Energy Technology Data Exchange (ETDEWEB)
Haberle, Rosemarie C.; Fourcade, Matthew L.; Boore, Jeffrey L.; Jansen, Robert K.
2006-01-09
Chloroplast genome structure, gene order and content arehighly conserved in land plants. We sequenced the complete chloroplastgenome sequence of Trachelium caeruleum (Campanulaceae) a member of anangiosperm family known for highly rearranged chloroplast genomes. Thetotal genome size is 162,321 bp with an IR of 27,273 bp, LSC of 100,113bp and SSC of 7,661 bp. The genome encodes 115 unique genes, with 19duplicated in the IR, a tRNA (trnI-CAU) duplicated once in the LSC and aprotein coding gene (psbJ) duplicated twice, for a total of 137 genes.Four genes (ycf15, rpl23, infA and accD) are truncated and likelynonfunctional; three others (clpP, ycf1 and ycf2) are so highly divergedthat they may now be pseudogenes. The most conspicuous feature of theTrachelium genome is the presence of eighteen internally unrearrangedblocks of genes that have been inverted or relocated within the genome,relative to the typical gene order of most angiosperm chloroplastgenomes. Recombination between repeats or tRNAs has been suggested as twomeans of chloroplast genome rearrangements. We compared the relativenumber of repeats in Trachelium to eight other angiosperm chloroplastgenomes, and evaluated the location of repeats and tRNAs in relation torearrangements. Trachelium has the highest number and largest repeats,which are concentrated near inversion endpoints or other rearrangements.tRNAs occur at many but not all inversion endpoints. There is likely nosingle mechanism responsible for the remarkable number of alterations inthis genome, but both repeats and tRNAs are clearly associated with theserearrangements. Land plant chloroplast genomes are highly conserved instructure, gene order and content. The chloroplast genomes of ferns, thegymnosperm Ginkgo, and most angiosperms are nearly collinear, reflectingthe gene order in lineages that diverged from lycopsids and the ancestralchloroplast gene order over 350 million years ago (Raubeson and Jansen,1992). Although earlier mapping studies
Lifescience Database Archive (English)
Full Text Available protein L33 (Fragment) OS=Trachelium caeruleum Align length 55 Score (bit) 57.0 E-value 5.0e-07 Report BLAST...|A9QC76|A9QC76_TRACE 50S ribosomal protein L33 (Fragment) OS=Trachelium caeruleum GN=rpl33 PE=3 SV=1 Length
Lifescience Database Archive (English)
Full Text Available _1( DQ114789 |pid:none) Pinctada fucata lysine-rich matrix... 33 4.0 EU017233_1( EU017233 |pid:none) Trach...elium caeruleum hypothetical ... 32 9.0 CT573213_5346( CT573213 |pid:none) Frankia
Lifescience Database Archive (English)
Full Text Available it c, chloroplastic OS=Trachelium caeruleum GN=atpH PE=3 SV=1 Length = 81 Score = 72.0 bits (175), Expect = ...YGLVVALALLFANPFV Sbjct: 45 AEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFV 81 >sp|A9QC36|ATPH_TRACE ATP synthase subun
DIASTATEA (CAMPANULACEAE, LOBELIODEAE, NUEVO GÉNERO PARA LA FLORA ARGENTINA
Directory of Open Access Journals (Sweden)
Alberto C. Slanis
2009-01-01
Full Text Available The genus Diastatea (Campanulaceae, Lobelioideae is recorded for the first time for Argentina in antropic enviroments of the Yungas phytogeographic province (Jujuy, between 1,100 and 2,000 m. We describe and illustrate D. micrantha, the only species collected up to now, including a key to discern it from Lobelia xalapensis, its closest taxon.
Investigation of plant latices of Asteraceae and Campanulaceae regarding proteolytic activity.
Sytwala, Sonja; Domsalla, André; Melzig, Matthias F
2015-12-01
Occurrence of plant latices is widespread, there are more than 40 families of plants characterized to establish lactiferous structures. The appearance of hydrolytic active proteins, incorporated in latices is already characterized, and hydrolytic active proteins are considerable, and for several plant families, the occurrence of hydrolytic active proteins is already specified e.g. Apocynaceae Juss., Caricaceae Dumort, Euphorbiaceae Juss., Moraceae Gaudich and Papaveraceae Juss. In our investigation, focused on latex bearing plants of order Asterales, Asteraceae and Campanulaceae in particular. The present outcomes represent a comprehensive study, relating to the occurrence of proteolytic active enzymes of order Asterales for the first time. 131 different species of Asteraceae and Campanulaceae were tested, and the appearance of plant latex proteases were determined in different quantities. Proteolytic activity was investigated by inhibitory studies and determination of residual activity in the following, enable us to characterize the proteases. Most of the considered species exhibit a serine protease activity and a multiplicity of species exhibited two or more subclasses of proteases. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
Pollination, biogeography and phylogeny of oceanic island bellflowers (Campanulaceae)
DEFF Research Database (Denmark)
Olesen, Jens Mogens; Alarcón, M.; Ehlers, Bodil
2012-01-01
. These examples of vertebrate pollination evolved independently on each island or archipelago. We discuss if these pollination systems have an island or mainland origin and when they may have evolved, and finally, we attempt to reconstruct the pollinator-interaction history of each species.......We studied the pollination biology of nine island Campanulaceae species: Azorina vidalii, Musschia aurea, M. wollastonii, Canarina canariensis, Campanula jacobaea, Nesocodon mauritianus, and three species of Heterochaenia. In addition, we compared C. canariensis to its two African mainland...... relatives C. eminii and C. abyssinica. We asked to what extent related species converge in their floral biology and pollination in related habitats, i.e. oceanic islands. Study islands were the Azores, Madeira, Canary Islands, Cape Verde, Mauritius, and Réunion. Information about phylogenetic relationships...
Energy Technology Data Exchange (ETDEWEB)
Sharp, J.R. [Southeast Missouri State Univ., Cape Girardeau, MO (United States). Dept. of Biology
1995-12-31
Etheostoma caeruleum and E. spectabile are sympatric teleostean species of the Family Percidae. The ova diameters and incubation times are different: E. caeruleum (1.9mm and 12-d), E. spectabile (1.2mm and 8-d). For both species, cleavage stage (4--8 cell), mid-blastula, mid-neurula, and early-eye stage embryos were exposed to + {minus}1 a 24-h static-renewal test of 0, 10, 20, 40, 60, 80, 100 {micro}gHg {sup ++}L{sup {minus}1} to assess the effects of stage-specific initial mercury exposure on the embryo-larval responses. In addition, cleavage stage embryos were exposed to a 1-d, 2-d, and 4-d static-renewal toxicity test to determine the influence that exposure duration to mercury has on embryolarval responses. Five replicates of 10 embryos each were incubated at 18 C for each concentration and exposure variation. Embryos were allowed to develop until all had hatched or died. Four embryonic responses were assessed for each species and exposure protocol: 96-h LC50, AB50, SH50 and VH50. The typical nonstressor specific terata were noted for each species with an increase in percent of embryos expressing abnormal developmental patterns with increase mercury concentrations and severity of exposure. These included dwarfism, cephalic complications, ophthalmic abnormalities, cardiovascular abnormalities, various edema, and haemorrhagia. Hatching success and viability of hatch were likewise reduced with increasing severity of exposure and mercury concentration. Previously undetected terata that were observed in the first hatch included scoliosis, lordosis, kyphosis, synarthrodic jaws, and grossly enlarged yolk sacs.
Hammen, van der T.; Cleef, A.M.
1978-01-01
Fossil pollen grains from the Quaternary of Colombia, formerly provisionally indicated as “Valeriana” stenophylla Killip, have now been identified as those of the Andean genus Lysipomia H.B.K. (Campanulaceae). In the genus Lysipomia s.l. (fide McVaugh) two considerably different pollen types are
Una nueva especie de Burmeistera (Campanulaceae de Colombia
Directory of Open Access Journals (Sweden)
Lozano C. Gustavo
1986-12-01
Full Text Available Esta nueva especie se puede separar fácilmente de las demás especies del género Burmeistera por tener sus hojas profunda y repetidamente pinnatisectas característica nunca antes registrada en este grupo de plantas. Aparte de la especie aquí descrita, la única especie de Burmeistera que presenta la lámina foliar pinnatisecta (laciniada, es B. pteridioides, Mc Vaugh, descrita de la Cordillera Oriental en Colombia (Mc VAUGH, 1965; sin embargo, las hojas de B. pteridioides tienen divisiones sólo de primer orden (simplemente pinnatisectas, mientras que las hojas de B. multipinnatisecta tienen divisiones hasta de quinto orden (pentapinnatisectas. Aún dentro de la familia Campanulaceae, el presentar la lámina foliar pinnatisecta es una característica de escasa ocurrencia; en lo que respecta a las especies americanas, este carácter se presenta en las especies ya mencionadas, B. multipinnatisecta y B. pteridiodes y en Centropogon dissectus Wimm., una especie endémica del Ecuador (JEPPESEN, 1981.
Development of Polymorphic Microsatellite Markers for Indian Tobacco, Lobelia inflata (Campanulaceae
Directory of Open Access Journals (Sweden)
P. William Hughes
2014-04-01
Full Text Available Premise of the study: Nuclear microsatellite markers were developed for Lobelia inflata (Campanulaceae, an obligately self-fertilizing plant species, for use in the study of temporal fluctuation in allele frequency and of the genetic structure within and among populations. Methods and Results: We developed 28 primer pairs for L. inflata, all of which amplify CT dinucleotide repeats. We evaluated amplification of these loci in 53 L. inflata individuals at three sites in eastern North America and found that 24 loci showed microsatellite polymorphism. We also found that 16 loci amplified successfully in L. cardinalis, and 11 amplified successfully in L. siphilitica. Conclusions: These primers will be useful for assessing allelic diversity within and among populations of L. inflata, and show potential for use in congeneric species.
