper basin close to this area the total amount of {sup 137}Cs was 130 kBq m{sup -2} in 1990. The clearly highest activity concentration and concentration factor of {sup 137}Cs was found in one sample of Water horsetail (Equisetum fluviatile), 1 430 Bq kg{sup -1} dry wt; CF 29 200, whereas in another sample of the same species the concentration was only 174 Bq kg{sup -1} dry wt. In addition, the Water lily (Nymphaea candida), Spiked water millfoil (Myriophyllum spicatum), Broad-leaved pondweed (Potamogeton natans) and Yellow water lily (Nuphar lutea) seemed to be good indicators for {sup 137}Cs. The tall freshwater clam (Anodonta sp.) seemed to be a modest accumulator of {sup 137}Cs. Contrary to our results from the coastal areas of the Baltic Sea, many aquatic plants demonstrated in fresh water similar accumulation capacity of {sup 137}Cs as fish (perch and roach), while in the sea the uptake of {sup 137}Cs in fish seemed to be more efficient than in aquatic plants. (LN)

  17. In situ and operando atomic force microscopy of high-capacity nano-silicon based electrodes for lithium-ion batteries

    Science.gov (United States)

    Breitung, Ben; Baumann, Peter; Sommer, Heino; Janek, Jürgen; Brezesinski, Torsten

    2016-07-01

    Silicon is a promising next-generation anode material for high-energy-density lithium-ion batteries. While the alloying of nano- and micron size silicon with lithium is relatively well understood, the knowledge of mechanical degradation and structural rearrangements in practical silicon-based electrodes during operation is limited. Here, we demonstrate, for the first time, in situ and operando atomic force microscopy (AFM) of nano-silicon anodes containing polymer binder and carbon black additive. With the help of this technique, the surface topography is analyzed while electrochemical reactions are occurring. In particular, changes in particle size as well as electrode structure and height are visualized with high resolution. Furthermore, the formation and evolution of the solid-electrolyte interphase (SEI) can be followed and its thickness determined by phase imaging and nano-indentation, respectively. Major changes occur in the first lithiation cycle at potentials below 0.6 V with respect to Li/Li+ due to increased SEI formation - which is a dynamic process - and alloying reactions. Overall, these results provide insight into the function of silicon-based composite electrodes and further show that AFM is a powerful technique that can be applied to important battery materials, without restriction to thin film geometries.Silicon is a promising next-generation anode material for high-energy-density lithium-ion batteries. While the alloying of nano- and micron size silicon with lithium is relatively well understood, the knowledge of mechanical degradation and structural rearrangements in practical silicon-based electrodes during operation is limited. Here, we demonstrate, for the first time, in situ and operando atomic force microscopy (AFM) of nano-silicon anodes containing polymer binder and carbon black additive. With the help of this technique, the surface topography is analyzed while electrochemical reactions are occurring. In particular, changes in particle

  18. Yttrium and rare earth elements in fluids from various deep-sea hydrothermal systems

    Energy Technology Data Exchange (ETDEWEB)

    Douville, E. [Univ. Bretagne Occidentale, Brest (France). Dept. de Chimie]|[IFREMER Centre de Brest, Plouzane (France); Appriou, P. [Univ. Bretagne Occidentale, Brest (France); Bienvenu, P. [CEA Cadarache, Saint Paul Lez Durance (France). Lab. d`Analyses Radiochimiques et Chimiques; Charlou, J.L.; Donval, J.P.; Fouquet, Y. [IFREMER Centre de Brest, Plouzane (France); Gamo, Toshitaka [Univ. of Tokyo, Nakano, Tokyo (Japan). Ocean Research Inst.