Chwil, Mirosława; Chwil, Stanisław
2012-10-01
The Polemoniaceae family forms flowers diverse in the terms of pollination methods and nectar types. The micromorphology of the nectary surface and the tissue structures as well as the ultrastructure of the cells of the floral nectaries in Polemonium caeruleum L. were examined using light, scanning and transmission electron microscopy. A bowl-shaped nectary, detached from the ovary, grows at its base. Its contour shows folds with depressions in the places where the stamens grow, forming five-lobed disc (synapomorphic character). Nectar is secreted through modified anomocytic stomata, which are formed in the epidermis covering the tip and the lateral wall of the projection located between the staminal filaments. The undulate nectary consists of a single-layered epidermis and three to nine layers of parenchymal cells. The cells of the nectary contain a dense cytoplasm, numerous plastids with an osmophilic stroma and starch grains, well-developed endoplasmic reticulum, as well as a large number of mitochondria interacting with the Golgi bodies. The ultrastructure of nectary cells indicates the granulocrine secretion mechanism and diversified transport of nectar.
Directory of Open Access Journals (Sweden)
Garzón Venegas, Javier
2012-12-01
Full Text Available Burmeistera minutiflora (Campanulaceae-Lobelioideae, a new species of sect. Barbatae, is here described, illustrated, and keyed out with respect to other species of the genus with small flowers (i.e. corolla tube < 1 cm long. The new species is a small herb that grows in the understory of remnants of cloud montane forests of the Western cordillera of Antioquia, Colombia. The dimensions of the corolla and the berries correspond without doubts to the smallest size of reproductive structures in the genus. The small floral size contrasts with the colorful, bright red and yellow corollas.
Se describe Burmeistera minutiflora (Campanulaceae-Lobelioideae, una nueva especie de la sect. Barbatae, y se ilustra e incluye en una clave en la que se contrasta con otras especies de flores diminutas (i.e. con corola < 1 cm. La nueva especie es una hierba pequeña, que crece en el sotobosque de remanentes de bosques nublados de la Cordillera Occidental de Antioquia, Colombia. Las pequeñas dimensiones de la corola y de las bayas corresponden si lugar a dudas a las estructuras reproductivas de menor tamaño conocidas en el género. El pequeño tamaño de las flores contrasta con la vivacidad de las corolas rojas brillantes y amarillas.
Directory of Open Access Journals (Sweden)
Yohan Pillon
2013-06-01
Full Text Available Premise of the study: Primers were developed to amplify 12 intron-less, low-copy nuclear genes in the Hawaiian genus Clermontia (Campanulaceae, a suspected tetraploid. Methods and Results: Data from a pooled 454 titanium run of the partial transcriptomes of seven Clermontia species were used to identify the loci of interest. Most loci were amplified and sequenced directly with success in a representative selection of lobeliads even though several of these loci turned out to be duplicated. Levels of variation were comparable to those observed in commonly used plastid and ribosomal markers. Conclusions: We found evidence of a genome duplication that likely predates the diversification of the Hawaiian lobeliads. Some genes nevertheless appear to be single-copy and should be useful for phylogenetic studies of Clermontia or the entire Lobelioideae subfamily.
Directory of Open Access Journals (Sweden)
JAVIER GARZÓN VENEGAS
2014-12-01
Full Text Available Burmeistera diazii (Campanulaceae: Lobelioideae, de la Cordillera Central de Colombia, en la franja altitudinal entre 1,800 y 2,750 m en los municipios de Sonsón y Guatapé (Antioquia, es descrita como una especie nueva. Se discuten en detalle las semejanzas morfológicas con sus especies afines (B. obtusifolia, de Costa Rica y Panamá, B. killipii y B. serraniaguae, de Colombia y B. crassifolia y B. loejtnantii, de Colombia y Ecuador, las cuales se caracterizan por tener hojas ovadas a ovado-lanceoladas, pedúnculo ebracteado y lóbulos del cáliz largos. Se registra B. loejtnantii por primera vez para la flora de Colombia.
Effects of elevated CO[sub 2] on time of flowering in four short-day and four long-day species
Energy Technology Data Exchange (ETDEWEB)
Reekie, J.Y.C.; Hicklenton, P.R. (Agriculture Canada Research Station, Kentiville, NS (Canada)); Reekie, E.G. (Acadia Univ., Wolfville, NS (Canada))
1994-01-01
A study was undertaken to determine if the effect of elevated CO[sub 2] on flowering phenology is a function of the photoperiodic response of the species involved. Four long-day plants, Achillea millefolium, Callistephus chinensis, Campanula isophylla, and Trachelium caeruleum, and four short-day plants, Dendranthema grandiflora, Kalanchoe blossfeldiana, Pharbitis nil, and Xanthium pensylvanicum, were grown under inductive photoperiods (9 h for short day and 17 h for long day) at either 350 or 1000 [mu]l/l CO[sub 2]. Time of visible flower bud formation, flower opening, and final plant biomass were assessed. Elevated CO[sub 2] advanced flower opening in all four long-day species and delayed flowering in all four short-day species. In the long-day species, the effect of CO[sub 2] was primarily on bud initiation; all four species formed buds earlier at high CO[sub 2]. Bud development, the difference in time between flower opening and bud initiation, was advanced in only one long-day species, Callistephus chinensis. Mixed results were obtained for the short-day species. Elevated CO[sub 2] exerted no effects on bud initiation but delayed bud development in Dendranthema and Kalanchoe. In Xanthium, bud initiation rather than bud development was delayed. Data on bud initiation and development were not obtained for Pharbitis. The negative effect of CO[sub 2] upon phenology in the short-day species was not associated with negative effects on growth. Elevated CO[sub 2] increased plant size in both long-day and short-day species. 26 refs., 4 tabs.
Surina, Boštjan; Schneeweiss, Gerald M; Glasnović, Peter; Schönswetter, Peter
2014-06-01
Due to strong spatial heterogeneity and limited Pleistocene glaciation, the Balkan Peninsula is a major European biodiversity hot spot. Surprisingly little, however, is known about patterns and processes of intraspecific diversification of its biota in general and of high-altitude species in particular. A well-suited system to test hypotheses with respect to various isolating factors acting at different geographic scales and to explore full-range phylogeographic patterns on the Balkan Peninsula is Edraianthus graminifolius (Campanulaceae), distributed in the western Balkan mountain systems, the southwestern Carpathians and the Apennine Peninsula. To this end, we used a dense population sampling and employed amplified fragment length polymorphism (AFLP) markers and plastid DNA sequences supplemented by ecological niche modelling. The strongest splits were inferred to separate southern and northern Balkan populations from the central ones, from where range extension occurred to the Carpathians and, in more recent times, once or twice to the Apennine Peninsula. The three genetic groups in the western Balkan Peninsula were remarkably congruent among molecular markers, suggesting that the barriers to gene flow acted over long time periods facilitating allopatric differentiation. Each main group of Balkan populations contained genetically and geographically distinct subgroups, which likely are the result of local refugia during warmer periods. Evidently, the topographically highly complex and during the Last Glacial Maximum only locally glaciated Balkan Peninsula is a hot spot of species richness and endemism as well as a sanctuary of intraspecific genetic diversity, even if the underlying causes remain insufficiently understood. © 2014 John Wiley & Sons Ltd.
Fuller, Rebecca C
2018-01-01
Abstract Selection against hybridization can cause mating traits to diverge between species in sympatry via reproductive character displacement (RCD). Additionally, selection against interspecific fighting can cause aggressive traits to diverge between sympatric species via agonistic character displacement (ACD). By directly affecting conspecific recognition traits, RCD and ACD between species can also incidentally cause divergence in mating and fighting traits among populations within a species [termed cascade RCD (CRCD) and cascade ACD]. Here, we demonstrate patterns consistent with male-driven RCD and ACD in 2 groups of darters (orangethroat darter clade Ceasia and rainbow darter Etheostoma caeruleum). In both groups, males that occur in sympatry (between Ceasia and E. caeruleum) have higher levels of preference for mating and fighting with conspecifics over heterospecifics than do males from allopatry. This is consistent with RCD and ACD. We also found patterns consistent with CRCD and cascade ACD among species of Ceasia. Ceasia males that are sympatric to E. caeruleum (but allopatric to one another) also have heightened preferences for mating and fighting with conspecific versus heterospecific Ceasia. In contrast, Ceasia males that are allopatric to E. caeruleum readily mate and fight with heterospecific Ceasia. We suggest that RCD and ACD between Ceasia and E. caeruleum has incidentally led to divergence in mating and fighting traits among Ceasia species. This study is unique in that male preferences evolve via both RCD (male preference for conspecific females) and ACD (male preference to fight conspecific males) which leads to subsequent divergence among allopatric lineages. PMID:29492043
Bragg, Leslie M.; Tetreault, Gerald R.; Bahamonde, Paulina A.; Tanna, Rajiv N.; Bennett, Charles J.; McMaster, Mark E.; Servos, Mark R.
2016-01-01
Municipal wastewater effluent (MWWE) and its constituents, such as chemicals of emerging concern, pose a potential threat to the sustainability of fish populations by disrupting key endocrine functions in aquatic organisms. While studies have demonstrated changes in biological markers of exposure of aquatic organisms to groups of chemicals of emerging concern, the variability of these markers over time has not been sufficiently described in wild fish species. The aim of this study was to assess the spatial and temporal variability of biological markers in response to MWWE exposure and to test the consistency of these responses between seasons and among years. Rainbow darter (Etheostoma caeruleum) were collected in spring and fall seasons over a 5-year period in the Grand River, Ontario, Canada. In addition to surface water chemistry (nutrients and selected pharmaceuticals), measures were taken across levels of biological organization in rainbow darter. The measurements of hormone production, gonad development, and intersex severity were temporally consistent and suggested impaired reproduction in male fish collected downstream of MWWE outfalls. In contrast, ovarian development and hormone production in females appeared to be influenced more by urbanization than MWWE. Measures of gene expression and somatic indices were highly variable between sites and years, respectively, and were inconclusive in terms of the impacts of MWWE overall. Robust biomonitoring programs must consider these factors in both the design and interpretation of results, especially when spatial and temporal sampling of biological endpoints is limited. Assessing the effects of contaminants and other stressors on fish in watersheds would be greatly enhanced by an approach that considers natural variability in the endpoints being measured. PMID:27776151
Directory of Open Access Journals (Sweden)
Meghan L M Fuzzen
Full Text Available Municipal wastewater effluent (MWWE and its constituents, such as chemicals of emerging concern, pose a potential threat to the sustainability of fish populations by disrupting key endocrine functions in aquatic organisms. While studies have demonstrated changes in biological markers of exposure of aquatic organisms to groups of chemicals of emerging concern, the variability of these markers over time has not been sufficiently described in wild fish species. The aim of this study was to assess the spatial and temporal variability of biological markers in response to MWWE exposure and to test the consistency of these responses between seasons and among years. Rainbow darter (Etheostoma caeruleum were collected in spring and fall seasons over a 5-year period in the Grand River, Ontario, Canada. In addition to surface water chemistry (nutrients and selected pharmaceuticals, measures were taken across levels of biological organization in rainbow darter. The measurements of hormone production, gonad development, and intersex severity were temporally consistent and suggested impaired reproduction in male fish collected downstream of MWWE outfalls. In contrast, ovarian development and hormone production in females appeared to be influenced more by urbanization than MWWE. Measures of gene expression and somatic indices were highly variable between sites and years, respectively, and were inconclusive in terms of the impacts of MWWE overall. Robust biomonitoring programs must consider these factors in both the design and interpretation of results, especially when spatial and temporal sampling of biological endpoints is limited. Assessing the effects of contaminants and other stressors on fish in watersheds would be greatly enhanced by an approach that considers natural variability in the endpoints being measured.
Moran, Rachel L.; Zhou, Muchu; Catchen, Julian M.; Fuller, Rebecca C.
2017-01-01
Abstract Determining which reproductive isolating barriers arise first between geographically isolated lineages is critical to understanding allopatric speciation. We examined behavioral isolation among four recently diverged allopatric species in the orangethroat darter clade (Etheostoma: Ceasia). We also examined behavioral isolation between each Ceasia species and the sympatric rainbow darter Etheostoma caeruleum. We asked (1) is behavioral isolation present between allopatric Ceasia species, and how does this compare to behavioral isolation with E. caeruleum, (2) does male color distance and/or genetic distance predict behavioral isolation between species, and (3) what are the relative contributions of female choice, male choice, and male competition to behavioral isolation? We found that behavioral isolation, genetic differentiation, and male color pattern differentiation were present between allopatric Ceasia species. Males, but not females, discerned between conspecific and heterospecific mates. Males also directed more aggression toward conspecific rival males. The high levels of behavioral isolation among Ceasia species showed no obvious pattern with genetic distance or male color distance. However, when the E. caeruleum was included in the analysis, an association between male aggression and male color distance was apparent. We discuss the possibility that reinforcement between Ceasia and E. caeruleum is driving behavioral isolation among allopatric Ceasia species. PMID:28776645
Native herbaceous perennials as ornamentals
DEFF Research Database (Denmark)
Larsen, Bjarne; Ørgaard, Marian
2013-01-01
Gardening with native perennials is a way to bring nature closer to urban citizens and bring up reflections on nature in a busy world. During three seasons of trialing Salvia pratensis, Dianthus deltoides, Campanula trachelium, Vincetoxicum hirundinaria, Saxifraga granulata, Plantago media and P...
Directory of Open Access Journals (Sweden)
John Bako Baon
2006-08-01
Full Text Available Arachis pintoiis potentially as a cover crop for cocoa (Theobroma cacaoL. farm, however information regarding its effect on the growth of cocoa plants in the field is very limited. The objective of this experiment is to investigate the combined influence of ground cover crop A. pintoi, rhizobial bacterial inoculation and phosphorus (P fertilizer on the growth of cocoa in the field and nutrient status. This experiment laid out in split-split plot design consisted of three levels of cover crop (without, A. pintoiand Calopogonium caeruleum, two levels of rhizobium inoculation (not inoculated and inoculated and two levels of phosphorus application (no P added and P added. The results showed that in field condition the presence of A. pintoias cover crop did not affect the growth of cocoa. On the other hand, C. caeruleumas cover crop tended to restrict cocoa growth compared to A. pintoi. Application of P increased leaf number of cocoa plant. Biomass production of A. pintoiwas 40% higher than C. caeruleum. Soil organic carbon and nitrogen contents were not affected by ground cover crops, though higher value (0.235% N and 1.63% organic C was obtained from combined treatments of inoculation and P addition or neither inoculation nor P addition. In the case of no rhizobium inoculation, soil N content in cocoa farm with A. pintoicover crop was lower than that of without cover crop or with C. caeruleum. Cover crop increased plant N content when there was no inoculation, on the other hand rhizobium inoculation decreased N content of cocoa tissue. Tissue P content of cocoa plant was not influenced by A. Pintoicover crop or by rhizobium inoculation, except that the P tissue content of cocoa was 28% higher when the cover crop was C. caeruleumand inoculated. Key words : Arachis pintoi, Theobroma cacao, Calopogonium caeruleum, rhizobium, nitrogen, phosphorus.
Lifescience Database Archive (English)
Full Text Available to BlastX Result : TrEMBL tr_hit_id B1NTT1 Definition tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachel....done Score E Sequences producing significant alignments: (bits) Value tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trache...li... 36 0.84 >tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachelium c
New floristic records in the Balkans: 8
DEFF Research Database (Denmark)
Tan, Kit; Issigoni, Margarita
2008-01-01
-56), Campanulaceae (10), Caryophyllaceae (11, 27, 57), Chenopodiaceae (12), Convolvulaceae (13, 58), Crassulaceae (14, 59, 60), Cucurbitaceae (28), Cupressaceae (19), Cuscutaceae (49), Dryopteridaceae (2), Ephedraceae (20), Fabaceae (42- 48, 50, 61-69, 84), Gesneriaceae (85), Iridaceae (77, 88), Lamiaceae (70...
Lifescience Database Archive (English)
Full Text Available NTPSRLDLRKFCRYCHKHTI 60 Query: 392 HKE 400 + E Sbjct: 61 YGE 63 >tr|A9QC76|A9QC76_TRACE 50S ribosomal protein L33 (Fragment) OS=Trach...elium caeruleum GN=rpl33 PE=3 SV=1 Length = 64 Score = 8
New floristic records in the Balkans: 16
DEFF Research Database (Denmark)
Zarkos, G.; Christodoulou, V.; Tan, Kit
2011-01-01
), Berberidaceae (81), Boraginaceae (1–3, 82), Brassicaceae (4, 5, 26, 27), Campanulaceae (6, 28, 29, 83), Caprifoliaceae (30), Chenopodiaceae (7), Cistaceae (8), Cornaceae (31), Crassulaceae (32–34), Dipsacaceae (84), Euphorbiaceae (64), Fabaceae (9–13, 35, 36, 65, 74), Gentianaceae (37, 38), Geraniaceae (39, 72...
New floristic records in the Balkans: 11
DEFF Research Database (Denmark)
2009-01-01
-50, 59-61, 70, 71, 79, 80), Berberidaceae (62), Brassicaceae (17, 27, 35), Campanulaceae (3, 4, 42-44), Caryophyllaceae (5, 28, 72, 81), Commelinaceae (22), Crassulaceae (29), Fabaceae (7-10, 36, 51-58, 63, 82, 83), Geraniaceae (18), Guttiferae (73), Iridaceae (31-33), Lamiaceae (74), Liliaceae s.l. (11...
New floristic records in the Balkans: 4
DEFF Research Database (Denmark)
2007-01-01
), Boraginaceae (6, 7), Brassicaceae (8, 9, 43-49, 70), Campanulaceae (10, 11, 98), Caryophyllaceae (12- (6, 7), (8, 9, 43-49, 70), (10, 11, 98), (12- 14, 50, 71, 72), Chenopodiaceae (15), Crassulaceae (61, 91), Cyperaceae (22, 23), Dryopteridaceae (59), Fabaceae (62, 73-75, 92, 99), Geraniaceae (63), Lamiaceae...