    1999-03-01

    Rare earth element (REE) and yttrium (Y) concentrations were measured in fluids collected from deep-sea hydrothermal systems including the Mid-Atlantic Ridge (MAR), i.e., Menez Gwen, Lucky Strike, TAG, and Snakepit; the East Pacific Rise (EPR), i.e., 13{degree}N and 17--19{degree}S; and the Lau (Vai Lili) and Manus (Vienna Woods, PacManus, Desmos) Back-arc Basins (BAB) in the South-West Pacific. In most fluids, Y is trivalent and behaves like Ho. Chondrite normalized Y-REE (Y-REE{sub N}) concentrations of fluids from MAR, EPR, and two BAB sites, i.e., Vai Lili and Vienna Woods, showed common patterns with LREE enrichment and positive Eu anomalies. REE analysis of plagioclase collected at Lucky Strike strengthens the idea that fluid REE contents, are controlled by plagioclase phenocrysts. Other processes, however, such as REE complexation by ligands (Cl{sup {minus}}, F{sup {minus}}, So{sub 4}{sup 2{minus}}), secondary phase precipitation, and phase separation modify REE distributions in deep-sea hydrothermal fluids. REE speciation calculations suggest that aqueous REE are mainly complexed by Cl{sup {minus}} ions in hot acidic fluids from deep-sea hydrothermal systems. REE concentrations in the fluid phases are, therefore, influenced by temperature, pH, and duration of rock-fluid interaction. Unusual Y-REE{sub N} patterns found in the PacManus fluids are characterized by depleted LREE and a positive Eu anomaly. The Demos fluid sample shows a flat Y-REE{sub N} pattern, which increases regularly from LREE to HREE with no Eu anomaly. These Manus Basin fluids also have an unusual major element chemistry with relatively high Mg, So{sub 4}, H{sub 2}S, and F contents, which may be due to the incorporation of magmatic fluids into heated seawater during hydrothermal circulation. REE distribution in PacManus fluids may stem from a subseafloor barite precipitation and the REE in Demos fluids are likely influenced by the presence of sulfate ions.

  19. Cine Club

    CERN Multimedia

    Ciné Club

    2011-01-01

    Wednesday 29 June 2011 at 20:30 CERN Council Chamber Arizona Dream  By/de : Emir Kusturica (USA/France, 1993) 142 min With/avec: Johnny Depp, Jerry Lewis, Fay Dunaway, Lily Taylor, Vincent Gallo A romantic comedy about the adventures of an innocent dreamer in the weird and colourful landscape of the American West. Caught between childhood and adulthood he finds himself back in his hometown where he becomes involved with a wealthy widow and her stepdaughter. Original version english; english subtitles Entrance : 2 CHF Projection from DVD http://cineclub.web.cern.ch/Cineclub/     Thursday 7 July 2011 at 20:30 CERN Council Chamber Burn After Reading  By/de : Ethan Coen and Joel Coen (USA/UK/France, 2008) 102 min With/avec: George Clooney, Frances McDormand, Brad Pitt, John Malkovich, Tilda Swinton Osbourne Cox, a Balkan expert, is fired at the CIA, so he begins a memoir. His wife wants a divorce and expects her lover, Harry, a philandering State Dep...

  20. Don Quijote in Nineteenth-Century English Theatre

    Directory of Open Access Journals (Sweden)

    J. A. Garrido Ardila

    2014-12-01

    Full Text Available This article brings to light a group of Cervantine English literary works hitherto unknown to present-day Cervantes studies: seven theatrical adaptations of Don Quixote (two anonymous ones in addition to those by Charles Dibdin, Joseph Moser, G. A. Macfarren, C. A. Maltby and P. Milton, a comedy with a Quixotic title (by George Dance, and five Quixotic fictions (two anonymous, in addition to those by Lily Spender, Maurice Hewlett and A. T. Quiller-Couch. Three of these plays, had been noted by Leopoldo Rius in 1899 (Moser, Macfarren, Maltby; the other four are presented for the first time here. In order to chart a fuller and more complete history of Don Quixote on the English stage, this article provides relevant information on those seven plays. An examination of these works reinforces the previous theses that underscore the essentially comical nature of Quixotic plays in nineteenth-century England, a fact of relevance in the study of the English reception of Don Quixote in the course of that century.