Directory of Open Access Journals (Sweden)
J Reino
2010-06-01
Full Text Available Se efectuó una prospección en el 2005, en la región centro-oriental de Cuba, y se colectaron semillas de 43 accesiones (36 de leguminosas arbóreas y siete de herbáceas. Posteriormente se realizó una prueba de germinación para conocer la calidad de las semillas (con corte de cubierta, en placas de petri sobre arena de río. El número de semillas utilizadas en cada accesión fue diferente (según las colectadas y solo se empleó una réplica (sin diseño estadístico. Las semillas de mejor calidad correspondieron a las accesiones Bauhinia acuminata, Bauhinia purpurea (de Nuevitas y Vertientes, Cassia fistula, Albizia kalkora, Centrosema sp. y Centrosema brasilianum (100% de germinación, así como Calopogonium caeruleum (90% y Albizia lucida (91,6%. Siete accesiones no germinaron. La mayoría logró una alta sobrevivencia (en bolsas, aunque en especies como Bauhinia hookeli, B. acuminata, Albizia lebbeck, C. caeruleum, C. brasilianum, Desmodium sp. y Teramnus sp. fue baja y dos accesiones no sobrevivieron. El germoplasma de la EEPF «Indio Hatuey» se incrementó en 34 accesiones. Se demostró la importancia de conocer la calidad de las semillas y la relación entre este indicador y su deterioro, debido a la gran variabilidad que mostró el porcentaje de germinación en semillas colectadas en un mismo período de tiempo.A prospection was made in 2005, in the central-eastern region of Cuba and seeds from 43 accessions (36 tree legumes and seven herbaceous ones were collected. Afterwards, a germination test was conducted in order to learn the quality of the seeds (with seed coat cut, in Petri dishes on river sand. The number of seeds used in each accession was different (according to the collected ones and only one replication was used (without statistical design. The best-quality seeds corresponded to the accessions Bauhinia acuminata, Bauhinia purpurea (from Nuevitas and Vertientes, Cassia fistula, Albizia kalkora, Centrosema sp. and
Directory of Open Access Journals (Sweden)
Plamen S. Stoyanov
2016-06-01
Full Text Available The study presents data on the diversity of grass species in the region of the village of Mugla (the Western Rhodopes. One hundred forty-one species of higher plants belonging to 40families were registered. (Apiaceae, Aspleniaceae, Asteraceae, Boraginaceae, Brassicaceae,Campanulaceae, Caryophyllaceae, Cistaceae, Cyperaceae, Dipsacaceae, Equisetaceae, Ericaceae,Euphorbiaceae, Fabaceae, Gentianaceae, Geraniaceae, Gesneriaceae, Hypericaceae, Juncaceae,Lamiaceae, Lemnaceae, Liliaceae, Linaceae, Menyanthaceae, Oleacea, Onagraceae, Orchidaceae,Parnassiaceae, Plantaginaceae, Plumbaginaceae, Poaceae, Polygalaceae, Primulaceae,Ranunculaceae, Rosaceae, Rubiaceae, Saxifragaceae, Scrophulariaceae, Valerianaceae andViolaceae. Their conservation status was presented, as well as medicinal plants.
Pollination, biogeography and phylogeny of oceanic island bellflowers (Campanulaceae)
DEFF Research Database (Denmark)
Olesen, Jens Mogens; Alarcón, M.; Ehlers, Bodil
2012-01-01
relatives C. eminii and C. abyssinica. We asked to what extent related species converge in their floral biology and pollination in related habitats, i.e. oceanic islands. Study islands were the Azores, Madeira, Canary Islands, Cape Verde, Mauritius, and Réunion. Information about phylogenetic relationships....... These examples of vertebrate pollination evolved independently on each island or archipelago. We discuss if these pollination systems have an island or mainland origin and when they may have evolved, and finally, we attempt to reconstruct the pollinator-interaction history of each species....
Gustavo Lozano Contreras Bogotá, 22 de Mayo De 1938 - Bogotá, 10 de julio de 2000
Directory of Open Access Journals (Sweden)
González Garavito Favio Antonio
2001-12-01
Full Text Available Sin duda alguna, el profesor Lozano fue uno de los mejores conocedores de la Flora de Colombia. Explorador de prácticamente todos los ecosistemas de nuestro país, colectó y estudió rigurosamente miles de plantas. Como resultado, dejó plasmado su conocimiento en varios libros y en numerosas publicaciones en revistas nacionales y extranjeras. Son notables los nuevos hallazgos y contribuciones en el conocimiento de las familias Bromeliaceae, Campanulaceae, Fagaceae, Hamamelidaceae, Juglandaceae, Magnoliaceae, Melastomataceae y Metteniusaceae, entre otras. Además, fue pionero en el estudio de la ecología de robledales y de páramos.
A checklist of the flora of Shanjan protected area, East Azerbaijan Province, NW Iran.
Bibalani, Ghassem Habibi; Taheri, Elnaz
2013-01-01
The flora of protected Shanjan rangeland in Shabestar district, Azerbaijan Province, NW Iran was studied using a 1 m × 1 m quadrate in spring and summer 2011. The climate of this area is cold and dry. In this area 94 plant species belonging to 25 families were identified as constituting the major part of the vegetation. The families in the area are Amaryllidaceae, Boraginaceae, Campanulaceae, Caryophllaceae, Cistaceae, Compositea, Cruciferae, Cyperaceae, Dipesaceae, Euphorbiaceae, Geraniaceae, Hypericaceae, Linaceae, Melvaceae, Orobachaceae, Papaveraceae, Paronychiaceae, Plantaginaceae, Polygolaceae, Ranunculaceae, Resedaceae, Rubiaceae, Scrophulariaceae, Solanaceae and Valerianacea. Floristic composition is Irano-Turanian elements. Detailed analysis showed that Biennial plants were 3.19%, Annual 41.49% and Perennial 55.32%.
Directory of Open Access Journals (Sweden)
Francisco de A. C. Almeida
2005-12-01
Full Text Available Através de três métodos, extratos vegetais foram aplicados, ao Callosobruchus maculatus na fase adulta, inoculados ou não em uma massa de sementes, e na fase imatura (ovo com o objetivo de se controlar esta praga do feijão armazenado. Utilizaram-se flores, folhas, frutos e caule secos de oito espécies vegetais na obtenção dos extratos, em percolador, com solvente álcool etílico (70%. O delineamento experimental utilizado foi o inteiramente ao acaso, com os tratamentos distribuídos em esquema fatorial, cujos fatores quantitativos foram revelados pela regressão na análise de variância. Mediante os resultados obtidos, concluiu-se que a mortalidade dos insetos está relacionada com o tipo de extrato, os métodos de aplicação e com a dosagem aplicada, sendo os extratos de Callopogonium caeruleum e Piper nigrum os mais eficientes no controle do caruncho de feijão.Vegetable extracts were applied, through three methods, to the Callosobruchus maculatus in the adult phase, inoculated or not in a mass of seeds, in the immature phase (egg with the objective of controlling this pest of the stored beans. Dry flowers, leaves, fruits and dry stems of eight vegetable species were used to obtain the extracts in an extractor, with ethyl alcohol (70%. A completely randomized statistical design was used with the treatments distributed in a factorial scheme, the quantitative factors were analysed by the regression in the variance analysis. From the results obtained, it was concluded that the mortality of the insects is related to the extract type, the application methods and the applied dose, being the extracts of Callopogonium caeruleum and Piper nigrum the most efficient in the control of the weevil of cowpea.
LOBELIA (CAMPANULACEAE - LOBELIOIDEAE: NUEVAS CITAS Y CLAVE PARA LAS ESPECIES ARGENTINAS
Directory of Open Access Journals (Sweden)
Jorge G. Chiapella
1997-01-01
Full Text Available Se registra por primera vez en la Argentina la presencia de Lobelia aquatica Cham., L. hassleri Zahlbr. y L. nummularioides Cham. var. prostrata (Zahlbr. E. Wimm., dos especies encontradas anteriormente sólo en la provincia de Misiones, están ahora registradas para Corrientes. La presencia de L. nana L. H.B.K. var. nana en la Argentina también es confirmada. Se proveen descripciones e ilustraciones para L. aquatica y L. nummularioides var. prostrata. Se incluye también una clave para la identificación de las seis especies presentes en el país.
A new species of Cyanea (Campanulaceae, Lobelioideae from Maui, Hawaiian Islands
Directory of Open Access Journals (Sweden)
Hank Oppenheimer
2012-06-01
Full Text Available Cyanea kauaulaensis H. Oppenheimer & Lorence sp. nov., a new, narrowly endemic species from Maui, Hawaiian Islands is described, illustrated with field photos, and its affinities and conservation status are discussed. It is currently known from 62 mature plants and is restricted to Kaua`ula and Waikapu valleys on leeward western Maui. It differs from all other species of Cyanea by its combination of many-branched habit; glabrous, unarmed, undivided leaves; small, narrow, glabrous corollas with small calyx lobes that do not persist in fruit; and bright orange, subglobose to obovoid fruits.
Directory of Open Access Journals (Sweden)
Cristian Camilo Sandoval Parra
2007-01-01
uso de los tres estratos del bosque. Se hallaron diferencias significativas entre las medidas morfométricas del culmen expuesto, la longitud de la cuerda alar, la cola y el peso; mientras que no se encontraron diferencias entre las medidas de culmen total comisura y tarso. Los recursos florales estuvieron concentrados en el interior del bosque, con seis especies vegetales (Palicourea sp., Tillandsia sp., Guzmania sp. y Gesneriaceae entre otras, mientras que en el rastrojo solo encontramos tres (Macleania sp., Cavendishia sp., y Centropogon sp.. En las cargas de polen contamos 4.890 granos, entre los que identifique seis palinomorfos que correspondieron a Ericaceas, Campanulaceas, Onagraceas y Bromeliaceas. Los granos de polen fueron transportados en orden de proporción en la frente, en la garganta y en el pico.
Fungi in neotropical epiphyte roots.
Bermudes, D; Benzing, D H
1989-01-01
Roots of thirty-eight Ecuadoran vascular epiphytes, representing eleven angiosperm families, were examined for the presence of symbiotic microorganisms. Most orchid roots contained fungal endophytes like those that regularly infect terrestrial counterparts. Hyphae were also common in and on nonorchid roots, but assignments of these relationships to known mycorrhizal morphologies was not possible in all cases. Evidence of vesicular-arbuscular mycorrhizae (VAM) existed in a number of subjects while in Ericaceae and Campanulaceae a fungal association similar to the demateaceous surface fungi (DSF) described for alpine and prarie plants was usually present. Some associations were characterized by multicellular propagules on root surfaces. The significance of these findings and the factors likely to influence occurrence and consequences of root-fungus mutualisms in tropical forest canopies are discussed. Facts and considerations that could aid future inquiry on these systems are provided.
NATURAL POLYACETYLENE COMPOUNDS
Directory of Open Access Journals (Sweden)
A. M. Nasukhova
2014-01-01
Full Text Available In article the review of the initial stage of researches of natural polyacetylene compounds is resulted. The high reactionary ability leading to fast oxidation and degradation of these compounds, especially at influence of Uf-light, oxygen of air, pH and other factors, has caused the serious difficulties connected with an establishment of structure and studying of their physical and chemical properties. Therefore the greatest quantity of works of this stage is connected with studying of essential oils of plants from families Apiaceae, Araliaceae, Asteraceae, Campanulaceae, Olacaceae, Pittosporaceae and Santalaceae where have been found out, basically, diacetylene compounds. About development of physical and chemical methods of the analysis of possibility of similar researches have considerably extended. More than 2000 polyacetylenes are known today, from them more than 1100 are found out in plants fam. Asteraceae. Revolution in the field of molecular biology has allowed to study processes of biosynthesis of these compounds intensively.
Pender, Richard J; Morden, Clifford W; Paull, Robert E
2014-01-01
Floral nectar sugar compositions have, for several decades, been used to predict a plant species' pollinator guild. Plants possessing a generalist ornithophilous pollination syndrome produce nectar that is dilute (8-12% w/v sugars) with a low sucrose to hexose (glucose and fructose) ratio. The Hawaiian lobeliad genus Clermontia contains 22 endemic species of shrubs and small trees that are believed to have evolved flowers adapted for pollination by now mostly extinct or endangered endemic passerines in the Drepanidinae and Mohoidae. We analyzed the nectar sugar compositions, concentration, and nectar standing crop of 23 taxa to test the assumption that Clermontia taxa have evolved floral traits in response to selection pressures from these avian pollinators. All Clermontia taxa produced nectar with sugar concentrations (mean: 9.2% w/v ± 1.8 SD) comparable to the nectar of other plant species with a generalized bird pollination system. Nectar sugars were overwhelmingly composed of hexoses in all taxa (mean sucrose/hexose ratio: 0.02 ± 0.02). Nectar standing crop volumes varied widely among taxa, ranging from 9.7 µL ± 7.1 to 430.5 µL ± 401.8 (mean volume: 177.8 ± 112.0). Collectively, the nectar traits indicate that Clermontia species possess a generalist passerine pollination syndrome.
International Nuclear Information System (INIS)
Kim, Ji Young; Kim, Dong Hee; Kim, Hyung Gyun; Song, Gyu-Yong; Chung, Young Chul; Roh, Seong Hwan; Jeong, Hye Gwang
2006-01-01
Adhesion molecules play an important role in the development of atherogenesis and are produced by endothelial cells after being stimulated with various inflammatory cytokines. This study examined the effect of saponins that were isolated from the roots of Platycodon grandiflorum A. DC (Campanulaceae), Changkil saponins (CKS), on the cytokine-induced monocyte/human endothelial cell interaction, which is a crucial early event in atherogenesis. CKS significantly inhibited the TNFα-induced increase in monocyte adhesion to endothelial cells as well as decreased the protein and mRNA expression levels of vascular adhesion molecule-1 and intercellular cell adhesion molecule-1 on endothelial cells. Furthermore, CKS significantly inhibited the TNFα-induced production of intracellular reactive oxygen species (ROS) and activation of NF-κB by preventing IκB degradation and inhibiting IκB kinase activity. Overall, CKS has anti-atherosclerotic and anti-inflammatory activity, which is least in part the result of it reducing the cytokine-induced endothelial adhesion to monocytes by inhibiting intracellular ROS production, NF-κB activation, and cell adhesion molecule expression in endothelial cells
Anti-Allergic Activity of a Platycodon Root Ethanol Extract
Directory of Open Access Journals (Sweden)
Dong-Yeul Kwon
2010-07-01
Full Text Available Platycodon grandiflorum (Campanulaceae is used as traditional medicine in Asian countries. In Korean traditional medicine, Platycodon root has been widely used since ancient times as a traditional drug to treat cold, cough and asthma. However, its effects on bone marrow-derived mast cell (BMMC-mediated allergy and inflammation mechanisms remain unknown. In this study, the biological effect of Platycodon root ethanol extract (PE was evaluated in BMMC after induction of allergic mediators by phorbol 12-myristate 13-acetate (PMA plus calcium ionophore A23187 (A23187 stimulation. The effect of PE on the production of several allergic mediators, such as interleukin-6 (IL-6, prostaglandin D2 (PGD2, leukotriene C4 (LTC4, β-Hexosaminidase (β-Hex and cyclooxygenase-2 (COX-2 protein, was investigated. The results demonstrate that PE inhibits PMA + A23187 induced production of IL-6, PGD2, LTC4, β-Hexosaminidase and COX-2 protein. Taken together, these results indicate that PE has the potential for use in the treatment of allergy.
Directory of Open Access Journals (Sweden)
Georg Bauer
Full Text Available Among latex-producing plants, mainly the latex of Hevea brasiliensis has been studied in detail so far, while comprehensive comparative studies of latex coagulation mechanisms among the more than 20,000 latex-bearing plant species are lacking. In order to give new insights into the potential variety of coagulation mechanisms, the untreated natural latices of five latex-bearing plants from the families Euphorbiaceae, Moraceae and Campanulaceae were visualised using Cryo-SEM and their particle size compared using the laser diffraction method. Additionally, the laticifers of these plants species were examined in planta via Cryo-SEM. Similar latex particle sizes and shape were found in Ficus benjamina and Hevea brasiliensis. Hence, and due to other similarities, we hypothesize comparable, mainly chemical, coagulation mechanisms in these two species, whereas a physical coagulation mechanism is proposed for the latex of Euphorbia spp. The latter mechanism is based on the huge amount of densely packed particles that after evaporation of water build a large surface area, which accelerates the coagulation procedure.
Directory of Open Access Journals (Sweden)
Yang Niu
Full Text Available The floral traits of bisexual flowers may evolve in response to selection on both male and female functions, but the relative importance of selection associated with each of these two aspects is poorly resolved. Sexually dimorphic traits in plants with unisexual flowers may reflect gender-specific selection, providing opportunities for gaining an increased understanding of the evolution of specific floral traits. We examined sexually dimorphic patterns of floral traits in perfect and female flowers of the gynodioecious species Cyananthus delavayi. A special corolla appendage, the throat hair, was investigated experimentally to examine its influences on male and female function. We found that perfect flowers have larger corollas and much longer throat hairs than female flowers, while female ones have much exerted stigmas. The presence of throat hairs prolonged the duration of pollen presentation by restricting the amount of pollen removed by pollen-collecting bees during each visit. Floral longevity was negatively related to the rate of pollen removal. When pollen removal rate was limited in perfect flowers, the duration of the female phases diminished with the increased male phase duration. There was a weak negative correlation between throat hair length and seed number per fruit in female flowers, but this correlation was not significant in perfect flowers. These results suggest that throat hairs may enhance male function in terms of prolonged pollen presentation. However, throat hairs have no obvious effect on female function in terms of seed number per fruit. The marked sexual dimorphism of this corolla appendage in C. delavayi is likely to have evolved and been maintained by gender-specific selection.
DEFF Research Database (Denmark)
Stefanovic, Sasa; Lakusic, Dmitar; Kuzmina, Maria
2008-01-01
The Balkan Peninsula is known as an ice-age refugium and an area with high rates of speciation and diversification. Only a few genera have their centers of distribution in the Balkans and the endemic genus Edraianthus is one of its most prominent groups. As such, Edraianthus is an excellent model...... divided into three sections: E. sect. Edraianthus, E. sect. Uniflori, and E. sect. Spathulati. We present here the first phylogenetic study of Edraianthus based on multiple plastid DNA sequences (trnL-F region and rbcL-atpB spacer) derived from a wide taxonomic sampling and geographic range. While...
Medicinal and ethnoveterinary remedies of hunters in Trinidad
Directory of Open Access Journals (Sweden)
Georges Karla
2001-11-01
Full Text Available Abstract Background Ethnomedicines are used by hunters for themselves and their hunting dogs in Trinidad. Plants are used for snakebites, scorpion stings, for injuries and mange of dogs and to facilitate hunting success. Results Plants used include Piper hispidum, Pithecelobium unguis-cati, Bauhinia excisa, Bauhinia cumanensis, Cecropia peltata, Aframomum melegueta, Aristolochia rugosa, Aristolochia trilobata, Jatropha curcas, Jatropha gossypifolia, Nicotiana tabacum, Vernonia scorpioides, Petiveria alliacea, Renealmia alpinia, Justicia secunda, Phyllanthus urinaria,Phyllanthus niruri,Momordica charantia, Xiphidium caeruleum, Ottonia ovata, Lepianthes peltata, Capsicum frutescens, Costus scaber, Dendropanax arboreus, Siparuma guianensis, Syngonium podophyllum, Monstera dubia, Solanum species, Eclipta prostrata, Spiranthes acaulis, Croton gossypifolius, Barleria lupulina, Cola nitida, Acrocomia ierensis (tentative ID. Conclusion Plant use is based on odour, and plant morphological characteristics and is embedded in a complex cultural context based on indigenous Amerindian beliefs. It is suggested that the medicinal plants exerted a physiological action on the hunter or his dog. Some of the plants mentioned contain chemicals that may explain the ethnomedicinal and ethnoveterinary use. For instance some of the plants influence the immune system or are effective against internal and external parasites. Plant baths may contribute to the health and well being of the hunting dogs.
Medicinal and ethnoveterinary remedies of hunters in Trinidad.
Lans, C; Harper, T; Georges, K; Bridgewater, E
2001-01-01
Ethnomedicines are used by hunters for themselves and their hunting dogs in Trinidad. Plants are used for snakebites, scorpion stings, for injuries and mange of dogs and to facilitate hunting success. Plants used include Piper hispidum, Pithecelobium unguis-cati, Bauhinia excisa, Bauhinia cumanensis, Cecropia peltata, Aframomum melegueta, Aristolochia rugosa, Aristolochia trilobata, Jatropha curcas, Jatropha gossypifolia, Nicotiana tabacum, Vernonia scorpioides, Petiveria alliacea, Renealmia alpinia, Justicia secunda, Phyllanthus urinaria,Phyllanthus niruri,Momordica charantia, Xiphidium caeruleum, Ottonia ovata, Lepianthes peltata, Capsicum frutescens, Costus scaber, Dendropanax arboreus, Siparuma guianensis, Syngonium podophyllum, Monstera dubia, Solanum species, Eclipta prostrata, Spiranthes acaulis, Croton gossypifolius, Barleria lupulina, Cola nitida, Acrocomia ierensis (tentative ID). Plant use is based on odour, and plant morphological characteristics and is embedded in a complex cultural context based on indigenous Amerindian beliefs. It is suggested that the medicinal plants exerted a physiological action on the hunter or his dog. Some of the plants mentioned contain chemicals that may explain the ethnomedicinal and ethnoveterinary use. For instance some of the plants influence the immune system or are effective against internal and external parasites. Plant baths may contribute to the health and well being of the hunting dogs.
Directory of Open Access Journals (Sweden)
O. A. Zemlyanukhina
2016-01-01
Full Text Available The development of evidence-based methods of reproduction of protected and highly decorative species that are in high demand for use in landscaping, as well as the establishment of gene pools of species and varieties of plants in actively growing collection corresponds to the main direction of the state coordination program for the development of biotechnology in the Russian Federation until 2020 «BIO 2020». The on-standing research developed and optimized the conditions for obtaining actively proliferating cultures of 5 disappearing species; Campanula rotundifolia L., Campanula persicifolia L., Campanula trachelium L., Campanula rapunculoides L., Campanula glomerata L. Optimized conditions of rhizogenesis. The effect of the different sterilization and antibiotics concentration (kanamycin, benzyl penicillin, gentamicin, klaforan on the growth and development of adventitious plants has been studied. Solutions of antibiotics for sterilization in addition to chlorine-containing agent («Belizna» and mercury (thimerosal are needed. The possible negative effects of the addition of antibiotics in incubation solution lead to increasing of somaclonal variation, neсrosis, disturbance of chlorine synthesis («fatal lack of chlorophyll», slow down the growth of adventitious shoots, and others. It is proposed LED lighting culture in a rack 16 hour period lighting LED strip 12 V power 4.5 W/m (3 LED 10 cm tape, general illumination of 2500–3000 lux. Each shelf is added with red tape photodiodes. The results allow, if necessary, to obtain plantation quantity of these kinds of Campanula in a short time.
Directory of Open Access Journals (Sweden)
Jin Bae Weon
2013-01-01
Full Text Available Codonopsis lanceolata (Campanulaceae have been traditionally used to treat lung inflammatory diseases, such as asthma, tonsillitis, and pharyngitis. The present study was performed to evaluate the cognitive-enhancing effects of steamed and fermented C. lanceolata in scopolamine-induced memory impairments in mice. Cognitive abilities were determined by the Morris water maze and passive avoidance tests. Mice orally received fermented C. lanceolata extract at doses of 100, 300, or 500 mg/kg body weight. Fermented C. lanceolata extract (500 mg/kg body weight, p.o. significantly shortened the escape latency times that were increased by scopolamine on the 4th day of trial sessions in the Morris water maze task. In addition, it exerted longer step-through latency times than those of the scopolamine-treated group in the passive avoidance test. Furthermore, the neuroprotective effects of fermented C. lanceolata extract on glutamate-induced neurocytotoxicity were investigated in HT22 cells. Fermented C. lanceolata extract showed a relative protection ratio of 59.62% at 500 μg/mL. In conclusion, fermented C. lanceolata extract ameliorated scopolamine-induced memory impairments, exerted neuroprotective effects, and improved activity compared to that found with original C. lanceolata. Further study will be required to investigate the mechanisms underlying this cognitive-enhancing activity.
International Nuclear Information System (INIS)
Brown, Carolyn J.M.; Knight, Brendan W.; McMaster, Mark E.; Munkittrick, Kelly R.; Oakes, Ken D.; Tetreault, Grald R.; Servos, Mark R.
2011-01-01
Fish community changes associated with a tertiary treated municipal wastewater effluent outfall in the Speed River, Ontario, Canada, were evaluated at nine sites over two seasons (2008) using standardized electrofishing. Habitat evaluations were conducted to ensure that the riffle sites selected were physically similar. The fish community was dominated by several species of darters that differed in their response to the effluent outfall. There was a significant decrease in Greenside Darter (Etheostoma blennioides) but an increase in Rainbow Darter (E. caeruleum) abundance directly downstream of the outfall. Stable isotope signatures (δ 13 C and δ 15 N), which indicate shifts in energy utilization and flow, increased in Rainbow Darter downstream, but showed no change in Greenside Darter. Rainbow Darter may be exploiting a food source that is not as available at upstream sites giving them a competitive advantage over the Greenside Darter immediately downstream of the outfall. - Highlights: → Fish communities are altered by tertiary treated municipal wastewater exposure. → Relative abundance of the two dominant fish (darter) species changed downstream. → Differing stable isotope signatures in fish suggests shifting energy flow and diet. → The altered environment may allow resilient species a competitive advantage. → The system recovers quickly downstream. - Tertiary treated effluent altered fish community composition in a small receiving stream possibly as a result of altered availability of resources (diet) as indicated by stable isotopes.
Repeated evolution of vertebrate pollination syndromes in a recently diverged Andean plant clade.
Lagomarsino, Laura P; Forrestel, Elisabeth J; Muchhala, Nathan; Davis, Charles C
2017-08-01
Although specialized interactions, including those involving plants and their pollinators, are often invoked to explain high species diversity, they are rarely explored at macroevolutionary scales. We investigate the dynamic evolution of hummingbird and bat pollination syndromes in the centropogonid clade (Lobelioideae: Campanulaceae), an Andean-centered group of ∼550 angiosperm species. We demonstrate that flowers hypothesized to be adapted to different pollinators based on flower color fall into distinct regions of morphospace, and this is validated by morphology of species with known pollinators. This supports the existence of pollination syndromes in the centropogonids, an idea corroborated by ecological studies. We further demonstrate that hummingbird pollination is ancestral, and that bat pollination has evolved ∼13 times independently, with ∼11 reversals. This convergence is associated with correlated evolution of floral traits within selective regimes corresponding to pollination syndrome. Collectively, our results suggest that floral morphological diversity is extremely labile, likely resulting from selection imposed by pollinators. Finally, even though this clade's rapid diversification is partially attributed to their association with vertebrate pollinators, we detect no difference in diversification rates between hummingbird- and bat-pollinated lineages. Our study demonstrates the utility of pollination syndromes as a proxy for ecological relationships in macroevolutionary studies of certain species-rich clades. © 2017 The Author(s). Evolution © 2017 The Society for the Study of Evolution.
DEFF Research Database (Denmark)
Friis, Ib; Phillips, Sylvia M.; Gilbert, Michael G.
2011-01-01
During recent field work by Ib Friis and Sally Bidgood six collections were collected that did not represent taxa accounted for in the Flora of Ethiopia and Eritrea. These were Phyllanthus chevalieri, Indigofer bracteolata, Wahlenbergia paludicola, Clerodendrum triflorum, Tragus mongolorum and Hy...
Ren, Zong-Xin; Wang, Hong; Bernhardt, Peter; Li, De-Zhu
2014-10-01
An increasing global demand for food, coupled with the widespread decline of pollinator diversity, remains an international concern in agriculture and genetic conservation. In particular, there are large gaps in the study of the pollination of economically important and traditionally grown species in China. Many plant species grown in China are both edible and used medicinally. The country retains extensive written records of agricultural and apicultural practices, facilitating contemporary studies of some important taxa. Here, we focus on Yunnan in southwestern China, a mega-biodiversity hotspot for medicinal/food plants. We used plant and insect taxa as model systems to understand the patterns and consequences of pollinator deficit to crops. We identified several gaps and limitations in research on the pollination ecology and breeding systems of domesticated taxa and their wild relatives in Yunnan and asked the following questions: (1) What is known about pollination systems of edible and medicinal plants in Yunnan? (2) What are the most important pollinators of Codonopsis subglobosa (Campanulaceae)? (3) How important are native pollinator species for maximizing yield in Chinese crops compared with the introduced Apis mellifera? We found that some crops that require cross-pollination now depend exclusively on hand pollination. Three domesticated crops are dependent primarily on the native but semidomesticated Apis cerana and the introduced A. mellifera. Other species of wild pollinators often play important roles for certain specialty crops (e.g., Vespa velutina pollinates Codonopsis subglobosa). We propose a more systematic and comprehensive approach to applied research in the future. © 2014 Botanical Society of America, Inc.
Directory of Open Access Journals (Sweden)
Chunhua eMa
2016-05-01
Full Text Available Background: Platycodon grandiflorum is the only species in the genus Platycodon of the family Campanulaceae, which has been traditionally used as a medicinal plant for its lung-heat-clearing, antitussive, and expectorant properties in China, Japanese and Korean. Oleanane-type triterpenoid saponins were the main chemical components of P. grandiflorum and platycodin D was the abundant and main bioactive component, but little is known about their biosynthesis in plants. Hence, P. grandiflorum is an ideal medicinal plant for studying the biosynthesis of Oleanane-type saponins. In addition, the genomic information of this important herbal plant is unavailable.Principal Findings:A total of 58,580,566 clean reads were obtained, which were assembled into 34,053 unigenes, with an average length of 936 bp and N50 of 1,661 bp by analyzing the transcriptome data of P. grandiflorum. Among these 34,053 unigenes, 22,409 unigenes (65.80% were annotated based on the information available from public databases, including Nr, NCBI, Swiss-Prot, KOG and KEGG. Furthermore, 21 candidate cytochrome P450 genes and 17 candidate UDP-glycosyltransferase genes most likely involved in triterpenoid saponins biosynthesis pathway were discovered from the transcriptome sequencing of P. grandiflorum. In addition, 10,626 SSRs were identified based on the transcriptome data, which would provide abundant candidates of molecular markers for genetic diversity and genetic map for this medicinal plant.Conclusion:The genomic data obtained from P. grandiflorum, especially the identification of putative genes involved in triterpenoid saponins biosynthesis pathway, will facilitate our understanding of the biosynthesis of triterpenoid saponins at molecular level.
ANATOMIC STRUCTURE OF CAMPANULA ROTUNDIFOLIA L. GRASS
Directory of Open Access Journals (Sweden)
V. N. Bubenchikova
2017-01-01
Full Text Available The article present results of the study for a anatomic structure of Campanula rotundifolia grass from Campanulaceae family. Despite its dispersion and application in folk medicine, there are no data about its anatomic structure, therefore to estimate the indices of authenticity and quality of raw materials it is necessary to develop microdiagnostical features in the first place, which could help introducing of thisplant in a medical practice. The purpose of this work is to study anatomical structureof Campanula rotundifolia grass to determine its diagnostic features. Methods. Thestudy for anatomic structure was carried out in accordance with the requirements of State Pharmacopoeia, edition XIII. Micromed laboratory microscope with digital adjutage was used to create microphotoes, Photoshop CC was used for their processing. Result. We have established that stalk epidermis is prosenchymal, slightly winding with straight of splayed end cells. After study for the epidermis cells we established that upper epidermis cells had straight walls and are slightly winding. The cells of lower epidermishave more winding walls with prolong wrinkled cuticule. Presence of simple one-cell, thin wall, rough papillose hair on leaf and stalk epidermis. Cells of epidermis in fauces of corolla are prosenchymal, with winding walls, straight or winding walls in a cup. Papillary excrescences can be found along the cup edges. Stomatal apparatus is anomocytic. Conclusion. As the result of the study we have carried out the research for Campanula rotundifolia grass anatomic structure, and determined microdiagnostic features for determination of raw materials authenticity, which included presence of simple, one-cell, thin-walled, rough papillose hair on both epidermises of a leaf, along the veins, leaf edge, and stalk epidermis, as well as the presence of epidermis cells with papillary excrescences along the edges of leaves and cups. Intercellular canals are situatedalong the
Gorelov, Yury; Kurganskaya, Lubov; Ilyin, Vyacheslav; Ruzaeva, Irina; Rozno, Svetlana; Kavelenova, Ludmila
species of Samara region (Clematis integrifolia L.; Aster alpinus L.; Dianthus andrzejowskianus Kulcz.; Linum perenne L.; Polemonium caeruleum L.; Primula macrocalyx Bunge; Iris pumila L.; Lilium martagon L.; Pulsatilla patens (L.) Mill., 8 from 9 are the plants of Samara Region Reed book) were packed into 3 marked plastic test tubes (Ø12/75, 4 ml). After the landing of “Bion-M” the seeds were sown on the experimental plot in the Botanical garden of Samara State University (25 July 2013). The sow time was near to the time of seeds ripening when they can fall on the ground in natural ecosystems. The abundant rains in the beginning of August 2013 made the beneficial conditions for sprouting and the first seedlings we found 10-15 days after sowing. The ground germination parameters varied from 3 to 78% for 6 different species (Clematis integrifolia L. 3%; Dianthus andrzejowskianus Kulcz. 8%; Pulsatilla patens (L.) Mill 15%; .Linum perenne L. 67%; Polemonium caeruleum L. 75%; Iris pumila L. 78%), whereas 3 species did not sprout for that time (Lilium martagon L.; Aster alpinus L.; Primula macrocalyx Bunge). The most native flora species normally have no synchronic seed germination and many seeds each year are added in soil seed bank. Many ripe seeds are in dormancy that must be removed passing by autumn-winter period. That is a possible reason of seedlings absence in 3 of our species. We can mention the increase of ground germination parameters (comparing with their common germination levels) for Linum perenne L. and Iris pumila L. as a positive (stimulating) effect of space flight factors complex. These seeds normally never demonstrate germination on the level of 70-80%. Also we found the increase of plants diversity on their initial stage of development. Some more developed and big specimens appeared among the seedlings, what more clearly demonstrated Linum perenne L. and Iris pumila L.. Maybe such heterogeneity is connected with different seed mass and size what
Berrendero, Esther; Arenas, Concha; Mateo, Pilar; Jones, Brian
2016-05-01
The River Piedra in the Monasterio de Piedra Natural Park (NE Spain) is a modern tufa-depositing river that encompasses various depositional environments that are inhabited by different cyanobacterial populations. Molecular (16S rDNA) and morphological analyses of the cyanobacteria from different facies showed that Phormidium incrustatum dominates in the fast-flowing water areas where the mean depositional rate is 1.6 cm/year. Stromatolites in these areas are formed of palisades of hollow calcite tubes (inner diameter of 6.0-7.5 μm, walls 2-12 μm thick) that formed through calcite encrustation around the filaments followed by decay of the trichomes. In contrast, in slow-flowing water areas with lower depositional rates (mean depositional rate of 0.3 cm/year), Phormidium aerugineo-caeruleum is the dominant species. In these areas, randomly oriented calcite tubes (inner diameter of 5-6 μm, walls 3-8 μm thick) formed by calcite encrustation, are found in thin and uneven laminae and as scattered tubes in the loose lime mud and sand-sized carbonate sediment. Although this species did not build laminated deposits, it gave cohesiveness to the loose sediment. In the stepped and low waterfalls, with intermediate deposition rates (mean depositional rate of 0.9 cm/year), both species of Phormidium are found in association with spongy moss and algal boundstones, which is consistent with the variable flow conditions in this setting. The calcite encrustations on the cyanobacteria from different environments exhibit irregular patterns that may be linked to changes in the calcite saturation index. The physicochemical conditions associated with extracellular polymeric substances may be more significant to CaCO3 precipitation in microbial mats in slow-flowing water conditions than in fast-flowing water conditions. These results show that flow conditions may influence the distribution of different cyanobacteria that, in turn, leads to the development of different sedimentary
Energy Technology Data Exchange (ETDEWEB)
Rahman, Zaharah Abd; R, Bah Abd [Universiti Putra Malaysia, Serdang (Malaysia). Dept of Land Management
2002-07-01
Alleviating P deficiency with natural inorganic phosphates and organic residues has significant economic and environmental advantages in the tropics. However, adapting this technology to various agroecosystems requires greater understanding of P dynamics in such systems. This was studied in an amended Bungor soil in laboratory incubation and glasshouse experiments. Treatments were a factorial combination of green manures GMs (Calopogonium caeruleum, Gliricidia sepium and Imperata cylindrica) and P fertilizers (phosphate rocks (PRs)) from China and Algeria, in 3 replications. The GMs were labeled with {sup 33}P in the glasshouse trial. Olsen P, mineral N, exchangeable Ca and pH were monitored in the incubation at 0,1,2,4,8,16,32 and 64 weeks after establishment (WAE). Soil P fractions were also determined at 64 WAE. Phosphorus available from the amendments at 4, 8, 15, and 20 WAE, was quantified by {sup 33}P-{sup 32}P double isotopic labeling in the glasshouse using Setaria sphacelata (Setaria grass) as test crop. Olsen P was unaffected by the sole P fertilizers, and hardly changed within 16 WAE in the legume GM and legume GM+PR treatments as NH{sub 4}{sup +}-N accumulated and soil pH increased. Afterwards Olsen P and exchangeable Ca increased as NH{sub 4}{sup +}-N and soil pH declined. The legume GMs augmented reversibly sorbed P in Al-P and Fe-P fractions resulting in high residual effect, but fertilizers was irreversibly retained. GM-P availability was very low (< 4%), but GMs enhanced PR solubility and mobilized soil P irrespective of quality, probably by the action of organic acids. Calcium content had negative effect on available P and should be considered when selecting compatible materials in integrated systems. The results are further evidence of the importance of the soil P mobilization capacity of organic components in integrated P management systems. Even low quality Imperata can augment soil P supply when combined with the reactive APR, probably by
International Nuclear Information System (INIS)
Zaharah Abd Rahman; Bah Abd R
2002-01-01
Alleviating P deficiency with natural inorganic phosphates and organic residues has significant economic and environmental advantages in the tropics. However, adapting this technology to various agroecosystems requires greater understanding of P dynamics in such systems. This was studied in an amended Bungor soil in laboratory incubation and glasshouse experiments. Treatments were a factorial combination of green manures GMs (Calopogonium caeruleum, Gliricidia sepium and Imperata cylindrica) and P fertilizers (phosphate rocks (PRs) from China and Algeria, in 3 replications. The GMs were labeled with 33 P in the glasshouse trial. Olsen P, mineral N, exchangeable Ca and pH were monitored in the incubation at 0,1,2,4,8,16,32 and 64 weeks after establishment (WAE). Soil P fractions were also determined at 64 WAE. Phosphorus available from the amendments at 4, 8, 15, and 20 WAE, was quantified by 33 P- 32 P double isotopic labeling in the glasshouse using Setaria sphacelata (Setaria grass) as test crop. Olsen P was unaffected by the sole P fertilizers, and hardly changed within 16 WAE in the legume GM and legume GM+PR treatments as NH 4 + -N accumulated and soil pH increased. Afterwards Olsen P and exchangeable Ca increased as NH 4 + -N and soil pH declined. The legume GMs augmented reversibly sorbed P in Al-P and Fe-P fractions resulting in high residual effect, but fertilizers was irreversibly retained. GM-P availability was very low (< 4%), but GMs enhanced PR solubility and mobilized soil P irrespective of quality, probably by the action of organic acids. Calcium content had negative effect on available P and should be considered when selecting compatible materials in integrated systems. The results are further evidence of the importance of the soil P mobilization capacity of organic components in integrated P management systems. Even low quality Imperata can augment soil P supply when combined with the reactive APR, probably by conserving soil moisture. (Author)
Directory of Open Access Journals (Sweden)
Abdul R. Bah
2004-01-01
Full Text Available Integrated nutrient management systems using plant residues and inorganic P fertilizers have high potential for increasing crop production and ensuring sustainability in the tropics, but their adoption requires in-depth understanding of nutrient dynamics in such systems. This was examined in a highly weathered tropical soil treated with green manures (GMs and P fertilizers in two experiments conducted in the laboratory and glasshouse. The treatments were factorial combinations of the GMs (Calopogonium caeruleum, Gliricidia sepium, and Imperata cylindrica and P fertilizers (phosphate rocks [PRs] from North Carolina, China, and Algeria, and triple superphosphate replicated thrice. Olsen P, mineral N, pH, and exchangeable K, Ca, and Mg were monitored in a laboratory incubation study for 16 months. The change in soil P fractions and available P was also determined at the end of the study. Phosphorus available from the amendments was quantified at monthly intervals for 5 months by 33P-32P double isotopic labeling in the glasshouse using Setaria sphacelata as test crop. The GMs were labeled with 33P to determine their contribution to P taken up by Setaria, while that from the P fertilizers was indirectly measured by labeling the soil with 32P. The P fertilizers hardly changed Olsen P and exchangeable cations during 16 months of incubation. The legume GMs and legume GM+P did not change Olsen P, lowered exchangeable Ca, and increased exchangeable K about threefold (4.5 cmol[+]kg−1 soil in the first 4 months, even as large amounts of NH4-N accumulated (~1000 mg kg soil−1 and soil pH increased to more than 6.5. Afterwards, Olsen P and exchangeable Ca and Mg increased (threefold as NH4+-N and soil pH declined. The legume GMs also augmented reversibly sorbed P in Al-P and Fe-P fractions resulting in high residual effect in the soil, while fertilizer-P was irreversibly retained. The GMs increased PR-P utilization by 40 to over 80%, mobilized soil P, and
Bouchal, Johannes Martin; Güner, Tuncay H.; Denk, Thomas
2015-04-01
The subject of this study is the palynology (biostratigraphic and taxonomic) and the plant remains of the lignite strip mines of Eskihisar, Salihpasalar, and Tinaz (Muğla province, western Turkey). In the Yatağan basin two Miocene to Pliocene formations are present, the Eskihisar Formation (early to middle Miocene) and the Yatağan Formation (late Miocene to early Pliocene). Both formations represent river and lake deposits consisting mainly of conglomerate, sandstone, claystone, limestone, tuffite, and intercalated lignite; the thickest, actively mined lignite seams occur in the Sekköy member of the Eskihisar Formation. Previous palynological studies of the palynoflora of the Yatağan basin mainly focussed on its biostratigraphic and palaeoclimatic significance, using conventional morphological nomenclature and light microscopy (LM). In this study the "single grain method" is applied. Using this method, the same individual pollen grains are investigated by using both LM and scanning electron microscopy (SEM). The resulting high-resolution pictographs enable a much higher taxonomic resolution. The studied palynoflora is very rich and taxonomically diverse. Cryptogams are represented by more than ten spore morphotypes of at least three families (Osmundaceae, Pteridaceae, Polypodiaceae). Gymnosperm pollen is dominated by Cupressaceae, Gnetales (Ephedra), and Pinaceae (Cathaya, Keteleeria, Pinus). Angiosperm pollen can be assigned to 57 different genera belonging to Poaceae, Typhaceae, Altingiaceae, Amaranthaceae (Chenopodieae), Anacardiaceae, Apiaceae (three types), Asteraceae (Asteroideae, Cichoriodeae), Betulaceae (Alnus, Betula, Carpinus, Ostrya) Buxaceae, Campanulaceae, Caprifoliaceae (Lonicera), Caryophyllaceae, Dipsacaceae, Eucommiaceae, Euphorbiaceae, Fabaceae, Fagaceae (Fagus, Quercus, Trigonobalanopsis) Geraniaceae, Juglandaceae, Linaceae, Malvaceae (Tilia), Myricaceae, Oleaceae (four different types), Plumbaginaceae, Polygonaceae (Rumex), Rosaceae
Bouchal, Johannes Martin; Grímsson, Friðgeir; Denk, Thomas
2016-04-01
The excavated main lignite seams and overlying lacustrine sediments of the opencast mines Eskihisar, Salihpaşalar, and Tı naz, Muǧla Province, south-western Turkey were investigated using a high taxonomic resolution palynological approach. The Eskihisar section comprises 47m and 56 samples of which 30 were usable for palynological analysis. The Tı naz section comprises 75 m and 29 samples of which 15 were usable for palynological analysis. Finally, the Salihpaşalar section comprises 25 m and 26 samples of which 16 were usable for palynological analysis. The age of the palynological sections is middle to late Miocene based on radiometric dating and vertebrate fossils. In order to investigate dispersed pollen and spores and their botanical affinities a combined light microscopy and scanning electron microscopy approach was used. The rich palynoflora comprises: seven types of algal cysts (Botryococcus, Zygnemataceae), seventeen spore types belonging to Lycopsida (club mosses), Marsileaceae (water-clover), Osmundaceae, Pteridaceae (brake), and Polypodiaceae; 14 types of gymnosperm pollen belonging to Ephedraceae (Mormon tea), Cupressaceae, Pinaceae (Cathaya, cedar, hemlock, pine, spruce); five types of monocotyledone pollen belonging to Poaceae (grasses, common reed), and Typhaceae (bulrush, bur-reed); ca 90 dicotyledone pollen types belonging to Altingiaceae (sweet gum), Amaranthaceae (goosefoot), Anacardiaceae (sumac family), Apiaceae (parsley family), Aquifoliaceae (holly), Asteraceae (sunflower family), Betulaceae (alder, birch, hazel, hophornbeam, hornbeam), Campanulaceae (bellflower family), Cannabaceae (hackberries), Caprifoliaceae (honeysuckle, teasel family), Caryophyllaceae (pink family), Ericaceae (heather family), Eucommiaceae, Euphorbiaceae (spurge family), Fabaceae (bean family), Fagaceae (beech, oak), Geraniaceae (storkbills), Juglandaceae (hickory, walnut, wingnut), Lamiaceae (bagflower), Linaceae (flax), Lythraceae (waterwillow), Malvaceae
Directory of Open Access Journals (Sweden)
Mihaela Paucã-Comãnescu
2009-11-01
, where by May it represents up to 20% of the inferior layer's biomass; on the limestone ground they do not exceed 0.5%. The most frequent are on the soil surface: Polytrichum formosum, Pogonatum nanum, Hypnum cupressiforme, Tortella tortuosa at Sotrile and,respectively Metzgeria furcata var. ulvula, Leskea nervosa ,Ctenidium molluscum at Lunca Mare. In the Lunca Mare area, the most relevant herbaceous species in the structure of the biomass are Viola reichenbachiana, Festuca drymeja, Sanicula europaea and Campanula trachelium; in spring there are also Erytronium dens-canis and Lathyrus vernus. In the Sotrile area these are: Luzula luzuloides, Carex digitata, Calamagrostis arundinacea and Hieracium transsylvanicum, in both spring and autumn. Hedera helix, present especially at the surface, is the most frequent and bestrepresented in terms of biomass in both beech forests, and in particular in the Lunca Mare site.The species characteristic to the phytocoenological association and to the allianceswhere these beech forests are included are representative through their biomass for the Hieracio rotundati-Fagetum association, while the orchids species characteristic to associations present on the limestone ground, although very diverse and with a great number of individuals for this taxonomic group, are not representative, neitheras frequency nor as biomass or density, compared to other herbal species with a larger coenotic value, which are included in the Epipactieto-Fagetum association. The necromass accumulated in the area analyzed decays slowly, varying greatly with surfaceand time. It averages 4492 kg/ha in the Lunca Mare area and 4134 kg/ha in the Sotrile area. The necromass is made mostly of fallen leaves, and, at least in the Lunca Mare area, the July values are amplified by vernal herb flora.
Directory of Open Access Journals (Sweden)
Mihaela Paucã-Comãnescu
2009-12-01
area, where by May it represents up to 20% of the inferior layer's biomass; on the limestone ground they do not exceed 0.5%. The most frequent are on the soil surface: Polytrichum formosum, Pogonatum nanum, Hypnum cupressiforme, Tortella tortuosa at Sotrile and, respectively Metzgeria furcata var. ulvula, Leskea nervosa , Ctenidium molluscum at Lunca Mare. In the Lunca Mare area, the most relevant herbaceous species in the structure of the biomass are Viola reichenbachiana, Festuca drymeja, Sanicula europaea and Campanula trachelium; in spring there are also Erytronium dens-canis and Lathyrus vernus. In the Sotrile area these are: Luzula luzuloides, Carex digitata, Calamagrostis arundinacea and Hieracium transsylvanicum, in both spring and autumn. Hedera helix, present especially at the surface, is the most frequent and best represented in terms of biomass in both beech forests, and in particular in the Lunca Mare site. The species characteristic to the phytocoenological association and to the alliances where these beech forests are included are representative through their biomass for the Hieracio rotundati-Fagetum association, while the orchids species characteristic to associations present on the limestone ground, although very diverse and with a great number of individuals for this taxonomic group, are not representative, neither as frequency nor as biomass or density, compared to other herbal species with a larger coenotic value, which are included in the Epipactieto-Fagetum association. The necromass accumulated in the area analyzed decays slowly, varying greatly with surface and time. It averages 4492 kg/ha in the Lunca Mare area and 4134 kg/ha in the Sotrile area. The necromass is made mostly of fallen leaves, and, at least in the Lunca Mare area, the July values are amplified by vernal herb flora.